4F5BA

Triple mutant src sh2 domain bound to phosphotyrosine
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
108
structure length
108
Chain Sequence
DSIQAEEWYFGKITRRESERLLLNAENPRGTFLVRESETVKGAYALSVSDFDNAKGLNVKHYLIRKLDSGGFYITSRTQFNSLQQLVAYYSKHADGLCHRLTTVCPTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Superbinder SH2 Domains Act as Antagonists of Cell Signaling.
pubmed doi rcsb
molecule keywords Proto-oncogene tyrosine-protein kinase Src
molecule tags Protein binding
source organism Homo sapiens
total genus 28
structure length 108
sequence length 108
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2012-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00017 SH2 SH2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.505.10 Alpha Beta 2-Layer Sandwich SHC Adaptor Protein SH2 domain 4f5bA00
1RJAA 1SKJA 2DCRA 2EYYA 1LUKA 2OZOA 1JYRA 3C7IA 4OHEA 3GXXA 1SHAA 1O48A 4OHDA 3TKZA 1KC2A 3PQZA 2CI8A 1O4NA 3WA4A 5CDWA 1CWEA 5EELA 1BHFA 4EIHA 2IUIA 4F5BA 2L4KA 3BUMB 1CSYA 1X6CA 2HCKA 3CXLA 4FL3A 5AXIA 1O4MA 4FL2A 1BFIA 3IN7A 4E93A 2LCTA 1XA6A 1AOTF 5HKYA 4K45A 5EEQA 1QCFA 1JU5A 1D4TA 1JYQA 2DM0A 1FYRA 1FU5A 2JYQA 1LUNA 5KAZA 1Y1UA 3PJPA 4L1BB 4QSYA 2ETZA 1O4EA 4K11A 1Z3KA 2CIAA 3BUXB 3PSJA 3VS5A 1A1EA 5DC9A 1F2FA 2OQ1A 2H8HA 2CRHA 2MC1A 4NWGA 3ZNIA 5D0JA 3UF4A 1A07A 2HDVA 2Y1NA 3OVEA 1O4GA 1BKMA 2C0OA 1TCEA 4F59A 4U17A 4E68A 1LUMA 1FBZA 3UYOA 2RSYA 5EHPA 3K2MA 3HIZB 1LKKA 1O4CA 1O4IA 4OHHA 5HKWA 3IMJA 4K44A 1AYDA 2ABLA 1SHDA 1O4FA 4P9ZA 1OPLA 5DC0B 3QWXX 1UURA 3OV1A 4LUDA 4DGPA 1O41A 1IS0A 2VIFA 2RVFA 2YSXA 4OHLA 2C0TA 4XZ0A 2C9WA 2HMHA 5GJHA 3VRYA 1BLKA 3MXCA 4JGHA 1A81A 1M27A 1O4LA 5DC4A 4XZ1A 1O4OA 1D4WA 3VS4A 1OPKA 3VGOA 1GRIA 1BKLA 2EYZA 1X27A 2XP1A 2FO0A 5I6VA 1AYCA 3PS5A 2C0IA 4ROJA 1O4PA 1FU6A 1O43A 2RORA 4GPLB 1OO4A 1G83A 2L6KA 2Y3AB 3TL0A 1AOUF 2MRKA 4TZIA 3CBLA 3PSKA 1BLJA 3VRZA 1RQQC 3VS6A 1BHHA 1X0NA 1ZFPE 4P9VA 2PLDA 4FBNA 1BF5A 1P13A 4WWQA 3HCKA 2CS0A 2SHPA 1NZVA 3VROA 1QG1E 1KA6A 3VS3A 2PLEA 4D8KA 1KA7A 2IUHA 1AYAA 2K79B 2CI9A 1I3ZA 2LQWA 2KNOA 4X6SA 3S8NA 3BKBA 3VS0A 3N84A 1B47A 1SHBA 1BHHB 1OO3A 3OP0A 1R1SA 3T04A 2DX0A 1LKLA 3OB2B 3PFVA 3BUWB 4M4ZA 4GL9E 4A4BA 3EAZA 3VS2A 5GJIA 2AOBA 2H5KA 2SRCA 3PLFB 3S8OA 3CWGA 1NZLA 1WQUA 1FHSA 1PICA 2HDXA 1AYBA 2MRJA 1QADA 2LNXA 2K7AB 2EKXA 5BO4A 1A08A 1O4RA 1A1CA 1O4HA 3BUNB 4H34A 2EL8A 2Y1MA 3MXYA 1O45A 2IUGA 5EG3B 4GWFA 2HUWA 5EHRA 1O49A 1D1ZA 3IN8A 3KFJA 1JYUA 1O4DA 3IMDA 2RMXA 3VRPA 2PNBA 2B3OA 3QWYA 1HCSB 1CJ1A 3NHNA 1JWOA 2L3TA 2GSBA 1HCTB 1R1QA 4A4CA 1LUIA 1RPYA 1O42A 1F1WA 3N7YA 1GHUA 1CWDL 1SPRA 2H46E 2AUGA 1FMKA 5IBSA 1BG1A 2GE9A 2DVJA 1K9AA 4K2RA 1A1BA 1MW4A 1A1AA 4JEGA 5AULA 5IBMA 4U1PA 2DLYA 1AD5A 5HKZA 1BMBA 1NRVA 3OB1B 1A09A 2DLZA 1O4QA 2ECDA 1YVHA 1LCJA 2EOBA 3VRQA 1CSZA 3M7FA 1O4JA 2CBLA 3HHMB 3VRRA 1LCKA 3MAZA 4LUEA 2CR4A 1YVLA 2EU0A 5DF6A 2YU7A 2PNAA 1AB2A 3N8MA 2MK2A 3GXWA 1FBVA 4NWFA 2MQIA 1TZEE 1M61A 1O4AA 2EYVA 1Y57A 4H1OA 2FCIA 1IJRA 4F5AA 2IZVA 1O46A 1SPSA 3EACA 1O47A 4EY0A 2EO6A 3CD3A 1BM2A 2EO3A 4DGXA 3US4A 1R1PA 5J3XA 1H9OA 2BBUA 3VRNA 3S8LA 1O44A 1O4KA 2PTKA 2QMSA 3GQIB 4JE4A 3VS7A 1KSWA 2LQNA 1BFJA 3VS1A 1O4BA 2LNWA 3BUOB 3S9KA 2AOAA 2KK6A 1MILA 4OHIA 1UUSA
chains in the Genus database with same CATH superfamily
1RJAA 1SKJA 2DCRA 2EYYA 1LUKA 2OZOA 1JYRA 3C7IA 4OHEA 3GXXA 1SHAA 1O48A 4OHDA 3TKZA 1KC2A 3PQZA 2CI8A 1O4NA 3WA4A 5CDWA 1CWEA 5EELA 1BHFA 4EIHA 2IUIA 4F5BA 2L4KA 3BUMB 1CSYA 1X6CA 2HCKA 3CXLA 4FL3A 5AXIA 1O4MA 4FL2A 3LYVA 1BFIA 3IN7A 4E93A 2LCTA 1XA6A 1AOTF 5HKYA 4K45A 5EEQA 1QCFA 1JU5A 1D4TA 1JYQA 2DM0A 1FYRA 1FU5A 2JYQA 1LUNA 5KAZA 1Y1UA 3PJPA 4L1BB 4QSYA 2ETZA 1O4EA 4K11A 1Z3KA 2CIAA 3BUXB 3PSJA 3VS5A 1A1EA 5DC9A 1F2FA 2OQ1A 2H8HA 2CRHA 2MC1A 4NWGA 3ZNIA 5D0JA 3UF4A 1A07A 2HDVA 2Y1NA 3OVEA 1O4GA 1BKMA 2C0OA 1TCEA 4F59A 4U17A 4E68A 1LUMA 1FBZA 3UYOA 2RSYA 5EHPA 3K2MA 3HIZB 1LKKA 1O4CA 1O4IA 4OHHA 5HKWA 3IMJA 4K44A 1AYDA 2ABLA 1SHDA 1O4FA 4P9ZA 1OPLA 5DC0B 3QWXX 1UURA 3OV1A 4LUDA 4DGPA 1O41A 1IS0A 2VIFA 2RVFA 2YSXA 4OHLA 2C0TA 4XZ0A 2C9WA 2HMHA 5GJHA 3VRYA 1BLKA 3MXCA 4JGHA 1A81A 1M27A 1O4LA 5DC4A 4XZ1A 1O4OA 1D4WA 3VS4A 1OPKA 3VGOA 1GRIA 1BKLA 2EYZA 1X27A 2XP1A 2FO0A 5I6VA 1AYCA 3PS5A 2C0IA 4ROJA 1O4PA 1FU6A 1O43A 2RORA 4GPLB 1OO4A 1G83A 2L6KA 2Y3AB 3TL0A 1AOUF 2MRKA 4TZIA 3CBLA 3PSKA 1BLJA 3VRZA 1RQQC 3VS6A 1BHHA 1X0NA 1ZFPE 4P9VA 2PLDA 4FBNA 1BF5A 1P13A 4WWQA 3HCKA 2CS0A 2SHPA 1NZVA 3VROA 1QG1E 1KA6A 3VS3A 2PLEA 4D8KA 1KA7A 2IUHA 1AYAA 2K79B 2CI9A 1I3ZA 2LQWA 2KNOA 4X6SA 3S8NA 3BKBA 3VS0A 3N84A 1B47A 1SHBA 1BHHB 1OO3A 3OP0A 1R1SA 3T04A 2DX0A 1LKLA 3OB2B 2LRAA 3PFVA 3BUWB 4M4ZA 4GL9E 4A4BA 3EAZA 3VS2A 5GJIA 2AOBA 2H5KA 2SRCA 3PLFB 3S8OA 3CWGA 1NZLA 1WQUA 1FHSA 1PICA 2HDXA 1AYBA 2MRJA 1QADA 2LNXA 2K7AB 2EKXA 5BO4A 1A08A 1O4RA 1A1CA 1O4HA 3BUNB 4H34A 2EL8A 2Y1MA 3MXYA 1O45A 2IUGA 5EG3B 4GWFA 2HUWA 5EHRA 1O49A 1D1ZA 3IN8A 3KFJA 1JYUA 1O4DA 3IMDA 2RMXA 3VRPA 2PNBA 2B3OA 3QWYA 1HCSB 1CJ1A 2KGYA 3NHNA 1JWOA 2L3TA 3K2TA 2GSBA 1HCTB 1R1QA 4A4CA 1LUIA 1RPYA 1O42A 1F1WA 3N7YA 1GHUA 1CWDL 1SPRA 2H46E 2AUGA 1FMKA 5IBSA 1BG1A 2GE9A 2DVJA 1K9AA 4K2RA 1A1BA 1MW4A 1A1AA 4JEGA 5AULA 5IBMA 4U1PA 2DLYA 1AD5A 5HKZA 1BMBA 1NRVA 3OB1B 1A09A 2DLZA 1O4QA 2ECDA 1YVHA 1LCJA 2EOBA 3VRQA 1CSZA 3M7FA 1O4JA 2CBLA 3HHMB 3VRRA 1LCKA 3MAZA 4LUEA 2CR4A 1YVLA 2EU0A 5DF6A 2YU7A 2PNAA 1AB2A 3N8MA 2MK2A 3GXWA 1FBVA 4NWFA 2MQIA 1TZEE 1M61A 1O4AA 2EYVA 1Y57A 4H1OA 2FCIA 1IJRA 4F5AA 2IZVA 1O46A 1SPSA 3EACA 1O47A 4EY0A 2EO6A 3CD3A 1BM2A 2EO3A 4DGXA 3US4A 1R1PA 5J3XA 1H9OA 2BBUA 3VRNA 3S8LA 1O44A 1O4KA 2PTKA 2QMSA 3GQIB 4JE4A 3VS7A 1KSWA 2LQNA 1BFJA 3VS1A 1O4BA 2LNWA 3BUOB 3S9KA 2AOAA 2KK6A 1MILA 4OHIA 1UUSA
chains in the Genus database with same CATH topology
1RJAA 1SKJA 2DCRA 2EYYA 1LUKA 2OZOA 1JYRA 3C7IA 4OHEA 3GXXA 1SHAA 1O48A 4OHDA 3TKZA 1KC2A 3PQZA 2CI8A 1O4NA 3WA4A 5CDWA 1CWEA 5EELA 1BHFA 4EIHA 2IUIA 4F5BA 2L4KA 3BUMB 1CSYA 1X6CA 2HCKA 3CXLA 4FL3A 5AXIA 1O4MA 4FL2A 1BFIA 3IN7A 4E93A 2LCTA 1XA6A 1AOTF 5HKYA 4K45A 5EEQA 1QCFA 1JU5A 1D4TA 1JYQA 2DM0A 1FYRA 1FU5A 2JYQA 1LUNA 5KAZA 1Y1UA 3PJPA 4L1BB 4QSYA 2ETZA 1O4EA 4K11A 1Z3KA 2CIAA 3BUXB 3PSJA 3VS5A 1A1EA 5DC9A 1F2FA 2OQ1A 2H8HA 2CRHA 2MC1A 4NWGA 3ZNIA 5D0JA 3UF4A 1A07A 2HDVA 2Y1NA 3OVEA 1O4GA 1BKMA 2C0OA 1TCEA 4F59A 4U17A 4E68A 1LUMA 1FBZA 3UYOA 2RSYA 5EHPA 3K2MA 3HIZB 1LKKA 1O4CA 1O4IA 4OHHA 5HKWA 3IMJA 4K44A 1AYDA 2ABLA 1SHDA 1O4FA 4P9ZA 1OPLA 5DC0B 3QWXX 1UURA 3OV1A 4LUDA 4DGPA 1O41A 1IS0A 2VIFA 2RVFA 2YSXA 4OHLA 2C0TA 4XZ0A 2C9WA 2HMHA 5GJHA 3VRYA 1BLKA 3MXCA 4JGHA 1A81A 1M27A 1O4LA 5DC4A 4XZ1A 1O4OA 1D4WA 3VS4A 1OPKA 3VGOA 1GRIA 1BKLA 2EYZA 1X27A 2XP1A 2FO0A 5I6VA 1AYCA 3PS5A 2C0IA 4ROJA 1O4PA 1FU6A 1O43A 2RORA 4GPLB 1OO4A 1G83A 2L6KA 2Y3AB 3TL0A 1AOUF 2MRKA 4TZIA 3CBLA 3PSKA 1BLJA 3VRZA 1RQQC 3VS6A 1BHHA 1X0NA 1ZFPE 4P9VA 2PLDA 4FBNA 1BF5A 1P13A 4WWQA 3HCKA 2CS0A 2SHPA 1NZVA 3VROA 1QG1E 1KA6A 3VS3A 2PLEA 4D8KA 1KA7A 2IUHA 1AYAA 2K79B 2CI9A 1I3ZA 2LQWA 2KNOA 4X6SA 3S8NA 3BKBA 3VS0A 3N84A 1B47A 1SHBA 1BHHB 1OO3A 3OP0A 1R1SA 3T04A 2DX0A 1LKLA 3OB2B 3PFVA 3BUWB 4M4ZA 4GL9E 4A4BA 3EAZA 3VS2A 5GJIA 2AOBA 2H5KA 2SRCA 3PLFB 3S8OA 3CWGA 1NZLA 1WQUA 1FHSA 1PICA 2HDXA 1AYBA 2MRJA 1QADA 2LNXA 2K7AB 2EKXA 5BO4A 1A08A 1O4RA 1A1CA 1O4HA 3BUNB 4H34A 2EL8A 2Y1MA 3MXYA 1O45A 2IUGA 5EG3B 4GWFA 2HUWA 5EHRA 1O49A 1D1ZA 3IN8A 3KFJA 1JYUA 1O4DA 3IMDA 2RMXA 3VRPA 2PNBA 2B3OA 3QWYA 1HCSB 1CJ1A 3NHNA 1JWOA 2L3TA 2GSBA 1HCTB 1R1QA 4A4CA 1LUIA 1RPYA 1O42A 1F1WA 3N7YA 1GHUA 1CWDL 1SPRA 2H46E 2AUGA 1FMKA 5IBSA 1BG1A 2GE9A 2DVJA 1K9AA 4K2RA 1A1BA 1MW4A 1A1AA 4JEGA 5AULA 5IBMA 4U1PA 2DLYA 1AD5A 5HKZA 1BMBA 1NRVA 3OB1B 1A09A 2DLZA 1O4QA 2ECDA 1YVHA 1LCJA 2EOBA 3VRQA 1CSZA 3M7FA 1O4JA 2CBLA 3HHMB 3VRRA 1LCKA 3MAZA 4LUEA 2CR4A 1YVLA 2EU0A 5DF6A 2YU7A 2PNAA 1AB2A 3N8MA 2MK2A 3GXWA 1FBVA 4NWFA 2MQIA 1TZEE 1M61A 1O4AA 2EYVA 1Y57A 4H1OA 2FCIA 1IJRA 4F5AA 2IZVA 1O46A 1SPSA 3EACA 1O47A 4EY0A 2EO6A 3CD3A 1BM2A 2EO3A 4DGXA 3US4A 1R1PA 5J3XA 1H9OA 2BBUA 3VRNA 3S8LA 1O44A 1O4KA 2PTKA 2QMSA 3GQIB 4JE4A 3VS7A 1KSWA 2LQNA 1BFJA 3VS1A 1O4BA 2LNWA 3BUOB 3S9KA 2AOAA 2KK6A 1MILA 4OHIA 1UUSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RJA A;  1SKJ A;  2DCR A;  2EYY A;  1LUK A;  2OZO A;  1JYR A;  3C7I A;  4OHE A;  3GXX A;  1SHA A;  1O48 A;  4OHD A;  3TKZ A;  1KC2 A;  3PQZ A;  2CI8 A;  1O4N A;  3WA4 A;  5CDW A;  1CWE A;  5EEL A;  1BHF A;  4EIH A;  2IUI A;  4F5B A;  2L4K A;  3BUM B;  1CSY A;  1X6C A;  2HCK A;  3CXL A;  4FL3 A;  5AXI A;  1O4M A;  4FL2 A;  1BFI A;  3IN7 A;  4E93 A;  2LCT A;  1XA6 A;  1AOT F;  5HKY A;  4K45 A;  5EEQ A;  1QCF A;  1JU5 A;  1D4T A;  1JYQ A;  2DM0 A;  1FYR A;  1FU5 A;  2JYQ A;  1LUN A;  5KAZ A;  1Y1U A;  3PJP A;  4L1B B;  4QSY A;  2ETZ A;  1O4E A;  4K11 A;  1Z3K A;  2CIA A;  3BUX B;  3PSJ A;  3VS5 A;  1A1E A;  5DC9 A;  1F2F A;  2OQ1 A;  2H8H A;  2CRH A;  2MC1 A;  4NWG A;  3ZNI A;  5D0J A;  3UF4 A;  1A07 A;  2HDV A;  2Y1N A;  3OVE A;  1O4G A;  1BKM A;  2C0O A;  1TCE A;  4F59 A;  4U17 A;  4E68 A;  1LUM A;  1FBZ A;  3UYO A;  2RSY A;  5EHP A;  3K2M A;  3HIZ B;  1LKK A;  1O4C A;  1O4I A;  4OHH A;  5HKW A;  3IMJ A;  4K44 A;  1AYD A;  2ABL A;  1SHD A;  1O4F A;  4P9Z A;  1OPL A;  5DC0 B;  3QWX X;  1UUR A;  3OV1 A;  4LUD A;  4DGP A;  1O41 A;  1IS0 A;  2VIF A;  2RVF A;  2YSX A;  4OHL A;  2C0T A;  4XZ0 A;  2C9W A;  2HMH A;  5GJH A;  3VRY A;  1BLK A;  3MXC A;  4JGH A;  1A81 A;  1M27 A;  1O4L A;  5DC4 A;  4XZ1 A;  1O4O A;  1D4W A;  3VS4 A;  1OPK A;  3VGO A;  1GRI A;  1BKL A;  2EYZ A;  1X27 A;  2XP1 A;  2FO0 A;  5I6V A;  1AYC A;  3PS5 A;  2C0I A;  4ROJ A;  1O4P A;  1FU6 A;  1O43 A;  2ROR A;  4GPL B;  1OO4 A;  1G83 A;  2L6K A;  2Y3A B;  3TL0 A;  1AOU F;  2MRK A;  4TZI A;  3CBL A;  3PSK A;  1BLJ A;  3VRZ A;  1RQQ C;  3VS6 A;  1BHH A;  1X0N A;  1ZFP E;  4P9V A;  2PLD A;  4FBN A;  1BF5 A;  1P13 A;  4WWQ A;  3HCK A;  2CS0 A;  2SHP A;  1NZV A;  3VRO A;  1QG1 E;  1KA6 A;  3VS3 A;  2PLE A;  4D8K A;  1KA7 A;  2IUH A;  1AYA A;  2K79 B;  2CI9 A;  1I3Z A;  2LQW A;  2KNO A;  4X6S A;  3S8N A;  3BKB A;  3VS0 A;  3N84 A;  1B47 A;  1SHB A;  1BHH B;  1OO3 A;  3OP0 A;  1R1S A;  3T04 A;  2DX0 A;  1LKL A;  3OB2 B;  3PFV A;  3BUW B;  4M4Z A;  4GL9 E;  4A4B A;  3EAZ A;  3VS2 A;  5GJI A;  2AOB A;  2H5K A;  2SRC A;  3PLF B;  3S8O A;  3CWG A;  1NZL A;  1WQU A;  1FHS A;  1PIC A;  2HDX A;  1AYB A;  2MRJ A;  1QAD A;  2LNX A;  2K7A B;  2EKX A;  5BO4 A;  1A08 A;  1O4R A;  1A1C A;  1O4H A;  3BUN B;  4H34 A;  2EL8 A;  2Y1M A;  3MXY A;  1O45 A;  2IUG A;  5EG3 B;  4GWF A;  2HUW A;  5EHR A;  1O49 A;  1D1Z A;  3IN8 A;  3KFJ A;  1JYU A;  1O4D A;  3IMD A;  2RMX A;  3VRP A;  2PNB A;  2B3O A;  3QWY A;  1HCS B;  1CJ1 A;  3NHN A;  1JWO A;  2L3T A;  2GSB A;  1HCT B;  1R1Q A;  4A4C A;  1LUI A;  1RPY A;  1O42 A;  1F1W A;  3N7Y A;  1GHU A;  1CWD L;  1SPR A;  2H46 E;  2AUG A;  1FMK A;  5IBS A;  1BG1 A;  2GE9 A;  2DVJ A;  1K9A A;  4K2R A;  1A1B A;  1MW4 A;  1A1A A;  4JEG A;  5AUL A;  5IBM A;  4U1P A;  2DLY A;  1AD5 A;  5HKZ A;  1BMB A;  1NRV A;  3OB1 B;  1A09 A;  2DLZ A;  1O4Q A;  2ECD A;  1YVH A;  1LCJ A;  2EOB A;  3VRQ A;  1CSZ A;  3M7F A;  1O4J A;  2CBL A;  3HHM B;  3VRR A;  1LCK A;  3MAZ A;  4LUE A;  2CR4 A;  1YVL A;  2EU0 A;  5DF6 A;  2YU7 A;  2PNA A;  1AB2 A;  3N8M A;  2MK2 A;  3GXW A;  1FBV A;  4NWF A;  2MQI A;  1TZE E;  1M61 A;  1O4A A;  2EYV A;  1Y57 A;  4H1O A;  2FCI A;  1IJR A;  4F5A A;  2IZV A;  1O46 A;  1SPS A;  3EAC A;  1O47 A;  4EY0 A;  2EO6 A;  3CD3 A;  1BM2 A;  2EO3 A;  4DGX A;  3US4 A;  1R1P A;  5J3X A;  1H9O A;  2BBU A;  3VRN A;  3S8L A;  1O44 A;  1O4K A;  2PTK A;  2QMS A;  3GQI B;  4JE4 A;  3VS7 A;  1KSW A;  2LQN A;  1BFJ A;  3VS1 A;  1O4B A;  2LNW A;  3BUO B;  3S9K A;  2AOA A;  2KK6 A;  1MIL A;  4OHI A;  1UUS A; 
#chains in the Genus database with same CATH topology
 1RJA A;  1SKJ A;  2DCR A;  2EYY A;  1LUK A;  2OZO A;  1JYR A;  3C7I A;  4OHE A;  3GXX A;  1SHA A;  1O48 A;  4OHD A;  3TKZ A;  1KC2 A;  3PQZ A;  2CI8 A;  1O4N A;  3WA4 A;  5CDW A;  1CWE A;  5EEL A;  1BHF A;  4EIH A;  2IUI A;  4F5B A;  2L4K A;  3BUM B;  1CSY A;  1X6C A;  2HCK A;  3CXL A;  4FL3 A;  5AXI A;  1O4M A;  4FL2 A;  3LYV A;  1BFI A;  3IN7 A;  4E93 A;  2LCT A;  1XA6 A;  1AOT F;  5HKY A;  4K45 A;  5EEQ A;  1QCF A;  1JU5 A;  1D4T A;  1JYQ A;  2DM0 A;  1FYR A;  1FU5 A;  2JYQ A;  1LUN A;  5KAZ A;  1Y1U A;  3PJP A;  4L1B B;  4QSY A;  2ETZ A;  1O4E A;  4K11 A;  1Z3K A;  2CIA A;  3BUX B;  3PSJ A;  3VS5 A;  1A1E A;  5DC9 A;  1F2F A;  2OQ1 A;  2H8H A;  2CRH A;  2MC1 A;  4NWG A;  3ZNI A;  5D0J A;  3UF4 A;  1A07 A;  2HDV A;  2Y1N A;  3OVE A;  1O4G A;  1BKM A;  2C0O A;  1TCE A;  4F59 A;  4U17 A;  4E68 A;  1LUM A;  1FBZ A;  3UYO A;  2RSY A;  5EHP A;  3K2M A;  3HIZ B;  1LKK A;  1O4C A;  1O4I A;  4OHH A;  5HKW A;  3IMJ A;  4K44 A;  1AYD A;  2ABL A;  1SHD A;  1O4F A;  4P9Z A;  1OPL A;  5DC0 B;  3QWX X;  1UUR A;  3OV1 A;  4LUD A;  4DGP A;  1O41 A;  1IS0 A;  2VIF A;  2RVF A;  2YSX A;  4OHL A;  2C0T A;  4XZ0 A;  2C9W A;  2HMH A;  5GJH A;  3VRY A;  1BLK A;  3MXC A;  4JGH A;  1A81 A;  1M27 A;  1O4L A;  5DC4 A;  4XZ1 A;  1O4O A;  1D4W A;  3VS4 A;  1OPK A;  3VGO A;  1GRI A;  1BKL A;  2EYZ A;  1X27 A;  2XP1 A;  2FO0 A;  5I6V A;  1AYC A;  3PS5 A;  2C0I A;  4ROJ A;  1O4P A;  1FU6 A;  1O43 A;  2ROR A;  4GPL B;  1OO4 A;  1G83 A;  2L6K A;  2Y3A B;  3TL0 A;  1AOU F;  2MRK A;  4TZI A;  3CBL A;  3PSK A;  1BLJ A;  3VRZ A;  1RQQ C;  3VS6 A;  1BHH A;  1X0N A;  1ZFP E;  4P9V A;  2PLD A;  4FBN A;  1BF5 A;  1P13 A;  4WWQ A;  3HCK A;  2CS0 A;  2SHP A;  1NZV A;  3VRO A;  1QG1 E;  1KA6 A;  3VS3 A;  2PLE A;  4D8K A;  1KA7 A;  2IUH A;  1AYA A;  2K79 B;  2CI9 A;  1I3Z A;  2LQW A;  2KNO A;  4X6S A;  3S8N A;  3BKB A;  3VS0 A;  3N84 A;  1B47 A;  1SHB A;  1BHH B;  1OO3 A;  3OP0 A;  1R1S A;  3T04 A;  2DX0 A;  1LKL A;  3OB2 B;  2LRA A;  3PFV A;  3BUW B;  4M4Z A;  4GL9 E;  4A4B A;  3EAZ A;  3VS2 A;  5GJI A;  2AOB A;  2H5K A;  2SRC A;  3PLF B;  3S8O A;  3CWG A;  1NZL A;  1WQU A;  1FHS A;  1PIC A;  2HDX A;  1AYB A;  2MRJ A;  1QAD A;  2LNX A;  2K7A B;  2EKX A;  5BO4 A;  1A08 A;  1O4R A;  1A1C A;  1O4H A;  3BUN B;  4H34 A;  2EL8 A;  2Y1M A;  3MXY A;  1O45 A;  2IUG A;  5EG3 B;  4GWF A;  2HUW A;  5EHR A;  1O49 A;  1D1Z A;  3IN8 A;  3KFJ A;  1JYU A;  1O4D A;  3IMD A;  2RMX A;  3VRP A;  2PNB A;  2B3O A;  3QWY A;  1HCS B;  1CJ1 A;  2KGY A;  3NHN A;  1JWO A;  2L3T A;  3K2T A;  2GSB A;  1HCT B;  1R1Q A;  4A4C A;  1LUI A;  1RPY A;  1O42 A;  1F1W A;  3N7Y A;  1GHU A;  1CWD L;  1SPR A;  2H46 E;  2AUG A;  1FMK A;  5IBS A;  1BG1 A;  2GE9 A;  2DVJ A;  1K9A A;  4K2R A;  1A1B A;  1MW4 A;  1A1A A;  4JEG A;  5AUL A;  5IBM A;  4U1P A;  2DLY A;  1AD5 A;  5HKZ A;  1BMB A;  1NRV A;  3OB1 B;  1A09 A;  2DLZ A;  1O4Q A;  2ECD A;  1YVH A;  1LCJ A;  2EOB A;  3VRQ A;  1CSZ A;  3M7F A;  1O4J A;  2CBL A;  3HHM B;  3VRR A;  1LCK A;  3MAZ A;  4LUE A;  2CR4 A;  1YVL A;  2EU0 A;  5DF6 A;  2YU7 A;  2PNA A;  1AB2 A;  3N8M A;  2MK2 A;  3GXW A;  1FBV A;  4NWF A;  2MQI A;  1TZE E;  1M61 A;  1O4A A;  2EYV A;  1Y57 A;  4H1O A;  2FCI A;  1IJR A;  4F5A A;  2IZV A;  1O46 A;  1SPS A;  3EAC A;  1O47 A;  4EY0 A;  2EO6 A;  3CD3 A;  1BM2 A;  2EO3 A;  4DGX A;  3US4 A;  1R1P A;  5J3X A;  1H9O A;  2BBU A;  3VRN A;  3S8L A;  1O44 A;  1O4K A;  2PTK A;  2QMS A;  3GQI B;  4JE4 A;  3VS7 A;  1KSW A;  2LQN A;  1BFJ A;  3VS1 A;  1O4B A;  2LNW A;  3BUO B;  3S9K A;  2AOA A;  2KK6 A;  1MIL A;  4OHI A;  1UUS A; 
#chains in the Genus database with same CATH homology
 1RJA A;  1SKJ A;  2DCR A;  2EYY A;  1LUK A;  2OZO A;  1JYR A;  3C7I A;  4OHE A;  3GXX A;  1SHA A;  1O48 A;  4OHD A;  3TKZ A;  1KC2 A;  3PQZ A;  2CI8 A;  1O4N A;  3WA4 A;  5CDW A;  1CWE A;  5EEL A;  1BHF A;  4EIH A;  2IUI A;  4F5B A;  2L4K A;  3BUM B;  1CSY A;  1X6C A;  2HCK A;  3CXL A;  4FL3 A;  5AXI A;  1O4M A;  4FL2 A;  1BFI A;  3IN7 A;  4E93 A;  2LCT A;  1XA6 A;  1AOT F;  5HKY A;  4K45 A;  5EEQ A;  1QCF A;  1JU5 A;  1D4T A;  1JYQ A;  2DM0 A;  1FYR A;  1FU5 A;  2JYQ A;  1LUN A;  5KAZ A;  1Y1U A;  3PJP A;  4L1B B;  4QSY A;  2ETZ A;  1O4E A;  4K11 A;  1Z3K A;  2CIA A;  3BUX B;  3PSJ A;  3VS5 A;  1A1E A;  5DC9 A;  1F2F A;  2OQ1 A;  2H8H A;  2CRH A;  2MC1 A;  4NWG A;  3ZNI A;  5D0J A;  3UF4 A;  1A07 A;  2HDV A;  2Y1N A;  3OVE A;  1O4G A;  1BKM A;  2C0O A;  1TCE A;  4F59 A;  4U17 A;  4E68 A;  1LUM A;  1FBZ A;  3UYO A;  2RSY A;  5EHP A;  3K2M A;  3HIZ B;  1LKK A;  1O4C A;  1O4I A;  4OHH A;  5HKW A;  3IMJ A;  4K44 A;  1AYD A;  2ABL A;  1SHD A;  1O4F A;  4P9Z A;  1OPL A;  5DC0 B;  3QWX X;  1UUR A;  3OV1 A;  4LUD A;  4DGP A;  1O41 A;  1IS0 A;  2VIF A;  2RVF A;  2YSX A;  4OHL A;  2C0T A;  4XZ0 A;  2C9W A;  2HMH A;  5GJH A;  3VRY A;  1BLK A;  3MXC A;  4JGH A;  1A81 A;  1M27 A;  1O4L A;  5DC4 A;  4XZ1 A;  1O4O A;  1D4W A;  3VS4 A;  1OPK A;  3VGO A;  1GRI A;  1BKL A;  2EYZ A;  1X27 A;  2XP1 A;  2FO0 A;  5I6V A;  1AYC A;  3PS5 A;  2C0I A;  4ROJ A;  1O4P A;  1FU6 A;  1O43 A;  2ROR A;  4GPL B;  1OO4 A;  1G83 A;  2L6K A;  2Y3A B;  3TL0 A;  1AOU F;  2MRK A;  4TZI A;  3CBL A;  3PSK A;  1BLJ A;  3VRZ A;  1RQQ C;  3VS6 A;  1BHH A;  1X0N A;  1ZFP E;  4P9V A;  2PLD A;  4FBN A;  1BF5 A;  1P13 A;  4WWQ A;  3HCK A;  2CS0 A;  2SHP A;  1NZV A;  3VRO A;  1QG1 E;  1KA6 A;  3VS3 A;  2PLE A;  4D8K A;  1KA7 A;  2IUH A;  1AYA A;  2K79 B;  2CI9 A;  1I3Z A;  2LQW A;  2KNO A;  4X6S A;  3S8N A;  3BKB A;  3VS0 A;  3N84 A;  1B47 A;  1SHB A;  1BHH B;  1OO3 A;  3OP0 A;  1R1S A;  3T04 A;  2DX0 A;  1LKL A;  3OB2 B;  3PFV A;  3BUW B;  4M4Z A;  4GL9 E;  4A4B A;  3EAZ A;  3VS2 A;  5GJI A;  2AOB A;  2H5K A;  2SRC A;  3PLF B;  3S8O A;  3CWG A;  1NZL A;  1WQU A;  1FHS A;  1PIC A;  2HDX A;  1AYB A;  2MRJ A;  1QAD A;  2LNX A;  2K7A B;  2EKX A;  5BO4 A;  1A08 A;  1O4R A;  1A1C A;  1O4H A;  3BUN B;  4H34 A;  2EL8 A;  2Y1M A;  3MXY A;  1O45 A;  2IUG A;  5EG3 B;  4GWF A;  2HUW A;  5EHR A;  1O49 A;  1D1Z A;  3IN8 A;  3KFJ A;  1JYU A;  1O4D A;  3IMD A;  2RMX A;  3VRP A;  2PNB A;  2B3O A;  3QWY A;  1HCS B;  1CJ1 A;  3NHN A;  1JWO A;  2L3T A;  2GSB A;  1HCT B;  1R1Q A;  4A4C A;  1LUI A;  1RPY A;  1O42 A;  1F1W A;  3N7Y A;  1GHU A;  1CWD L;  1SPR A;  2H46 E;  2AUG A;  1FMK A;  5IBS A;  1BG1 A;  2GE9 A;  2DVJ A;  1K9A A;  4K2R A;  1A1B A;  1MW4 A;  1A1A A;  4JEG A;  5AUL A;  5IBM A;  4U1P A;  2DLY A;  1AD5 A;  5HKZ A;  1BMB A;  1NRV A;  3OB1 B;  1A09 A;  2DLZ A;  1O4Q A;  2ECD A;  1YVH A;  1LCJ A;  2EOB A;  3VRQ A;  1CSZ A;  3M7F A;  1O4J A;  2CBL A;  3HHM B;  3VRR A;  1LCK A;  3MAZ A;  4LUE A;  2CR4 A;  1YVL A;  2EU0 A;  5DF6 A;  2YU7 A;  2PNA A;  1AB2 A;  3N8M A;  2MK2 A;  3GXW A;  1FBV A;  4NWF A;  2MQI A;  1TZE E;  1M61 A;  1O4A A;  2EYV A;  1Y57 A;  4H1O A;  2FCI A;  1IJR A;  4F5A A;  2IZV A;  1O46 A;  1SPS A;  3EAC A;  1O47 A;  4EY0 A;  2EO6 A;  3CD3 A;  1BM2 A;  2EO3 A;  4DGX A;  3US4 A;  1R1P A;  5J3X A;  1H9O A;  2BBU A;  3VRN A;  3S8L A;  1O44 A;  1O4K A;  2PTK A;  2QMS A;  3GQI B;  4JE4 A;  3VS7 A;  1KSW A;  2LQN A;  1BFJ A;  3VS1 A;  1O4B A;  2LNW A;  3BUO B;  3S9K A;  2AOA A;  2KK6 A;  1MIL A;  4OHI A;  1UUS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...