4F5GA

Rational design and directed evolution of e. coli apartate aminotransferase to tyrosine aminotransferase: mutant p2.
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
399
structure length
398
Chain Sequence
b'HVGTFENITAAPADPILGLADLFRADERPGKVDLGVGVYKDETGKTPVLTSVKKAEQYLLENETTKTYLGLDGLPEFGRCTQELLFGKGSALINDKRARTAQTPGGSGALRVAADFLAKNTSVKRVWVSNPSWPNHKAIFNSAGLEVREYAYYDAENHTLDFDALINSLNEAQAGDVVLFHGCCHNPTGADPTLEQWQTLAQLSVEKGWLPLIDIAYQGFGRGLEEDAEGLRAFAAMHKELIVASSCSNFGLYNERVGACTLVAADSETVDRAFGQMKAAIRANYSNPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFVIKQNGMFSFSGLTKEQVLRLREEFGVYAVASGRVNVAGMTPDNMAPLCEAIVAVL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aspartate aminotransferase
publication title Janus: prediction and ranking of mutations required for functional interconversion of enzymes.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 147
structure length 398
sequence length 399
chains with identical sequence B
ec nomenclature ec 2.6.1.1: Aspartate transaminase.
pdb deposition date 2012-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 4f5gA02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 4f5gA01
2OATA 2YCPA 2Z9XA 3II0A 3LVLB 4BMKA 5M46A 4LNMA 2CFBA 1BW0A 1B5PA 1MDZA 5AX8A 2BI9A 1IUGA 3NUIA 2DOUA 3FRKA 5BJ4A 1LC5A 2ZUKA 4ATQA 2W7LA 1AIBA 1MLZA 4Q76A 1QITA 2CANA 2AY4A 3LY1A 1IAYA 2YOBA 4U2HA 5J8QA 2E54A 1D7RA 4CXQA 1C4KA 4N0WA 2FQ6A 2FNUA 4W5KA 2D64A 4BA5A 5EFSA 3FQ7A 2CH2A 4Q31A 3FFRA 5G4JA 1GDEA 1D2FA 4OMAA 2VMXA 3WGCA 1N2TA 2HP2A 5G2QA 3NRAA 3PIUA 1RV3A 3BCBA 1TOEA 4W91A 2BI3A 2QB2A 3AENB 4JEYA 2JG2A 4F5GA 3G7QA 2EGYA 1WYVB 3EI7A 4A6RA 1D7SA 1BJNA 4XEWA 1BQAA 4XK1A 1OXOA 5DX5A 3WY7A 3UE8A 1BJ4A 4LNJA 3NU7A 1M32A 1SFFA 1X2AA 1WKHA 1QGNA 1H1CA 2D7ZA 3A9YA 3ATHA 3FVXA 3AEOA 4J8LA 4GEBA 4J5UA 2ZY3A 1PFFA 3MKJA 4PIWA 2FYFA 4IX8A 4MY5A 1G7XA 3EZSA 2O1BA 2BI1A 1TOIA 4A6UA 2PB2A 2CJDA 5EUNA 1ASBA 9AATA 4RJ0A 4CBRA 3FTBA 1BJOB 4A00A 1JS3A 1IX8A 3DXVA 3MEBA 1M0PA 1O4SA 2BIEA 2VGZA 3E2ZA 4K2MA 4RIZA 3AEPA 3PD6A 3EZ1A 4B9BA 3MAUA 5HHYA 3MAFB 3GJUA 2X3LA 2TPLA 1ZC9A 1ASNA 2VMSA 2Z1YA 3FD0A 1V2FA 4RITA 2OGAA 5G2PA 3TFTA 3GR9A 3RCHA 2YCTA 4AOAA 1X0MA 3A2BA 1SPAA 2HOZA 2D66A 1AKBA 5E5IA 2DGLA 2CY8A 3P6KA 2HOXA 3ACZA 1M4NA 1CS1A 1KKJA 4JE5A 3LVMA 4K2BA 1P3WA 2QB3A 3WZFA 4CVQA 5IWQA 4WYCA 3I5TA 2GMSA 3JWAA 4TV7A 3CQ6A 5LH9A 1IX6A 1AY4A 5M49A 1RV4A 1ASDA 1SVVA 1XEYA 2ZY5A 4E3RA 4GE9A 1B4XA 4ADDA 3KE3A 1CJ0A 1EJIA 2BWPA 1S08A 4IY7A 1T3IA 2VIBA 3KGXA 1EG5A 2CB1A 2VGUA 4WXFA 4P3MA 1GEYA 1AKCA 1LW5A 1W23A 1X29A 1V2DA 3NYTA 1GD9A 1E5FA 3E2ZB 2ZC0A 3BCAA 3DZZA 1DTYA 4BQ0A 1B9IA 1QJ3A 3TFUA 3ECDA 4DQ6A 3N0LA 3W1JA 2HZPA 1ASCA 2AY1A 4LNLA 4RJYA 1TOJA 3H7FA 4UOYA 3R9AA 2CTZA 1Z3ZA 3TCMA 1I29A 2EPJA 1QIRA 3QGUA 4OTLA 2JJGA 4E77A 1C9CA 3TQXA 3ELPA 3ELEA 4RKDA 3FFHA 1OHWA 4R2NA 1M0OA 3PDXA 4ATPA 1CQ7A 2GMUA 4CBSA 1FC4A 1B9HA 4B98A 3ZRPA 4O6ZA 1VEFA 1YJYA 1AIAA 2FM1A 3P1TA 3E6GA 4WYGA 3QI6A 4LC3A 1QISA 1I48A 4OBUA 1GC0A 3JZLA 2W8VA 4KXKA 3FDDA 3T32A 4DBCA 3NUBA 2FN6A 2OKKA 2YRIA 3G0TA 3WKRA 1E5EA 1WYVA 3NYSA 2ZY4A 4ZDLA 2X5FA 4FL0A 3JU7A 5HDMA 1YJZA 2BWNA 1FG3A 4TN4A 3LVJA 2JGTA 2YKUA 3BV0A 2EZ1A 2ZY2A 3GZCA 2R5CA 2XBNA 3A9ZA 4GDYA 4ZLVA 3QHXA 1ASEA 4Y0HA 3AV7A 1C7NA 1IBJA 1SZKA 2QMAA 2AY6A 2AATA 4BA4A 5FT6A 1C7GA 3PPLA 2VMOA 2YCNA 5JAYA 4A0GA 4XJLA 1OATA 2AY5A 3CQ4A 1UU0A 2XH1A 3F0HA 1KKPA 1BJOA 4NOGA 1GC4A 4WYFA 4F4EA 1YNUA 3UAKA 3KKIA 1MLYA 1O62A 1TASA 3NNKA 1W7LA 1WSTA 4JEWA 4AO9A 4A6TA 2JISA 4WD2A 5FT8A 3MAFA 1WYUA 1BS0A 4H51A 2W7HA 5K8BA 3FQAA 1S0AA 2CH1A 4Y0DA 3AOWA 4ITXA 2BWOA 3BN1A 2W7KA 1M6SA 2CINA 1TOGA 5EIGB 4QGRA 2GQNA 4EFFA 4W8IA 5F9SA 3W1HA 4GE7A 3NYUA 4WB0B 1ZODA 3PGYA 1UU2A 1DGEA 1MGVA 2R5CB 5EQCA 2E7UA 3LWSA 1RVUA 1ELQA 1QJ5A 4GSAA 3WCNA 1S07A 2W7FA 3EIBA 3CBFA 1N8PA 4P7YA 2R0TA 3IHJA 2D7YA 2VMRA 3RI6A 3MADA 3FQ8A 2CJGA 2V1PA 3WLXA 2YRRA 3ZRRA 1AAWA 4OT8A 2VMWA 4WBTA 2Z20A 1XI9A 2W7GA 1TARA 4JEZA 3EIAA 5LHAA 4ITGA 2BI5A 1WYUB 2GB3A 4UHNA 1J32A 2BKWA 4EMYA 3HQTA 2F8JA 3VOMA 2R2NA 2Z1ZA 8AATA 2VGSA 5M4BA 3K40A 3K28A 1DFOA 4JF1A 1B8GA 4OYTA 5DJ1A 4A0HA 3PA9A 3GZDC 3F9TA 1AJRA 4BHDA 4CXRA 4MKJA 2QBTA 1PMMA 2CSTA 1AMQA 3FVUA 5G0AA 4W1XA 5BJ3A 1M7YA 4XQ2A 3E9KA 5DB5A 1CL1A 4I8AA 2HORA 2QLRA 1KL1A 1DJ9A 1UU1A 2PB0A 4MSOA 2ZJGA 2AY9A 2VLHA 3PAAA 1X28A 2YHKA 1AY5A 2CJHA 1AHYA 2DKJA 3LV2A 1ARSA 2AEUA 1ASGA 1AMAA 3MC6C 3I16A 1QZ9A 1AHGA 2ZSLA 4ISYA 5D5SA 1GC3A 2OKJA 3AEJA 4A72A 1OHVA 3NX3A 4JEVA 4F5KA 1AY8A 3ZZKA 2O7CA 4A0FA 4GRXA 2VMTA 1DGDA 1GC2A 3AATA 2VI8A 3VK2A 3W1IA 2D5YA 3MBBA 2GSAA 2ORDA 4GE4A 3TATA 3NDNA 2Z61A 4ZM3A 1LS3A 3E2YA 5FT5A 2VLFA 1YOOA 4WXGA 1BJWA 4MQPA 2WK7A 4JEXA 4PVFA 1KMKA 1S09A 1YAAA 2EH6A 1IAXA 3KGWA 1AAMA 1CQ6A 3WGBA 1GBNA 1YIZA 4WLJA 4ZAHA 1GEWA 2WK9A 1CZCA 2ZP7A 4WYDA 1MDXA 1V72A 2W7JA 5E3KA 1H0CA 4ZSYA 1DKAA 3D6KA 4UHMA 1C7OA 4L0OA 1DJUA 2BI2A 4XAUA 2G6WA 3AEJC 2VMVA 2R5EA 3JWBA 4OCAA 5DJ9A 1IVRA 5EIGA 3UWCA 1LK9A 2Z9UA 5EAVA 1AMSA 1GEXA 2W7MA 4WB0A 3FSLA 3K7YA 1WYTA 2C7TA 3IF2A 2VGVA 4ADCA 3B46A 2C0RA 2JJEA 3CQ5A 4W1WA 4IYOB 4ADBA 1W7MA 2Z67A 2E7JA 3PDBA 4RLGA 3E2FA 4IXSA 4PFFA 4PFNA 2HP1A 3BC8A 5M4DA 4ZWVA 2VI9A 2W7IA 2Z9VA 1AHEA 1I41A 1VJOA 1Z7DA 2VMPA 2HUFA 3QN6A 4WXBA 1KL2A 1KMJA 2AY2A 3L8AA 3FZ8A 3B8XA 4A0RA 4FFCA 2OGEA 3CAIA 4IW7A 4XJPA 3EI6A 4XJOA 3B1EA 1O69A 4EB5A 3FZ6A 4OBVA 2DR1A 3E77A 3VK3A 3FKDA 3AEMC 2W7EA 3N5MA 3QM2A 2VGTA 1BKGA 2AY8A 1CZEA 3R4TA 2O0RA 3BWNC 1ASLA 2C81A 2FNIA 4KYOA 3HL2A 2BHXA 4AZJA 4ZDPA 2D61A 3GZDA 4U1TA 2NMPA 1ECXA 2VMNA 5EUDA 4AZKA 3B1CA 1WYTB 1O61A 5I92A 3VP6A 5FT4A 3HBXA 1ORDA 4Q6RA 3PJ0A 4JF0A 4N0BA 4AO4A 1SZUA 2WK8A 3L44A 2W7DA 4JE5D 4WLHA 3PDBB 4LW2A 4EU1A 4DGTA 2RFVA 2D63A 4E3QA 5C6UA 4MGRA 1IX7A 3FZ7A 3BWOA 1BT4A 1W7NA 3N75A 3FCRA 4R5FA 2AY3A 3HDOA 3DODA 5HXXA 1OXPA 1AJSB 2OQXA 1AHFA 4IXOA 1AKAA 1LC7A 3MC6A 1ASAA 3Q8NA 2DKBA 1N31A 3USFA 3GETA 1Y4IA 3A9XA 2VYCA 3OKSA 3AOVA 3DRDA 1RVYA 2ZSMA 5F8VA 2AY7A 1G4VA 4ADEA 1CQ8A 1BQDA 1M0NA 1W3UA 2VMZA 3DC1A 3DU4A 4Y0IA 3VAXA 4F5MA 4MQRA 1I43A 4OC9A 2V0YA 5D95A 2BIGA 2VMUA 1DJEA 2W8JA 1D7VA 2VIAA 1JG8A 4RKCA 2E7IA 2DGKA 4UHOA 1GCKA 4MQQA 1MDOA 1PG8A 5G09A 3GSBA 2X8UA 2EZ2A 4UQVA 4W1VA 4Q75A 2HUIA 3AELA 4WP0A 4EB7A 4R8DA 1AHXA 1V2EA 3BB8A 2X5DA 3GWPA 3BS8A 3RBFA 3ISLA 4XJMA 1C0NA 4ZSWA 4RAEA 1G7WA 4F5IA 1G4XA 1JS6A 3EI9A 3ZZJA 2JJFA 3DR7A 3GBXA 3QBOA 1LW4A 3I4JA 1IJIA 1B5OA 1M0QA 3EI8A 3FDBA 2YKVA 3HMUA 1U08A 4IXZA 3LG0A 2ZYJA 5TF5A 3JW9A 3ZRQA 3NU8A 3BCXA 3NTJA 4IYOA 5G4IA 2Z9WA 4R5ZA 3HT4A 1ELUA 2VMYA 1D7UA 4WYAA 1TOKA 3EUCA 1AICA 7AATA 1LC8A 4ZASA 1ARIA 3M5UA 3COGA 1ARTA 2D65A 3VK4A 4LW4A 2AEVA 4KAMA 4E1OA 2BYLA 4M2MA 1EQBA 1TATA 2HOYA 3PD6B 1S06A 4F5LA 2VMQA 2W8WA 2DGMA 2JJHA 1ARHA 3ASBA 4RM1A 3HVYA 4HVKA 1J04A 1PMOA 5E4ZA 1TPLA 3QPGA 1AMRA 1YJSA 1SF2A 2QA3A 1WKGA 3FVSA 3RBLA 3EI5A 4F5HA 2W8TA 3RCHB 5EAAA 3LVKA 4F5FA 2W8UA 2PO3A 3DXWA 4MKKA 4ZDOA 4TMRA 2C44A 2VGWA 4HF8A 4K2IA 1ASFA 1UKJA 1AX4A 1VP4A 3AEMA 3HLMA 1CL2A 4ZM4A 3RUYA 3BWNA 3B1DA 3WX9A 3A8UX 4M2KA 2WKAA 3RQ1A 1ARGA 3JTXA 3H14A 2HUUA 4M2JA 5EUEA 2Q7WA 1LKCA 3WCOA 2YKYA 1MAQA 3WKSA 1FG7A 1ZOBA 2EO5A 2YKXA 3AENA 1OHYA 1SZSA 3DYDA 4WYEA 2BIAA 3F6TA 1JF9A 4F5JA 3G8MA 4AH3A 1AJSA 3DR4A 1YIYA 4ZWMA 3OP7A 1ASMA 3ASAA 2BYJA 1MAPA
chains in the Genus database with same CATH superfamily
2OATA 2YCPA 2Z9XA 3II0A 3LVLB 4BMKA 5M46A 4LNMA 2CFBA 1BW0A 1B5PA 1MDZA 5AX8A 2BI9A 1IUGA 3NUIA 3N4RA 2DOUA 3FRKA 5BJ4A 1LC5A 2ZUKA 4ATQA 2W7LA 1AIBA 1MLZA 4Q76A 1QITA 2CANA 2AY4A 3LY1A 1IAYA 2YOBA 4U2HA 5J8QA 2E54A 1D7RA 4CXQA 1C4KA 4N0WA 2FQ6A 2FNUA 4W5KA 2D64A 4BA5A 5EFSA 3FQ7A 2CH2A 4Q31A 3FFRA 5G4JA 1GDEA 1D2FA 4OMAA 2VMXA 3WGCA 1N2TA 2HP2A 5G2QA 3NRAA 3PIUA 1RV3A 3BCBA 1TOEA 4W91A 2BI3A 2QB2A 3AENB 4JEYA 2JG2A 4F5GA 3G7QA 2EGYA 1WYVB 3EI7A 4A6RA 1D7SA 1BJNA 4XEWA 3H9XA 1BQAA 4XK1A 1OXOA 5DX5A 3WY7A 3UE8A 1BJ4A 4LNJA 3NU7A 1M32A 1SFFA 1X2AA 1WKHA 1QGNA 1H1CA 2D7ZA 3A9YA 3ATHA 3FVXA 3AEOA 4J8LA 4GEBA 4J5UA 2ZY3A 1PFFA 3MKJA 4PIWA 2FYFA 4IX8A 4MY5A 1G7XA 3EZSA 2O1BA 2BI1A 1TOIA 4A6UA 2PB2A 2CJDA 5EUNA 1ASBA 9AATA 4RJ0A 4CBRA 3FTBA 1BJOB 4A00A 1JS3A 1IX8A 3DXVA 3MEBA 1M0PA 1O4SA 2BIEA 2VGZA 3E2ZA 4K2MA 4RIZA 3AEPA 3PD6A 3EZ1A 4B9BA 3MAUA 5HHYA 3MAFB 3GJUA 2X3LA 2TPLA 1ZC9A 1ASNA 2VMSA 2Z1YA 3FD0A 1V2FA 4RITA 2OGAA 5G2PA 3TFTA 3GR9A 3RCHA 2YCTA 4AOAA 1X0MA 3A2BA 1SPAA 2HOZA 2D66A 1AKBA 5E5IA 2DGLA 2CY8A 3P6KA 2HOXA 3ACZA 1M4NA 1CS1A 1KKJA 4JE5A 3LVMA 4K2BA 1P3WA 2QB3A 3WZFA 4CVQA 5IWQA 4WYCA 3I5TA 2GMSA 3JWAA 4TV7A 3CQ6A 5LH9A 1IX6A 1AY4A 5M49A 1RV4A 1ASDA 1SVVA 1XEYA 2ZY5A 4E3RA 4GE9A 1B4XA 4ADDA 3KE3A 1CJ0A 1EJIA 2BWPA 1S08A 4IY7A 1T3IA 2VIBA 3KGXA 1EG5A 2CB1A 2VGUA 4WXFA 3N4XA 4P3MA 1GEYA 1AKCA 1LW5A 1W23A 1X29A 1V2DA 3NYTA 1GD9A 1E5FA 3E2ZB 2ZC0A 3BCAA 3DZZA 1DTYA 4BQ0A 1B9IA 1QJ3A 3TFUA 3ECDA 4DQ6A 3N0LA 3W1JA 2HZPA 1ASCA 2AY1A 4LNLA 4RJYA 1TOJA 3H7FA 4UOYA 3R9AA 2CTZA 1Z3ZA 3TCMA 1I29A 2EPJA 1QIRA 3QGUA 4OTLA 2JJGA 4E77A 1C9CA 3TQXA 3ELPA 3ELEA 4RKDA 3FFHA 1OHWA 4R2NA 1M0OA 3PDXA 4ATPA 1CQ7A 2GMUA 4CBSA 1FC4A 1B9HA 4B98A 3ZRPA 4O6ZA 1VEFA 1YJYA 1AIAA 2FM1A 3P1TA 3E6GA 4WYGA 3QI6A 4LC3A 1QISA 3N4SA 1I48A 4OBUA 1GC0A 3JZLA 2W8VA 4KXKA 3FDDA 3T32A 4DBCA 3NUBA 2FN6A 2OKKA 2YRIA 3G0TA 3WKRA 1E5EA 1WYVA 3NYSA 2WB6A 2ZY4A 4ZDLA 2X5FA 4FL0A 3JU7A 5HDMA 1YJZA 2BWNA 1FG3A 4TN4A 3LVJA 2JGTA 2YKUA 3BV0A 2EZ1A 2ZY2A 3GZCA 2R5CA 2XBNA 3A9ZA 4GDYA 4ZLVA 3QHXA 1ASEA 4Y0HA 3AV7A 1C7NA 1IBJA 1SZKA 2QMAA 2AY6A 2AATA 4BA4A 5FT6A 1C7GA 3PPLA 2VMOA 2YCNA 5JAYA 4A0GA 4XJLA 1OATA 2AY5A 3CQ4A 1UU0A 2XH1A 3F0HA 1KKPA 1BJOA 4NOGA 1GC4A 4WYFA 4F4EA 2A1VA 1YNUA 3UAKA 3KKIA 1MLYA 1O62A 1TASA 3NNKA 1W7LA 1WSTA 4JEWA 4AO9A 4A6TA 2JISA 4WD2A 5FT8A 3MAFA 1WYUA 1BS0A 4H51A 2W7HA 5K8BA 3FQAA 1S0AA 2CH1A 2EYQA 4Y0DA 3AOWA 4ITXA 2BWOA 3BN1A 2W7KA 1M6SA 2CINA 4H63Q 1TOGA 5EIGB 4QGRA 2GQNA 4EFFA 4W8IA 5F9SA 3W1HA 4GE7A 3NYUA 4WB0B 1ZODA 3PGYA 1UU2A 1DGEA 1MGVA 2R5CB 5EQCA 2E7UA 3LWSA 1RVUA 1ELQA 1QJ5A 4GSAA 3WCNA 1S07A 2W7FA 3EIBA 3CBFA 1N8PA 4P7YA 2R0TA 3IHJA 2D7YA 2VMRA 3RI6A 3MADA 3FQ8A 2CJGA 2V1PA 3WLXA 2YRRA 3ZRRA 1AAWA 4OT8A 2VMWA 4WBTA 2Z20A 1XI9A 2W7GA 1TARA 4JEZA 3EIAA 5LHAA 4ITGA 2BI5A 1WYUB 2GB3A 4UHNA 1J32A 2BKWA 5KTBA 4EMYA 3HQTA 2F8JA 3VOMA 2R2NA 2Z1ZA 8AATA 2VGSA 5M4BA 3K40A 3K28A 1DFOA 4JF1A 1B8GA 4OYTA 5DJ1A 4A0HA 3PA9A 3GZDC 3F9TA 1AJRA 4BHDA 4CXRA 4MKJA 2QBTA 1PMMA 2CSTA 1AMQA 3FVUA 5G0AA 4W1XA 5BJ3A 1M7YA 4XQ2A 3E9KA 5DB5A 1CL1A 4I8AA 2HORA 2QLRA 1KL1A 1DJ9A 1UU1A 2PB0A 4MSOA 2ZJGA 2AY9A 2VLHA 3PAAA 1X28A 2YHKA 1AY5A 2CJHA 1AHYA 2DKJA 3LV2A 1ARSA 2AEUA 1ASGA 1AMAA 3MC6C 3I16A 1QZ9A 1AHGA 2ZSLA 4ISYA 5D5SA 1GC3A 2OKJA 3AEJA 4A72A 1OHVA 3NX3A 4JEVA 1KAFA 4F5KA 1AY8A 3ZZKA 2O7CA 4A0FA 4GRXA 2VMTA 1DGDA 1GC2A 3AATA 2VI8A 3VK2A 3W1IA 2D5YA 3MBBA 2GSAA 2ORDA 4GE4A 3TATA 2KFPA 3NDNA 2Z61A 4ZM3A 1LS3A 3E2YA 5FT5A 2VLFA 1YOOA 4WXGA 1BJWA 4MQPA 2WK7A 4JEXA 4PVFA 1KMKA 1S09A 1YAAA 2EH6A 1IAXA 3KGWA 1AAMA 1CQ6A 3WGBA 1GBNA 1YIZA 4WLJA 4ZAHA 1GEWA 2WK9A 2FKIA 1CZCA 2ZP7A 4WYDA 1MDXA 1V72A 2W7JA 5E3KA 1H0CA 4ZSYA 1DKAA 3D6KA 4UHMA 1C7OA 4L0OA 1DJUA 2BI2A 4XAUA 2G6WA 3AEJC 2VMVA 2R5EA 3JWBA 4OCAA 5DJ9A 1IVRA 5EIGA 3UWCA 1LK9A 2Z9UA 5EAVA 1AMSA 1GEXA 2W7MA 4WB0A 3FSLA 3K7YA 1WYTA 2C7TA 3IF2A 2VGVA 4ADCA 3B46A 2C0RA 2JJEA 3CQ5A 4W1WA 4IYOB 4ADBA 1W7MA 2Z67A 2E7JA 3PDBA 4RLGA 3E2FA 4IXSA 4PFFA 4PFNA 2HP1A 3BC8A 5M4DA 4ZWVA 2VI9A 2W7IA 2Z9VA 1AHEA 1I41A 1VJOA 1Z7DA 2VMPA 2HUFA 3QN6A 4WXBA 1KL2A 1KMJA 2AY2A 3L8AA 3FZ8A 3B8XA 4A0RA 4FFCA 2OGEA 3CAIA 4IW7A 4XJPA 3EI6A 4XJOA 3B1EA 1O69A 4EB5A 3FZ6A 4OBVA 2DR1A 3E77A 3VK3A 3FKDA 3AEMC 2W7EA 3N5MA 3QM2A 2VGTA 1BKGA 2AY8A 1CZEA 3R4TA 2O0RA 3BWNC 1ASLA 2C81A 2FNIA 4KYOA 3HL2A 2BHXA 4AZJA 4ZDPA 2D61A 3GZDA 4U1TA 2NMPA 1ECXA 2VMNA 5EUDA 4AZKA 3B1CA 1WYTB 1O61A 5I92A 3VP6A 5FT4A 3HBXA 1ORDA 4Q6RA 3PJ0A 4JF0A 4N0BA 4AO4A 1SZUA 2WK8A 3L44A 2W7DA 4JE5D 4WLHA 3PDBB 4LW2A 4EU1A 4DGTA 2RFVA 2D63A 4E3QA 5C6UA 4MGRA 1IX7A 3FZ7A 3BWOA 1BT4A 1W7NA 3N75A 3FCRA 4R5FA 2AY3A 3HDOA 3DODA 5HXXA 1OXPA 1AJSB 2OQXA 1AHFA 4IXOA 1AKAA 1LC7A 3MC6A 1ASAA 3Q8NA 2DKBA 1N31A 3USFA 3GETA 1Y4IA 3A9XA 2VYCA 3OKSA 3AOVA 3DRDA 1RVYA 2ZSMA 5F8VA 2AY7A 1G4VA 4ADEA 4K05A 1CQ8A 1BQDA 1M0NA 1W3UA 2VMZA 3DC1A 3DU4A 4Y0IA 3VAXA 4F5MA 4MQRA 1I43A 4OC9A 2V0YA 5D95A 2BIGA 2VMUA 1DJEA 2W8JA 1D7VA 2VIAA 1JG8A 4RKCA 2E7IA 2DGKA 4UHOA 1GCKA 4MQQA 1MDOA 1PG8A 5G09A 3GSBA 2X8UA 2EZ2A 4UQVA 4W1VA 4Q75A 2HUIA 3AELA 4WP0A 4EB7A 4R8DA 2QSRA 1AHXA 1V2EA 3BB8A 2X5DA 3GWPA 3BS8A 3RBFA 3ISLA 4XJMA 1C0NA 4ZSWA 4RAEA 1G7WA 4F5IA 1G4XA 1JS6A 3EI9A 3ZZJA 2JJFA 3DR7A 3GBXA 3QBOA 1LW4A 3I4JA 1IJIA 1B5OA 1M0QA 3EI8A 3FDBA 2YKVA 3HMUA 1U08A 4IXZA 3LG0A 2ZYJA 5TF5A 3JW9A 3ZRQA 3NU8A 3BCXA 3NTJA 4IYOA 5G4IA 2Z9WA 4R5ZA 3HT4A 1ELUA 2VMYA 1D7UA 4WYAA 1TOKA 3EUCA 1AICA 7AATA 1LC8A 4ZASA 1ARIA 3M5UA 3COGA 1ARTA 2D65A 3VK4A 4LW4A 2AEVA 4KAMA 4E1OA 2BYLA 4M2MA 1EQBA 1TATA 2HOYA 3PD6B 1S06A 4F5LA 2VMQA 2W8WA 2DGMA 2JJHA 3N7NA 1ARHA 3ASBA 4RM1A 3HVYA 4HVKA 1J04A 1PMOA 5E4ZA 1TPLA 3QPGA 1AMRA 1YJSA 1SF2A 2QA3A 1WKGA 3FVSA 3RBLA 3EI5A 4F5HA 2W8TA 2G7JA 3RCHB 5EAAA 3LVKA 4F5FA 2W8UA 2PO3A 3DXWA 4MKKA 4ZDOA 4TMRA 2C44A 2VGWA 4HF8A 4K2IA 1ASFA 1UKJA 1AX4A 1VP4A 3AEMA 3HLMA 1CL2A 4ZM4A 3RUYA 3BWNA 3B1DA 3WX9A 3A8UX 4M2KA 2WKAA 3RQ1A 1ARGA 3JTXA 3H14A 2HUUA 4M2JA 5EUEA 2Q7WA 1LKCA 3WCOA 2YKYA 1MAQA 3WKSA 1FG7A 1ZOBA 2EO5A 2YKXA 3AENA 1OHYA 1SZSA 3DYDA 4WYEA 2BIAA 3F6TA 1JF9A 4F5JA 3G8MA 4AH3A 1AJSA 3DR4A 1YIYA 4ZWMA 3OP7A 1ASMA 3ASAA 2BYJA 1MAPA
chains in the Genus database with same CATH topology
2OATA 2YCPA 2Z9XA 3II0A 3LVLB 4BMKA 5M46A 4LNMA 2CFBA 1BW0A 1B5PA 1MDZA 5AX8A 2BI9A 1IUGA 3NUIA 3N4RA 2DOUA 3FRKA 5BJ4A 1LC5A 2ZUKA 4ATQA 2W7LA 1AIBA 1MLZA 4Q76A 1QITA 2CANA 2AY4A 3LY1A 1IAYA 2YOBA 4U2HA 5J8QA 2E54A 1D7RA 4CXQA 1C4KA 4N0WA 2FQ6A 2FNUA 4W5KA 2D64A 4BA5A 5EFSA 3FQ7A 2CH2A 4Q31A 3FFRA 5G4JA 1GDEA 1D2FA 4OMAA 2VMXA 3WGCA 1N2TA 2HP2A 5G2QA 3NRAA 3PIUA 1RV3A 3BCBA 1TOEA 4W91A 2BI3A 2QB2A 3AENB 4JEYA 2JG2A 4F5GA 3G7QA 2EGYA 1WYVB 3EI7A 4A6RA 1D7SA 1BJNA 4XEWA 3H9XA 1BQAA 4XK1A 1OXOA 5DX5A 3WY7A 3UE8A 1BJ4A 4LNJA 3NU7A 1M32A 1SFFA 1X2AA 1WKHA 1QGNA 1H1CA 2D7ZA 3A9YA 3ATHA 3FVXA 3AEOA 4J8LA 4GEBA 4J5UA 2ZY3A 1PFFA 3MKJA 4PIWA 2FYFA 4IX8A 4MY5A 1G7XA 3EZSA 2O1BA 2BI1A 1TOIA 4A6UA 2PB2A 2CJDA 5EUNA 1ASBA 9AATA 4RJ0A 4CBRA 3FTBA 1BJOB 4A00A 1JS3A 1IX8A 3DXVA 3MEBA 1M0PA 1O4SA 2BIEA 2VGZA 3E2ZA 4K2MA 4RIZA 3AEPA 3PD6A 3EZ1A 4B9BA 3MAUA 5HHYA 3MAFB 3GJUA 2X3LA 2TPLA 1ZC9A 1ASNA 2VMSA 2Z1YA 3FD0A 1V2FA 4RITA 2OGAA 5G2PA 3TFTA 3GR9A 3RCHA 2YCTA 4AOAA 1X0MA 3A2BA 1SPAA 2HOZA 2D66A 1AKBA 5E5IA 2DGLA 2CY8A 3P6KA 2HOXA 3ACZA 1M4NA 1CS1A 1KKJA 4JE5A 3LVMA 4K2BA 1P3WA 2QB3A 3WZFA 4CVQA 5IWQA 4WYCA 3I5TA 2GMSA 3JWAA 4TV7A 3CQ6A 5LH9A 1IX6A 1AY4A 5M49A 1RV4A 1ASDA 1SVVA 1XEYA 2ZY5A 4E3RA 4GE9A 1B4XA 4ADDA 3KE3A 1CJ0A 1EJIA 2BWPA 1S08A 4IY7A 1T3IA 2VIBA 3KGXA 1EG5A 2CB1A 2VGUA 4WXFA 3N4XA 4P3MA 1GEYA 1AKCA 1LW5A 1W23A 1X29A 1V2DA 3NYTA 1GD9A 1E5FA 3E2ZB 2ZC0A 3BCAA 3DZZA 1DTYA 4BQ0A 1B9IA 1QJ3A 3TFUA 3ECDA 4DQ6A 3N0LA 3W1JA 2HZPA 1ASCA 2AY1A 4LNLA 4RJYA 1TOJA 3H7FA 4UOYA 3R9AA 2CTZA 1Z3ZA 3TCMA 1I29A 2EPJA 1QIRA 3QGUA 4OTLA 2JJGA 4E77A 1C9CA 3TQXA 3ELPA 3ELEA 4RKDA 3FFHA 1OHWA 4R2NA 1M0OA 3PDXA 4ATPA 1CQ7A 2GMUA 4CBSA 1FC4A 1B9HA 4B98A 3ZRPA 4O6ZA 1VEFA 1YJYA 1AIAA 2FM1A 3P1TA 3E6GA 4WYGA 3QI6A 4LC3A 1QISA 3N4SA 1I48A 4OBUA 1GC0A 3JZLA 2W8VA 4KXKA 3FDDA 3T32A 4DBCA 3NUBA 2FN6A 2OKKA 2YRIA 3G0TA 3WKRA 1E5EA 1WYVA 3NYSA 2WB6A 2ZY4A 4ZDLA 2X5FA 4FL0A 3JU7A 5HDMA 1YJZA 2BWNA 1FG3A 4TN4A 3LVJA 2JGTA 2YKUA 3BV0A 2EZ1A 2ZY2A 3GZCA 2R5CA 2XBNA 3A9ZA 4GDYA 4ZLVA 3QHXA 1ASEA 4Y0HA 3AV7A 1C7NA 1IBJA 1SZKA 2QMAA 2AY6A 2AATA 4BA4A 5FT6A 1C7GA 3PPLA 2VMOA 2YCNA 5JAYA 4A0GA 4XJLA 1OATA 2AY5A 3CQ4A 1UU0A 2XH1A 3F0HA 1KKPA 1BJOA 4NOGA 1GC4A 4WYFA 4F4EA 2A1VA 1YNUA 3UAKA 3KKIA 1MLYA 1O62A 1TASA 3NNKA 1W7LA 1WSTA 4JEWA 4AO9A 4A6TA 2JISA 4WD2A 5FT8A 3MAFA 1WYUA 1BS0A 4H51A 2W7HA 5K8BA 3FQAA 1S0AA 2CH1A 2EYQA 4Y0DA 3AOWA 4ITXA 2BWOA 3BN1A 2W7KA 1M6SA 2CINA 4H63Q 1TOGA 5EIGB 4QGRA 2GQNA 4EFFA 4W8IA 5F9SA 3W1HA 4GE7A 3NYUA 4WB0B 1ZODA 3PGYA 1UU2A 1DGEA 1MGVA 2R5CB 5EQCA 2E7UA 3LWSA 1RVUA 1ELQA 1QJ5A 4GSAA 3WCNA 1S07A 2W7FA 3EIBA 3CBFA 1N8PA 4P7YA 2R0TA 3IHJA 2D7YA 2VMRA 3RI6A 3MADA 3FQ8A 2CJGA 2V1PA 3WLXA 2YRRA 3ZRRA 1AAWA 4OT8A 2VMWA 4WBTA 2Z20A 1XI9A 2W7GA 1TARA 4JEZA 3EIAA 5LHAA 4ITGA 2BI5A 1WYUB 2GB3A 4UHNA 1J32A 2BKWA 5KTBA 4EMYA 3HQTA 2F8JA 3VOMA 2R2NA 2Z1ZA 8AATA 2VGSA 5M4BA 3K40A 3K28A 1DFOA 4JF1A 1B8GA 4OYTA 5DJ1A 4A0HA 3PA9A 3GZDC 3F9TA 1AJRA 4BHDA 4CXRA 4MKJA 2QBTA 1PMMA 2CSTA 1AMQA 3FVUA 5G0AA 4W1XA 5BJ3A 1M7YA 4XQ2A 3E9KA 5DB5A 1CL1A 4I8AA 2HORA 2QLRA 1KL1A 1DJ9A 1UU1A 2PB0A 4MSOA 2ZJGA 2AY9A 2VLHA 3PAAA 1X28A 2YHKA 1AY5A 2CJHA 1AHYA 2DKJA 3LV2A 1ARSA 2AEUA 1ASGA 1AMAA 3MC6C 3I16A 1QZ9A 1AHGA 2ZSLA 4ISYA 5D5SA 1GC3A 2OKJA 3AEJA 4A72A 1OHVA 3NX3A 4JEVA 4F5KA 1AY8A 3ZZKA 2O7CA 4A0FA 4GRXA 2VMTA 1DGDA 1GC2A 3AATA 2VI8A 3VK2A 3W1IA 2D5YA 3MBBA 2GSAA 2ORDA 4GE4A 3TATA 2KFPA 3NDNA 2Z61A 4ZM3A 1LS3A 3E2YA 5FT5A 2VLFA 1YOOA 4WXGA 1BJWA 4MQPA 2WK7A 4JEXA 4PVFA 1KMKA 1S09A 1YAAA 2EH6A 1IAXA 3KGWA 1AAMA 1CQ6A 3WGBA 1GBNA 1YIZA 4WLJA 4ZAHA 1GEWA 2WK9A 2FKIA 1CZCA 2ZP7A 4WYDA 1MDXA 1V72A 2W7JA 5E3KA 1H0CA 4ZSYA 1DKAA 3D6KA 4UHMA 1C7OA 4L0OA 1DJUA 2BI2A 4XAUA 2G6WA 3AEJC 2VMVA 2R5EA 3JWBA 4OCAA 5DJ9A 1IVRA 5EIGA 3UWCA 1LK9A 2Z9UA 5EAVA 1AMSA 1GEXA 2W7MA 4WB0A 3FSLA 3K7YA 1WYTA 2C7TA 3IF2A 2VGVA 4ADCA 3B46A 2C0RA 2JJEA 3CQ5A 4W1WA 4IYOB 4ADBA 1W7MA 2Z67A 2E7JA 3PDBA 4RLGA 3E2FA 4IXSA 4PFFA 4PFNA 2HP1A 3BC8A 5M4DA 4ZWVA 2VI9A 2W7IA 2Z9VA 1AHEA 1I41A 1VJOA 1Z7DA 2VMPA 2HUFA 3QN6A 4WXBA 1KL2A 1KMJA 2AY2A 3L8AA 3FZ8A 3B8XA 4A0RA 4FFCA 2OGEA 3CAIA 4IW7A 4XJPA 3EI6A 4XJOA 3B1EA 1O69A 4EB5A 3FZ6A 4OBVA 2DR1A 3E77A 3VK3A 3FKDA 3AEMC 2W7EA 3N5MA 3QM2A 2VGTA 1BKGA 2AY8A 1CZEA 3R4TA 2O0RA 3BWNC 1ASLA 2C81A 2FNIA 4KYOA 3HL2A 2BHXA 4AZJA 4ZDPA 2D61A 3GZDA 4U1TA 2NMPA 1ECXA 2VMNA 5EUDA 4AZKA 3B1CA 1WYTB 1O61A 5I92A 3VP6A 5FT4A 3HBXA 1ORDA 4Q6RA 3PJ0A 4JF0A 4N0BA 4AO4A 1SZUA 2WK8A 3L44A 2W7DA 4JE5D 4WLHA 3PDBB 4LW2A 4EU1A 4DGTA 2RFVA 2D63A 4E3QA 5C6UA 4MGRA 1IX7A 3FZ7A 3BWOA 1BT4A 1W7NA 3N75A 3FCRA 4R5FA 2AY3A 3HDOA 3DODA 5HXXA 1OXPA 1AJSB 2OQXA 1AHFA 4IXOA 1AKAA 1LC7A 3MC6A 1ASAA 3Q8NA 2DKBA 1N31A 3USFA 3GETA 1Y4IA 3A9XA 2VYCA 3OKSA 3AOVA 3DRDA 1RVYA 2ZSMA 5F8VA 2AY7A 1G4VA 4ADEA 4K05A 1CQ8A 1BQDA 1M0NA 1W3UA 2VMZA 3DC1A 3DU4A 4Y0IA 3VAXA 4F5MA 4MQRA 1I43A 4OC9A 2V0YA 5D95A 2BIGA 2VMUA 1DJEA 2W8JA 1D7VA 2VIAA 1JG8A 4RKCA 2E7IA 2DGKA 4UHOA 1GCKA 4MQQA 1MDOA 1PG8A 5G09A 3GSBA 2X8UA 2EZ2A 4UQVA 4W1VA 4Q75A 2HUIA 3AELA 4WP0A 4EB7A 4R8DA 2QSRA 1AHXA 1V2EA 3BB8A 2X5DA 3GWPA 3BS8A 3RBFA 3ISLA 4XJMA 1C0NA 4ZSWA 4RAEA 1G7WA 4F5IA 1G4XA 1JS6A 3EI9A 3ZZJA 2JJFA 3DR7A 3GBXA 3QBOA 1LW4A 3I4JA 1IJIA 1B5OA 1M0QA 3EI8A 3FDBA 2YKVA 3HMUA 1U08A 4IXZA 3LG0A 2ZYJA 5TF5A 3JW9A 3ZRQA 3NU8A 3BCXA 3NTJA 4IYOA 5G4IA 2Z9WA 4R5ZA 3HT4A 1ELUA 2VMYA 1D7UA 4WYAA 1TOKA 3EUCA 1AICA 7AATA 1LC8A 4ZASA 1ARIA 3M5UA 3COGA 1ARTA 2D65A 3VK4A 4LW4A 2AEVA 4KAMA 4E1OA 2BYLA 4M2MA 1EQBA 1TATA 2HOYA 3PD6B 1S06A 4F5LA 2VMQA 2W8WA 2DGMA 2JJHA 3N7NA 1ARHA 3ASBA 4RM1A 3HVYA 4HVKA 1J04A 1PMOA 5E4ZA 1TPLA 3QPGA 1AMRA 1YJSA 1SF2A 2QA3A 1WKGA 3FVSA 3RBLA 3EI5A 4F5HA 2W8TA 2G7JA 3RCHB 5EAAA 3LVKA 4F5FA 2W8UA 2PO3A 3DXWA 4MKKA 4ZDOA 4TMRA 2C44A 2VGWA 4HF8A 4K2IA 1ASFA 1UKJA 1AX4A 1VP4A 3AEMA 3HLMA 1CL2A 4ZM4A 3RUYA 3BWNA 3B1DA 3WX9A 3A8UX 4M2KA 2WKAA 3RQ1A 1ARGA 3JTXA 3H14A 2HUUA 4M2JA 5EUEA 2Q7WA 1LKCA 3WCOA 2YKYA 1MAQA 3WKSA 1FG7A 1ZOBA 2EO5A 2YKXA 3AENA 1OHYA 1SZSA 3DYDA 4WYEA 2BIAA 3F6TA 1JF9A 4F5JA 3G8MA 4AH3A 1AJSA 3DR4A 1YIYA 4ZWMA 3OP7A 1ASMA 3ASAA 2BYJA 1MAPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OAT A;  2YCP A;  2Z9X A;  3II0 A;  3LVL B;  4BMK A;  5M46 A;  4LNM A;  2CFB A;  1BW0 A;  1B5P A;  1MDZ A;  5AX8 A;  2BI9 A;  1IUG A;  3NUI A;  2DOU A;  3FRK A;  5BJ4 A;  1LC5 A;  2ZUK A;  4ATQ A;  2W7L A;  1AIB A;  1MLZ A;  4Q76 A;  1QIT A;  2CAN A;  2AY4 A;  3LY1 A;  1IAY A;  2YOB A;  4U2H A;  5J8Q A;  2E54 A;  1D7R A;  4CXQ A;  1C4K A;  4N0W A;  2FQ6 A;  2FNU A;  4W5K A;  2D64 A;  4BA5 A;  5EFS A;  3FQ7 A;  2CH2 A;  4Q31 A;  3FFR A;  5G4J A;  1GDE A;  1D2F A;  4OMA A;  2VMX A;  3WGC A;  1N2T A;  2HP2 A;  5G2Q A;  3NRA A;  3PIU A;  1RV3 A;  3BCB A;  1TOE A;  4W91 A;  2BI3 A;  2QB2 A;  3AEN B;  4JEY A;  2JG2 A;  4F5G A;  3G7Q A;  2EGY A;  1WYV B;  3EI7 A;  4A6R A;  1D7S A;  1BJN A;  4XEW A;  1BQA A;  4XK1 A;  1OXO A;  5DX5 A;  3WY7 A;  3UE8 A;  1BJ4 A;  4LNJ A;  3NU7 A;  1M32 A;  1SFF A;  1X2A A;  1WKH A;  1QGN A;  1H1C A;  2D7Z A;  3A9Y A;  3ATH A;  3FVX A;  3AEO A;  4J8L A;  4GEB A;  4J5U A;  2ZY3 A;  1PFF A;  3MKJ A;  4PIW A;  2FYF A;  4IX8 A;  4MY5 A;  1G7X A;  3EZS A;  2O1B A;  2BI1 A;  1TOI A;  4A6U A;  2PB2 A;  2CJD A;  5EUN A;  1ASB A;  9AAT A;  4RJ0 A;  4CBR A;  3FTB A;  1BJO B;  4A00 A;  1JS3 A;  1IX8 A;  3DXV A;  3MEB A;  1M0P A;  1O4S A;  2BIE A;  2VGZ A;  3E2Z A;  4K2M A;  4RIZ A;  3AEP A;  3PD6 A;  3EZ1 A;  4B9B A;  3MAU A;  5HHY A;  3MAF B;  3GJU A;  2X3L A;  2TPL A;  1ZC9 A;  1ASN A;  2VMS A;  2Z1Y A;  3FD0 A;  1V2F A;  4RIT A;  2OGA A;  5G2P A;  3TFT A;  3GR9 A;  3RCH A;  2YCT A;  4AOA A;  1X0M A;  3A2B A;  1SPA A;  2HOZ A;  2D66 A;  1AKB A;  5E5I A;  2DGL A;  2CY8 A;  3P6K A;  2HOX A;  3ACZ A;  1M4N A;  1CS1 A;  1KKJ A;  4JE5 A;  3LVM A;  4K2B A;  1P3W A;  2QB3 A;  3WZF A;  4CVQ A;  5IWQ A;  4WYC A;  3I5T A;  2GMS A;  3JWA A;  4TV7 A;  3CQ6 A;  5LH9 A;  1IX6 A;  1AY4 A;  5M49 A;  1RV4 A;  1ASD A;  1SVV A;  1XEY A;  2ZY5 A;  4E3R A;  4GE9 A;  1B4X A;  4ADD A;  3KE3 A;  1CJ0 A;  1EJI A;  2BWP A;  1S08 A;  4IY7 A;  1T3I A;  2VIB A;  3KGX A;  1EG5 A;  2CB1 A;  2VGU A;  4WXF A;  4P3M A;  1GEY A;  1AKC A;  1LW5 A;  1W23 A;  1X29 A;  1V2D A;  3NYT A;  1GD9 A;  1E5F A;  3E2Z B;  2ZC0 A;  3BCA A;  3DZZ A;  1DTY A;  4BQ0 A;  1B9I A;  1QJ3 A;  3TFU A;  3ECD A;  4DQ6 A;  3N0L A;  3W1J A;  2HZP A;  1ASC A;  2AY1 A;  4LNL A;  4RJY A;  1TOJ A;  3H7F A;  4UOY A;  3R9A A;  2CTZ A;  1Z3Z A;  3TCM A;  1I29 A;  2EPJ A;  1QIR A;  3QGU A;  4OTL A;  2JJG A;  4E77 A;  1C9C A;  3TQX A;  3ELP A;  3ELE A;  4RKD A;  3FFH A;  1OHW A;  4R2N A;  1M0O A;  3PDX A;  4ATP A;  1CQ7 A;  2GMU A;  4CBS A;  1FC4 A;  1B9H A;  4B98 A;  3ZRP A;  4O6Z A;  1VEF A;  1YJY A;  1AIA A;  2FM1 A;  3P1T A;  3E6G A;  4WYG A;  3QI6 A;  4LC3 A;  1QIS A;  1I48 A;  4OBU A;  1GC0 A;  3JZL A;  2W8V A;  4KXK A;  3FDD A;  3T32 A;  4DBC A;  3NUB A;  2FN6 A;  2OKK A;  2YRI A;  3G0T A;  3WKR A;  1E5E A;  1WYV A;  3NYS A;  2ZY4 A;  4ZDL A;  2X5F A;  4FL0 A;  3JU7 A;  5HDM A;  1YJZ A;  2BWN A;  1FG3 A;  4TN4 A;  3LVJ A;  2JGT A;  2YKU A;  3BV0 A;  2EZ1 A;  2ZY2 A;  3GZC A;  2R5C A;  2XBN A;  3A9Z A;  4GDY A;  4ZLV A;  3QHX A;  1ASE A;  4Y0H A;  3AV7 A;  1C7N A;  1IBJ A;  1SZK A;  2QMA A;  2AY6 A;  2AAT A;  4BA4 A;  5FT6 A;  1C7G A;  3PPL A;  2VMO A;  2YCN A;  5JAY A;  4A0G A;  4XJL A;  1OAT A;  2AY5 A;  3CQ4 A;  1UU0 A;  2XH1 A;  3F0H A;  1KKP A;  1BJO A;  4NOG A;  1GC4 A;  4WYF A;  4F4E A;  1YNU A;  3UAK A;  3KKI A;  1MLY A;  1O62 A;  1TAS A;  3NNK A;  1W7L A;  1WST A;  4JEW A;  4AO9 A;  4A6T A;  2JIS A;  4WD2 A;  5FT8 A;  3MAF A;  1WYU A;  1BS0 A;  4H51 A;  2W7H A;  5K8B A;  3FQA A;  1S0A A;  2CH1 A;  4Y0D A;  3AOW A;  4ITX A;  2BWO A;  3BN1 A;  2W7K A;  1M6S A;  2CIN A;  1TOG A;  5EIG B;  4QGR A;  2GQN A;  4EFF A;  4W8I A;  5F9S A;  3W1H A;  4GE7 A;  3NYU A;  4WB0 B;  1ZOD A;  3PGY A;  1UU2 A;  1DGE A;  1MGV A;  2R5C B;  5EQC A;  2E7U A;  3LWS A;  1RVU A;  1ELQ A;  1QJ5 A;  4GSA A;  3WCN A;  1S07 A;  2W7F A;  3EIB A;  3CBF A;  1N8P A;  4P7Y A;  2R0T A;  3IHJ A;  2D7Y A;  2VMR A;  3RI6 A;  3MAD A;  3FQ8 A;  2CJG A;  2V1P A;  3WLX A;  2YRR A;  3ZRR A;  1AAW A;  4OT8 A;  2VMW A;  4WBT A;  2Z20 A;  1XI9 A;  2W7G A;  1TAR A;  4JEZ A;  3EIA A;  5LHA A;  4ITG A;  2BI5 A;  1WYU B;  2GB3 A;  4UHN A;  1J32 A;  2BKW A;  4EMY A;  3HQT A;  2F8J A;  3VOM A;  2R2N A;  2Z1Z A;  8AAT A;  2VGS A;  5M4B A;  3K40 A;  3K28 A;  1DFO A;  4JF1 A;  1B8G A;  4OYT A;  5DJ1 A;  4A0H A;  3PA9 A;  3GZD C;  3F9T A;  1AJR A;  4BHD A;  4CXR A;  4MKJ A;  2QBT A;  1PMM A;  2CST A;  1AMQ A;  3FVU A;  5G0A A;  4W1X A;  5BJ3 A;  1M7Y A;  4XQ2 A;  3E9K A;  5DB5 A;  1CL1 A;  4I8A A;  2HOR A;  2QLR A;  1KL1 A;  1DJ9 A;  1UU1 A;  2PB0 A;  4MSO A;  2ZJG A;  2AY9 A;  2VLH A;  3PAA A;  1X28 A;  2YHK A;  1AY5 A;  2CJH A;  1AHY A;  2DKJ A;  3LV2 A;  1ARS A;  2AEU A;  1ASG A;  1AMA A;  3MC6 C;  3I16 A;  1QZ9 A;  1AHG A;  2ZSL A;  4ISY A;  5D5S A;  1GC3 A;  2OKJ A;  3AEJ A;  4A72 A;  1OHV A;  3NX3 A;  4JEV A;  4F5K A;  1AY8 A;  3ZZK A;  2O7C A;  4A0F A;  4GRX A;  2VMT A;  1DGD A;  1GC2 A;  3AAT A;  2VI8 A;  3VK2 A;  3W1I A;  2D5Y A;  3MBB A;  2GSA A;  2ORD A;  4GE4 A;  3TAT A;  3NDN A;  2Z61 A;  4ZM3 A;  1LS3 A;  3E2Y A;  5FT5 A;  2VLF A;  1YOO A;  4WXG A;  1BJW A;  4MQP A;  2WK7 A;  4JEX A;  4PVF A;  1KMK A;  1S09 A;  1YAA A;  2EH6 A;  1IAX A;  3KGW A;  1AAM A;  1CQ6 A;  3WGB A;  1GBN A;  1YIZ A;  4WLJ A;  4ZAH A;  1GEW A;  2WK9 A;  1CZC A;  2ZP7 A;  4WYD A;  1MDX A;  1V72 A;  2W7J A;  5E3K A;  1H0C A;  4ZSY A;  1DKA A;  3D6K A;  4UHM A;  1C7O A;  4L0O A;  1DJU A;  2BI2 A;  4XAU A;  2G6W A;  3AEJ C;  2VMV A;  2R5E A;  3JWB A;  4OCA A;  5DJ9 A;  1IVR A;  5EIG A;  3UWC A;  1LK9 A;  2Z9U A;  5EAV A;  1AMS A;  1GEX A;  2W7M A;  4WB0 A;  3FSL A;  3K7Y A;  1WYT A;  2C7T A;  3IF2 A;  2VGV A;  4ADC A;  3B46 A;  2C0R A;  2JJE A;  3CQ5 A;  4W1W A;  4IYO B;  4ADB A;  1W7M A;  2Z67 A;  2E7J A;  3PDB A;  4RLG A;  3E2F A;  4IXS A;  4PFF A;  4PFN A;  2HP1 A;  3BC8 A;  5M4D A;  4ZWV A;  2VI9 A;  2W7I A;  2Z9V A;  1AHE A;  1I41 A;  1VJO A;  1Z7D A;  2VMP A;  2HUF A;  3QN6 A;  4WXB A;  1KL2 A;  1KMJ A;  2AY2 A;  3L8A A;  3FZ8 A;  3B8X A;  4A0R A;  4FFC A;  2OGE A;  3CAI A;  4IW7 A;  4XJP A;  3EI6 A;  4XJO A;  3B1E A;  1O69 A;  4EB5 A;  3FZ6 A;  4OBV A;  2DR1 A;  3E77 A;  3VK3 A;  3FKD A;  3AEM C;  2W7E A;  3N5M A;  3QM2 A;  2VGT A;  1BKG A;  2AY8 A;  1CZE A;  3R4T A;  2O0R A;  3BWN C;  1ASL A;  2C81 A;  2FNI A;  4KYO A;  3HL2 A;  2BHX A;  4AZJ A;  4ZDP A;  2D61 A;  3GZD A;  4U1T A;  2NMP A;  1ECX A;  2VMN A;  5EUD A;  4AZK A;  3B1C A;  1WYT B;  1O61 A;  5I92 A;  3VP6 A;  5FT4 A;  3HBX A;  1ORD A;  4Q6R A;  3PJ0 A;  4JF0 A;  4N0B A;  4AO4 A;  1SZU A;  2WK8 A;  3L44 A;  2W7D A;  4JE5 D;  4WLH A;  3PDB B;  4LW2 A;  4EU1 A;  4DGT A;  2RFV A;  2D63 A;  4E3Q A;  5C6U A;  4MGR A;  1IX7 A;  3FZ7 A;  3BWO A;  1BT4 A;  1W7N A;  3N75 A;  3FCR A;  4R5F A;  2AY3 A;  3HDO A;  3DOD A;  5HXX A;  1OXP A;  1AJS B;  2OQX A;  1AHF A;  4IXO A;  1AKA A;  1LC7 A;  3MC6 A;  1ASA A;  3Q8N A;  2DKB A;  1N31 A;  3USF A;  3GET A;  1Y4I A;  3A9X A;  2VYC A;  3OKS A;  3AOV A;  3DRD A;  1RVY A;  2ZSM A;  5F8V A;  2AY7 A;  1G4V A;  4ADE A;  1CQ8 A;  1BQD A;  1M0N A;  1W3U A;  2VMZ A;  3DC1 A;  3DU4 A;  4Y0I A;  3VAX A;  4F5M A;  4MQR A;  1I43 A;  4OC9 A;  2V0Y A;  5D95 A;  2BIG A;  2VMU A;  1DJE A;  2W8J A;  1D7V A;  2VIA A;  1JG8 A;  4RKC A;  2E7I A;  2DGK A;  4UHO A;  1GCK A;  4MQQ A;  1MDO A;  1PG8 A;  5G09 A;  3GSB A;  2X8U A;  2EZ2 A;  4UQV A;  4W1V A;  4Q75 A;  2HUI A;  3AEL A;  4WP0 A;  4EB7 A;  4R8D A;  1AHX A;  1V2E A;  3BB8 A;  2X5D A;  3GWP A;  3BS8 A;  3RBF A;  3ISL A;  4XJM A;  1C0N A;  4ZSW A;  4RAE A;  1G7W A;  4F5I A;  1G4X A;  1JS6 A;  3EI9 A;  3ZZJ A;  2JJF A;  3DR7 A;  3GBX A;  3QBO A;  1LW4 A;  3I4J A;  1IJI A;  1B5O A;  1M0Q A;  3EI8 A;  3FDB A;  2YKV A;  3HMU A;  1U08 A;  4IXZ A;  3LG0 A;  2ZYJ A;  5TF5 A;  3JW9 A;  3ZRQ A;  3NU8 A;  3BCX A;  3NTJ A;  4IYO A;  5G4I A;  2Z9W A;  4R5Z A;  3HT4 A;  1ELU A;  2VMY A;  1D7U A;  4WYA A;  1TOK A;  3EUC A;  1AIC A;  7AAT A;  1LC8 A;  4ZAS A;  1ARI A;  3M5U A;  3COG A;  1ART A;  2D65 A;  3VK4 A;  4LW4 A;  2AEV A;  4KAM A;  4E1O A;  2BYL A;  4M2M A;  1EQB A;  1TAT A;  2HOY A;  3PD6 B;  1S06 A;  4F5L A;  2VMQ A;  2W8W A;  2DGM A;  2JJH A;  1ARH A;  3ASB A;  4RM1 A;  3HVY A;  4HVK A;  1J04 A;  1PMO A;  5E4Z A;  1TPL A;  3QPG A;  1AMR A;  1YJS A;  1SF2 A;  2QA3 A;  1WKG A;  3FVS A;  3RBL A;  3EI5 A;  4F5H A;  2W8T A;  3RCH B;  5EAA A;  3LVK A;  4F5F A;  2W8U A;  2PO3 A;  3DXW A;  4MKK A;  4ZDO A;  4TMR A;  2C44 A;  2VGW A;  4HF8 A;  4K2I A;  1ASF A;  1UKJ A;  1AX4 A;  1VP4 A;  3AEM A;  3HLM A;  1CL2 A;  4ZM4 A;  3RUY A;  3BWN A;  3B1D A;  3WX9 A;  3A8U X;  4M2K A;  2WKA A;  3RQ1 A;  1ARG A;  3JTX A;  3H14 A;  2HUU A;  4M2J A;  5EUE A;  2Q7W A;  1LKC A;  3WCO A;  2YKY A;  1MAQ A;  3WKS A;  1FG7 A;  1ZOB A;  2EO5 A;  2YKX A;  3AEN A;  1OHY A;  1SZS A;  3DYD A;  4WYE A;  2BIA A;  3F6T A;  1JF9 A;  4F5J A;  3G8M A;  4AH3 A;  1AJS A;  3DR4 A;  1YIY A;  4ZWM A;  3OP7 A;  1ASM A;  3ASA A;  2BYJ A;  1MAP A; 
#chains in the Genus database with same CATH topology
 2OAT A;  2YCP A;  2Z9X A;  3II0 A;  3LVL B;  4BMK A;  5M46 A;  4LNM A;  2CFB A;  1BW0 A;  1B5P A;  1MDZ A;  5AX8 A;  2BI9 A;  1IUG A;  3NUI A;  3N4R A;  2DOU A;  3FRK A;  5BJ4 A;  1LC5 A;  2ZUK A;  4ATQ A;  2W7L A;  1AIB A;  1MLZ A;  4Q76 A;  1QIT A;  2CAN A;  2AY4 A;  3LY1 A;  1IAY A;  2YOB A;  4U2H A;  5J8Q A;  2E54 A;  1D7R A;  4CXQ A;  1C4K A;  4N0W A;  2FQ6 A;  2FNU A;  4W5K A;  2D64 A;  4BA5 A;  5EFS A;  3FQ7 A;  2CH2 A;  4Q31 A;  3FFR A;  5G4J A;  1GDE A;  1D2F A;  4OMA A;  2VMX A;  3WGC A;  1N2T A;  2HP2 A;  5G2Q A;  3NRA A;  3PIU A;  1RV3 A;  3BCB A;  1TOE A;  4W91 A;  2BI3 A;  2QB2 A;  3AEN B;  4JEY A;  2JG2 A;  4F5G A;  3G7Q A;  2EGY A;  1WYV B;  3EI7 A;  4A6R A;  1D7S A;  1BJN A;  4XEW A;  3H9X A;  1BQA A;  4XK1 A;  1OXO A;  5DX5 A;  3WY7 A;  3UE8 A;  1BJ4 A;  4LNJ A;  3NU7 A;  1M32 A;  1SFF A;  1X2A A;  1WKH A;  1QGN A;  1H1C A;  2D7Z A;  3A9Y A;  3ATH A;  3FVX A;  3AEO A;  4J8L A;  4GEB A;  4J5U A;  2ZY3 A;  1PFF A;  3MKJ A;  4PIW A;  2FYF A;  4IX8 A;  4MY5 A;  1G7X A;  3EZS A;  2O1B A;  2BI1 A;  1TOI A;  4A6U A;  2PB2 A;  2CJD A;  5EUN A;  1ASB A;  9AAT A;  4RJ0 A;  4CBR A;  3FTB A;  1BJO B;  4A00 A;  1JS3 A;  1IX8 A;  3DXV A;  3MEB A;  1M0P A;  1O4S A;  2BIE A;  2VGZ A;  3E2Z A;  4K2M A;  4RIZ A;  3AEP A;  3PD6 A;  3EZ1 A;  4B9B A;  3MAU A;  5HHY A;  3MAF B;  3GJU A;  2X3L A;  2TPL A;  1ZC9 A;  1ASN A;  2VMS A;  2Z1Y A;  3FD0 A;  1V2F A;  4RIT A;  2OGA A;  5G2P A;  3TFT A;  3GR9 A;  3RCH A;  2YCT A;  4AOA A;  1X0M A;  3A2B A;  1SPA A;  2HOZ A;  2D66 A;  1AKB A;  5E5I A;  2DGL A;  2CY8 A;  3P6K A;  2HOX A;  3ACZ A;  1M4N A;  1CS1 A;  1KKJ A;  4JE5 A;  3LVM A;  4K2B A;  1P3W A;  2QB3 A;  3WZF A;  4CVQ A;  5IWQ A;  4WYC A;  3I5T A;  2GMS A;  3JWA A;  4TV7 A;  3CQ6 A;  5LH9 A;  1IX6 A;  1AY4 A;  5M49 A;  1RV4 A;  1ASD A;  1SVV A;  1XEY A;  2ZY5 A;  4E3R A;  4GE9 A;  1B4X A;  4ADD A;  3KE3 A;  1CJ0 A;  1EJI A;  2BWP A;  1S08 A;  4IY7 A;  1T3I A;  2VIB A;  3KGX A;  1EG5 A;  2CB1 A;  2VGU A;  4WXF A;  3N4X A;  4P3M A;  1GEY A;  1AKC A;  1LW5 A;  1W23 A;  1X29 A;  1V2D A;  3NYT A;  1GD9 A;  1E5F A;  3E2Z B;  2ZC0 A;  3BCA A;  3DZZ A;  1DTY A;  4BQ0 A;  1B9I A;  1QJ3 A;  3TFU A;  3ECD A;  4DQ6 A;  3N0L A;  3W1J A;  2HZP A;  1ASC A;  2AY1 A;  4LNL A;  4RJY A;  1TOJ A;  3H7F A;  4UOY A;  3R9A A;  2CTZ A;  1Z3Z A;  3TCM A;  1I29 A;  2EPJ A;  1QIR A;  3QGU A;  4OTL A;  2JJG A;  4E77 A;  1C9C A;  3TQX A;  3ELP A;  3ELE A;  4RKD A;  3FFH A;  1OHW A;  4R2N A;  1M0O A;  3PDX A;  4ATP A;  1CQ7 A;  2GMU A;  4CBS A;  1FC4 A;  1B9H A;  4B98 A;  3ZRP A;  4O6Z A;  1VEF A;  1YJY A;  1AIA A;  2FM1 A;  3P1T A;  3E6G A;  4WYG A;  3QI6 A;  4LC3 A;  1QIS A;  3N4S A;  1I48 A;  4OBU A;  1GC0 A;  3JZL A;  2W8V A;  4KXK A;  3FDD A;  3T32 A;  4DBC A;  3NUB A;  2FN6 A;  2OKK A;  2YRI A;  3G0T A;  3WKR A;  1E5E A;  1WYV A;  3NYS A;  2WB6 A;  2ZY4 A;  4ZDL A;  2X5F A;  4FL0 A;  3JU7 A;  5HDM A;  1YJZ A;  2BWN A;  1FG3 A;  4TN4 A;  3LVJ A;  2JGT A;  2YKU A;  3BV0 A;  2EZ1 A;  2ZY2 A;  3GZC A;  2R5C A;  2XBN A;  3A9Z A;  4GDY A;  4ZLV A;  3QHX A;  1ASE A;  4Y0H A;  3AV7 A;  1C7N A;  1IBJ A;  1SZK A;  2QMA A;  2AY6 A;  2AAT A;  4BA4 A;  5FT6 A;  1C7G A;  3PPL A;  2VMO A;  2YCN A;  5JAY A;  4A0G A;  4XJL A;  1OAT A;  2AY5 A;  3CQ4 A;  1UU0 A;  2XH1 A;  3F0H A;  1KKP A;  1BJO A;  4NOG A;  1GC4 A;  4WYF A;  4F4E A;  2A1V A;  1YNU A;  3UAK A;  3KKI A;  1MLY A;  1O62 A;  1TAS A;  3NNK A;  1W7L A;  1WST A;  4JEW A;  4AO9 A;  4A6T A;  2JIS A;  4WD2 A;  5FT8 A;  3MAF A;  1WYU A;  1BS0 A;  4H51 A;  2W7H A;  5K8B A;  3FQA A;  1S0A A;  2CH1 A;  2EYQ A;  4Y0D A;  3AOW A;  4ITX A;  2BWO A;  3BN1 A;  2W7K A;  1M6S A;  2CIN A;  4H63 Q;  1TOG A;  5EIG B;  4QGR A;  2GQN A;  4EFF A;  4W8I A;  5F9S A;  3W1H A;  4GE7 A;  3NYU A;  4WB0 B;  1ZOD A;  3PGY A;  1UU2 A;  1DGE A;  1MGV A;  2R5C B;  5EQC A;  2E7U A;  3LWS A;  1RVU A;  1ELQ A;  1QJ5 A;  4GSA A;  3WCN A;  1S07 A;  2W7F A;  3EIB A;  3CBF A;  1N8P A;  4P7Y A;  2R0T A;  3IHJ A;  2D7Y A;  2VMR A;  3RI6 A;  3MAD A;  3FQ8 A;  2CJG A;  2V1P A;  3WLX A;  2YRR A;  3ZRR A;  1AAW A;  4OT8 A;  2VMW A;  4WBT A;  2Z20 A;  1XI9 A;  2W7G A;  1TAR A;  4JEZ A;  3EIA A;  5LHA A;  4ITG A;  2BI5 A;  1WYU B;  2GB3 A;  4UHN A;  1J32 A;  2BKW A;  5KTB A;  4EMY A;  3HQT A;  2F8J A;  3VOM A;  2R2N A;  2Z1Z A;  8AAT A;  2VGS A;  5M4B A;  3K40 A;  3K28 A;  1DFO A;  4JF1 A;  1B8G A;  4OYT A;  5DJ1 A;  4A0H A;  3PA9 A;  3GZD C;  3F9T A;  1AJR A;  4BHD A;  4CXR A;  4MKJ A;  2QBT A;  1PMM A;  2CST A;  1AMQ A;  3FVU A;  5G0A A;  4W1X A;  5BJ3 A;  1M7Y A;  4XQ2 A;  3E9K A;  5DB5 A;  1CL1 A;  4I8A A;  2HOR A;  2QLR A;  1KL1 A;  1DJ9 A;  1UU1 A;  2PB0 A;  4MSO A;  2ZJG A;  2AY9 A;  2VLH A;  3PAA A;  1X28 A;  2YHK A;  1AY5 A;  2CJH A;  1AHY A;  2DKJ A;  3LV2 A;  1ARS A;  2AEU A;  1ASG A;  1AMA A;  3MC6 C;  3I16 A;  1QZ9 A;  1AHG A;  2ZSL A;  4ISY A;  5D5S A;  1GC3 A;  2OKJ A;  3AEJ A;  4A72 A;  1OHV A;  3NX3 A;  4JEV A;  1KAF A;  4F5K A;  1AY8 A;  3ZZK A;  2O7C A;  4A0F A;  4GRX A;  2VMT A;  1DGD A;  1GC2 A;  3AAT A;  2VI8 A;  3VK2 A;  3W1I A;  2D5Y A;  3MBB A;  2GSA A;  2ORD A;  4GE4 A;  3TAT A;  2KFP A;  3NDN A;  2Z61 A;  4ZM3 A;  1LS3 A;  3E2Y A;  5FT5 A;  2VLF A;  1YOO A;  4WXG A;  1BJW A;  4MQP A;  2WK7 A;  4JEX A;  4PVF A;  1KMK A;  1S09 A;  1YAA A;  2EH6 A;  1IAX A;  3KGW A;  1AAM A;  1CQ6 A;  3WGB A;  1GBN A;  1YIZ A;  4WLJ A;  4ZAH A;  1GEW A;  2WK9 A;  2FKI A;  1CZC A;  2ZP7 A;  4WYD A;  1MDX A;  1V72 A;  2W7J A;  5E3K A;  1H0C A;  4ZSY A;  1DKA A;  3D6K A;  4UHM A;  1C7O A;  4L0O A;  1DJU A;  2BI2 A;  4XAU A;  2G6W A;  3AEJ C;  2VMV A;  2R5E A;  3JWB A;  4OCA A;  5DJ9 A;  1IVR A;  5EIG A;  3UWC A;  1LK9 A;  2Z9U A;  5EAV A;  1AMS A;  1GEX A;  2W7M A;  4WB0 A;  3FSL A;  3K7Y A;  1WYT A;  2C7T A;  3IF2 A;  2VGV A;  4ADC A;  3B46 A;  2C0R A;  2JJE A;  3CQ5 A;  4W1W A;  4IYO B;  4ADB A;  1W7M A;  2Z67 A;  2E7J A;  3PDB A;  4RLG A;  3E2F A;  4IXS A;  4PFF A;  4PFN A;  2HP1 A;  3BC8 A;  5M4D A;  4ZWV A;  2VI9 A;  2W7I A;  2Z9V A;  1AHE A;  1I41 A;  1VJO A;  1Z7D A;  2VMP A;  2HUF A;  3QN6 A;  4WXB A;  1KL2 A;  1KMJ A;  2AY2 A;  3L8A A;  3FZ8 A;  3B8X A;  4A0R A;  4FFC A;  2OGE A;  3CAI A;  4IW7 A;  4XJP A;  3EI6 A;  4XJO A;  3B1E A;  1O69 A;  4EB5 A;  3FZ6 A;  4OBV A;  2DR1 A;  3E77 A;  3VK3 A;  3FKD A;  3AEM C;  2W7E A;  3N5M A;  3QM2 A;  2VGT A;  1BKG A;  2AY8 A;  1CZE A;  3R4T A;  2O0R A;  3BWN C;  1ASL A;  2C81 A;  2FNI A;  4KYO A;  3HL2 A;  2BHX A;  4AZJ A;  4ZDP A;  2D61 A;  3GZD A;  4U1T A;  2NMP A;  1ECX A;  2VMN A;  5EUD A;  4AZK A;  3B1C A;  1WYT B;  1O61 A;  5I92 A;  3VP6 A;  5FT4 A;  3HBX A;  1ORD A;  4Q6R A;  3PJ0 A;  4JF0 A;  4N0B A;  4AO4 A;  1SZU A;  2WK8 A;  3L44 A;  2W7D A;  4JE5 D;  4WLH A;  3PDB B;  4LW2 A;  4EU1 A;  4DGT A;  2RFV A;  2D63 A;  4E3Q A;  5C6U A;  4MGR A;  1IX7 A;  3FZ7 A;  3BWO A;  1BT4 A;  1W7N A;  3N75 A;  3FCR A;  4R5F A;  2AY3 A;  3HDO A;  3DOD A;  5HXX A;  1OXP A;  1AJS B;  2OQX A;  1AHF A;  4IXO A;  1AKA A;  1LC7 A;  3MC6 A;  1ASA A;  3Q8N A;  2DKB A;  1N31 A;  3USF A;  3GET A;  1Y4I A;  3A9X A;  2VYC A;  3OKS A;  3AOV A;  3DRD A;  1RVY A;  2ZSM A;  5F8V A;  2AY7 A;  1G4V A;  4ADE A;  4K05 A;  1CQ8 A;  1BQD A;  1M0N A;  1W3U A;  2VMZ A;  3DC1 A;  3DU4 A;  4Y0I A;  3VAX A;  4F5M A;  4MQR A;  1I43 A;  4OC9 A;  2V0Y A;  5D95 A;  2BIG A;  2VMU A;  1DJE A;  2W8J A;  1D7V A;  2VIA A;  1JG8 A;  4RKC A;  2E7I A;  2DGK A;  4UHO A;  1GCK A;  4MQQ A;  1MDO A;  1PG8 A;  5G09 A;  3GSB A;  2X8U A;  2EZ2 A;  4UQV A;  4W1V A;  4Q75 A;  2HUI A;  3AEL A;  4WP0 A;  4EB7 A;  4R8D A;  2QSR A;  1AHX A;  1V2E A;  3BB8 A;  2X5D A;  3GWP A;  3BS8 A;  3RBF A;  3ISL A;  4XJM A;  1C0N A;  4ZSW A;  4RAE A;  1G7W A;  4F5I A;  1G4X A;  1JS6 A;  3EI9 A;  3ZZJ A;  2JJF A;  3DR7 A;  3GBX A;  3QBO A;  1LW4 A;  3I4J A;  1IJI A;  1B5O A;  1M0Q A;  3EI8 A;  3FDB A;  2YKV A;  3HMU A;  1U08 A;  4IXZ A;  3LG0 A;  2ZYJ A;  5TF5 A;  3JW9 A;  3ZRQ A;  3NU8 A;  3BCX A;  3NTJ A;  4IYO A;  5G4I A;  2Z9W A;  4R5Z A;  3HT4 A;  1ELU A;  2VMY A;  1D7U A;  4WYA A;  1TOK A;  3EUC A;  1AIC A;  7AAT A;  1LC8 A;  4ZAS A;  1ARI A;  3M5U A;  3COG A;  1ART A;  2D65 A;  3VK4 A;  4LW4 A;  2AEV A;  4KAM A;  4E1O A;  2BYL A;  4M2M A;  1EQB A;  1TAT A;  2HOY A;  3PD6 B;  1S06 A;  4F5L A;  2VMQ A;  2W8W A;  2DGM A;  2JJH A;  3N7N A;  1ARH A;  3ASB A;  4RM1 A;  3HVY A;  4HVK A;  1J04 A;  1PMO A;  5E4Z A;  1TPL A;  3QPG A;  1AMR A;  1YJS A;  1SF2 A;  2QA3 A;  1WKG A;  3FVS A;  3RBL A;  3EI5 A;  4F5H A;  2W8T A;  2G7J A;  3RCH B;  5EAA A;  3LVK A;  4F5F A;  2W8U A;  2PO3 A;  3DXW A;  4MKK A;  4ZDO A;  4TMR A;  2C44 A;  2VGW A;  4HF8 A;  4K2I A;  1ASF A;  1UKJ A;  1AX4 A;  1VP4 A;  3AEM A;  3HLM A;  1CL2 A;  4ZM4 A;  3RUY A;  3BWN A;  3B1D A;  3WX9 A;  3A8U X;  4M2K A;  2WKA A;  3RQ1 A;  1ARG A;  3JTX A;  3H14 A;  2HUU A;  4M2J A;  5EUE A;  2Q7W A;  1LKC A;  3WCO A;  2YKY A;  1MAQ A;  3WKS A;  1FG7 A;  1ZOB A;  2EO5 A;  2YKX A;  3AEN A;  1OHY A;  1SZS A;  3DYD A;  4WYE A;  2BIA A;  3F6T A;  1JF9 A;  4F5J A;  3G8M A;  4AH3 A;  1AJS A;  3DR4 A;  1YIY A;  4ZWM A;  3OP7 A;  1ASM A;  3ASA A;  2BYJ A;  1MAP A; 
#chains in the Genus database with same CATH homology
 2OAT A;  2YCP A;  2Z9X A;  3II0 A;  3LVL B;  4BMK A;  5M46 A;  4LNM A;  2CFB A;  1BW0 A;  1B5P A;  1MDZ A;  5AX8 A;  2BI9 A;  1IUG A;  3NUI A;  3N4R A;  2DOU A;  3FRK A;  5BJ4 A;  1LC5 A;  2ZUK A;  4ATQ A;  2W7L A;  1AIB A;  1MLZ A;  4Q76 A;  1QIT A;  2CAN A;  2AY4 A;  3LY1 A;  1IAY A;  2YOB A;  4U2H A;  5J8Q A;  2E54 A;  1D7R A;  4CXQ A;  1C4K A;  4N0W A;  2FQ6 A;  2FNU A;  4W5K A;  2D64 A;  4BA5 A;  5EFS A;  3FQ7 A;  2CH2 A;  4Q31 A;  3FFR A;  5G4J A;  1GDE A;  1D2F A;  4OMA A;  2VMX A;  3WGC A;  1N2T A;  2HP2 A;  5G2Q A;  3NRA A;  3PIU A;  1RV3 A;  3BCB A;  1TOE A;  4W91 A;  2BI3 A;  2QB2 A;  3AEN B;  4JEY A;  2JG2 A;  4F5G A;  3G7Q A;  2EGY A;  1WYV B;  3EI7 A;  4A6R A;  1D7S A;  1BJN A;  4XEW A;  3H9X A;  1BQA A;  4XK1 A;  1OXO A;  5DX5 A;  3WY7 A;  3UE8 A;  1BJ4 A;  4LNJ A;  3NU7 A;  1M32 A;  1SFF A;  1X2A A;  1WKH A;  1QGN A;  1H1C A;  2D7Z A;  3A9Y A;  3ATH A;  3FVX A;  3AEO A;  4J8L A;  4GEB A;  4J5U A;  2ZY3 A;  1PFF A;  3MKJ A;  4PIW A;  2FYF A;  4IX8 A;  4MY5 A;  1G7X A;  3EZS A;  2O1B A;  2BI1 A;  1TOI A;  4A6U A;  2PB2 A;  2CJD A;  5EUN A;  1ASB A;  9AAT A;  4RJ0 A;  4CBR A;  3FTB A;  1BJO B;  4A00 A;  1JS3 A;  1IX8 A;  3DXV A;  3MEB A;  1M0P A;  1O4S A;  2BIE A;  2VGZ A;  3E2Z A;  4K2M A;  4RIZ A;  3AEP A;  3PD6 A;  3EZ1 A;  4B9B A;  3MAU A;  5HHY A;  3MAF B;  3GJU A;  2X3L A;  2TPL A;  1ZC9 A;  1ASN A;  2VMS A;  2Z1Y A;  3FD0 A;  1V2F A;  4RIT A;  2OGA A;  5G2P A;  3TFT A;  3GR9 A;  3RCH A;  2YCT A;  4AOA A;  1X0M A;  3A2B A;  1SPA A;  2HOZ A;  2D66 A;  1AKB A;  5E5I A;  2DGL A;  2CY8 A;  3P6K A;  2HOX A;  3ACZ A;  1M4N A;  1CS1 A;  1KKJ A;  4JE5 A;  3LVM A;  4K2B A;  1P3W A;  2QB3 A;  3WZF A;  4CVQ A;  5IWQ A;  4WYC A;  3I5T A;  2GMS A;  3JWA A;  4TV7 A;  3CQ6 A;  5LH9 A;  1IX6 A;  1AY4 A;  5M49 A;  1RV4 A;  1ASD A;  1SVV A;  1XEY A;  2ZY5 A;  4E3R A;  4GE9 A;  1B4X A;  4ADD A;  3KE3 A;  1CJ0 A;  1EJI A;  2BWP A;  1S08 A;  4IY7 A;  1T3I A;  2VIB A;  3KGX A;  1EG5 A;  2CB1 A;  2VGU A;  4WXF A;  3N4X A;  4P3M A;  1GEY A;  1AKC A;  1LW5 A;  1W23 A;  1X29 A;  1V2D A;  3NYT A;  1GD9 A;  1E5F A;  3E2Z B;  2ZC0 A;  3BCA A;  3DZZ A;  1DTY A;  4BQ0 A;  1B9I A;  1QJ3 A;  3TFU A;  3ECD A;  4DQ6 A;  3N0L A;  3W1J A;  2HZP A;  1ASC A;  2AY1 A;  4LNL A;  4RJY A;  1TOJ A;  3H7F A;  4UOY A;  3R9A A;  2CTZ A;  1Z3Z A;  3TCM A;  1I29 A;  2EPJ A;  1QIR A;  3QGU A;  4OTL A;  2JJG A;  4E77 A;  1C9C A;  3TQX A;  3ELP A;  3ELE A;  4RKD A;  3FFH A;  1OHW A;  4R2N A;  1M0O A;  3PDX A;  4ATP A;  1CQ7 A;  2GMU A;  4CBS A;  1FC4 A;  1B9H A;  4B98 A;  3ZRP A;  4O6Z A;  1VEF A;  1YJY A;  1AIA A;  2FM1 A;  3P1T A;  3E6G A;  4WYG A;  3QI6 A;  4LC3 A;  1QIS A;  3N4S A;  1I48 A;  4OBU A;  1GC0 A;  3JZL A;  2W8V A;  4KXK A;  3FDD A;  3T32 A;  4DBC A;  3NUB A;  2FN6 A;  2OKK A;  2YRI A;  3G0T A;  3WKR A;  1E5E A;  1WYV A;  3NYS A;  2WB6 A;  2ZY4 A;  4ZDL A;  2X5F A;  4FL0 A;  3JU7 A;  5HDM A;  1YJZ A;  2BWN A;  1FG3 A;  4TN4 A;  3LVJ A;  2JGT A;  2YKU A;  3BV0 A;  2EZ1 A;  2ZY2 A;  3GZC A;  2R5C A;  2XBN A;  3A9Z A;  4GDY A;  4ZLV A;  3QHX A;  1ASE A;  4Y0H A;  3AV7 A;  1C7N A;  1IBJ A;  1SZK A;  2QMA A;  2AY6 A;  2AAT A;  4BA4 A;  5FT6 A;  1C7G A;  3PPL A;  2VMO A;  2YCN A;  5JAY A;  4A0G A;  4XJL A;  1OAT A;  2AY5 A;  3CQ4 A;  1UU0 A;  2XH1 A;  3F0H A;  1KKP A;  1BJO A;  4NOG A;  1GC4 A;  4WYF A;  4F4E A;  2A1V A;  1YNU A;  3UAK A;  3KKI A;  1MLY A;  1O62 A;  1TAS A;  3NNK A;  1W7L A;  1WST A;  4JEW A;  4AO9 A;  4A6T A;  2JIS A;  4WD2 A;  5FT8 A;  3MAF A;  1WYU A;  1BS0 A;  4H51 A;  2W7H A;  5K8B A;  3FQA A;  1S0A A;  2CH1 A;  2EYQ A;  4Y0D A;  3AOW A;  4ITX A;  2BWO A;  3BN1 A;  2W7K A;  1M6S A;  2CIN A;  4H63 Q;  1TOG A;  5EIG B;  4QGR A;  2GQN A;  4EFF A;  4W8I A;  5F9S A;  3W1H A;  4GE7 A;  3NYU A;  4WB0 B;  1ZOD A;  3PGY A;  1UU2 A;  1DGE A;  1MGV A;  2R5C B;  5EQC A;  2E7U A;  3LWS A;  1RVU A;  1ELQ A;  1QJ5 A;  4GSA A;  3WCN A;  1S07 A;  2W7F A;  3EIB A;  3CBF A;  1N8P A;  4P7Y A;  2R0T A;  3IHJ A;  2D7Y A;  2VMR A;  3RI6 A;  3MAD A;  3FQ8 A;  2CJG A;  2V1P A;  3WLX A;  2YRR A;  3ZRR A;  1AAW A;  4OT8 A;  2VMW A;  4WBT A;  2Z20 A;  1XI9 A;  2W7G A;  1TAR A;  4JEZ A;  3EIA A;  5LHA A;  4ITG A;  2BI5 A;  1WYU B;  2GB3 A;  4UHN A;  1J32 A;  2BKW A;  5KTB A;  4EMY A;  3HQT A;  2F8J A;  3VOM A;  2R2N A;  2Z1Z A;  8AAT A;  2VGS A;  5M4B A;  3K40 A;  3K28 A;  1DFO A;  4JF1 A;  1B8G A;  4OYT A;  5DJ1 A;  4A0H A;  3PA9 A;  3GZD C;  3F9T A;  1AJR A;  4BHD A;  4CXR A;  4MKJ A;  2QBT A;  1PMM A;  2CST A;  1AMQ A;  3FVU A;  5G0A A;  4W1X A;  5BJ3 A;  1M7Y A;  4XQ2 A;  3E9K A;  5DB5 A;  1CL1 A;  4I8A A;  2HOR A;  2QLR A;  1KL1 A;  1DJ9 A;  1UU1 A;  2PB0 A;  4MSO A;  2ZJG A;  2AY9 A;  2VLH A;  3PAA A;  1X28 A;  2YHK A;  1AY5 A;  2CJH A;  1AHY A;  2DKJ A;  3LV2 A;  1ARS A;  2AEU A;  1ASG A;  1AMA A;  3MC6 C;  3I16 A;  1QZ9 A;  1AHG A;  2ZSL A;  4ISY A;  5D5S A;  1GC3 A;  2OKJ A;  3AEJ A;  4A72 A;  1OHV A;  3NX3 A;  4JEV A;  4F5K A;  1AY8 A;  3ZZK A;  2O7C A;  4A0F A;  4GRX A;  2VMT A;  1DGD A;  1GC2 A;  3AAT A;  2VI8 A;  3VK2 A;  3W1I A;  2D5Y A;  3MBB A;  2GSA A;  2ORD A;  4GE4 A;  3TAT A;  2KFP A;  3NDN A;  2Z61 A;  4ZM3 A;  1LS3 A;  3E2Y A;  5FT5 A;  2VLF A;  1YOO A;  4WXG A;  1BJW A;  4MQP A;  2WK7 A;  4JEX A;  4PVF A;  1KMK A;  1S09 A;  1YAA A;  2EH6 A;  1IAX A;  3KGW A;  1AAM A;  1CQ6 A;  3WGB A;  1GBN A;  1YIZ A;  4WLJ A;  4ZAH A;  1GEW A;  2WK9 A;  2FKI A;  1CZC A;  2ZP7 A;  4WYD A;  1MDX A;  1V72 A;  2W7J A;  5E3K A;  1H0C A;  4ZSY A;  1DKA A;  3D6K A;  4UHM A;  1C7O A;  4L0O A;  1DJU A;  2BI2 A;  4XAU A;  2G6W A;  3AEJ C;  2VMV A;  2R5E A;  3JWB A;  4OCA A;  5DJ9 A;  1IVR A;  5EIG A;  3UWC A;  1LK9 A;  2Z9U A;  5EAV A;  1AMS A;  1GEX A;  2W7M A;  4WB0 A;  3FSL A;  3K7Y A;  1WYT A;  2C7T A;  3IF2 A;  2VGV A;  4ADC A;  3B46 A;  2C0R A;  2JJE A;  3CQ5 A;  4W1W A;  4IYO B;  4ADB A;  1W7M A;  2Z67 A;  2E7J A;  3PDB A;  4RLG A;  3E2F A;  4IXS A;  4PFF A;  4PFN A;  2HP1 A;  3BC8 A;  5M4D A;  4ZWV A;  2VI9 A;  2W7I A;  2Z9V A;  1AHE A;  1I41 A;  1VJO A;  1Z7D A;  2VMP A;  2HUF A;  3QN6 A;  4WXB A;  1KL2 A;  1KMJ A;  2AY2 A;  3L8A A;  3FZ8 A;  3B8X A;  4A0R A;  4FFC A;  2OGE A;  3CAI A;  4IW7 A;  4XJP A;  3EI6 A;  4XJO A;  3B1E A;  1O69 A;  4EB5 A;  3FZ6 A;  4OBV A;  2DR1 A;  3E77 A;  3VK3 A;  3FKD A;  3AEM C;  2W7E A;  3N5M A;  3QM2 A;  2VGT A;  1BKG A;  2AY8 A;  1CZE A;  3R4T A;  2O0R A;  3BWN C;  1ASL A;  2C81 A;  2FNI A;  4KYO A;  3HL2 A;  2BHX A;  4AZJ A;  4ZDP A;  2D61 A;  3GZD A;  4U1T A;  2NMP A;  1ECX A;  2VMN A;  5EUD A;  4AZK A;  3B1C A;  1WYT B;  1O61 A;  5I92 A;  3VP6 A;  5FT4 A;  3HBX A;  1ORD A;  4Q6R A;  3PJ0 A;  4JF0 A;  4N0B A;  4AO4 A;  1SZU A;  2WK8 A;  3L44 A;  2W7D A;  4JE5 D;  4WLH A;  3PDB B;  4LW2 A;  4EU1 A;  4DGT A;  2RFV A;  2D63 A;  4E3Q A;  5C6U A;  4MGR A;  1IX7 A;  3FZ7 A;  3BWO A;  1BT4 A;  1W7N A;  3N75 A;  3FCR A;  4R5F A;  2AY3 A;  3HDO A;  3DOD A;  5HXX A;  1OXP A;  1AJS B;  2OQX A;  1AHF A;  4IXO A;  1AKA A;  1LC7 A;  3MC6 A;  1ASA A;  3Q8N A;  2DKB A;  1N31 A;  3USF A;  3GET A;  1Y4I A;  3A9X A;  2VYC A;  3OKS A;  3AOV A;  3DRD A;  1RVY A;  2ZSM A;  5F8V A;  2AY7 A;  1G4V A;  4ADE A;  4K05 A;  1CQ8 A;  1BQD A;  1M0N A;  1W3U A;  2VMZ A;  3DC1 A;  3DU4 A;  4Y0I A;  3VAX A;  4F5M A;  4MQR A;  1I43 A;  4OC9 A;  2V0Y A;  5D95 A;  2BIG A;  2VMU A;  1DJE A;  2W8J A;  1D7V A;  2VIA A;  1JG8 A;  4RKC A;  2E7I A;  2DGK A;  4UHO A;  1GCK A;  4MQQ A;  1MDO A;  1PG8 A;  5G09 A;  3GSB A;  2X8U A;  2EZ2 A;  4UQV A;  4W1V A;  4Q75 A;  2HUI A;  3AEL A;  4WP0 A;  4EB7 A;  4R8D A;  2QSR A;  1AHX A;  1V2E A;  3BB8 A;  2X5D A;  3GWP A;  3BS8 A;  3RBF A;  3ISL A;  4XJM A;  1C0N A;  4ZSW A;  4RAE A;  1G7W A;  4F5I A;  1G4X A;  1JS6 A;  3EI9 A;  3ZZJ A;  2JJF A;  3DR7 A;  3GBX A;  3QBO A;  1LW4 A;  3I4J A;  1IJI A;  1B5O A;  1M0Q A;  3EI8 A;  3FDB A;  2YKV A;  3HMU A;  1U08 A;  4IXZ A;  3LG0 A;  2ZYJ A;  5TF5 A;  3JW9 A;  3ZRQ A;  3NU8 A;  3BCX A;  3NTJ A;  4IYO A;  5G4I A;  2Z9W A;  4R5Z A;  3HT4 A;  1ELU A;  2VMY A;  1D7U A;  4WYA A;  1TOK A;  3EUC A;  1AIC A;  7AAT A;  1LC8 A;  4ZAS A;  1ARI A;  3M5U A;  3COG A;  1ART A;  2D65 A;  3VK4 A;  4LW4 A;  2AEV A;  4KAM A;  4E1O A;  2BYL A;  4M2M A;  1EQB A;  1TAT A;  2HOY A;  3PD6 B;  1S06 A;  4F5L A;  2VMQ A;  2W8W A;  2DGM A;  2JJH A;  3N7N A;  1ARH A;  3ASB A;  4RM1 A;  3HVY A;  4HVK A;  1J04 A;  1PMO A;  5E4Z A;  1TPL A;  3QPG A;  1AMR A;  1YJS A;  1SF2 A;  2QA3 A;  1WKG A;  3FVS A;  3RBL A;  3EI5 A;  4F5H A;  2W8T A;  2G7J A;  3RCH B;  5EAA A;  3LVK A;  4F5F A;  2W8U A;  2PO3 A;  3DXW A;  4MKK A;  4ZDO A;  4TMR A;  2C44 A;  2VGW A;  4HF8 A;  4K2I A;  1ASF A;  1UKJ A;  1AX4 A;  1VP4 A;  3AEM A;  3HLM A;  1CL2 A;  4ZM4 A;  3RUY A;  3BWN A;  3B1D A;  3WX9 A;  3A8U X;  4M2K A;  2WKA A;  3RQ1 A;  1ARG A;  3JTX A;  3H14 A;  2HUU A;  4M2J A;  5EUE A;  2Q7W A;  1LKC A;  3WCO A;  2YKY A;  1MAQ A;  3WKS A;  1FG7 A;  1ZOB A;  2EO5 A;  2YKX A;  3AEN A;  1OHY A;  1SZS A;  3DYD A;  4WYE A;  2BIA A;  3F6T A;  1JF9 A;  4F5J A;  3G8M A;  4AH3 A;  1AJS A;  3DR4 A;  1YIY A;  4ZWM A;  3OP7 A;  1ASM A;  3ASA A;  2BYJ A;  1MAP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...