4FABH

Three-dimensional structure of a fluorescein-fab complex crystallized in 2-methyl-2,4-pentanediol
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
216
structure length
216
Chain Sequence
EVKLDETGGGLVQPGRPMKLSCVASGFTFSDYWMNWVRQSPEKGLEWVAQIRNKPYNYETYYSDSVKGRFTISRDDSKSSVYLQMNNLRVEDMGIYYCTGSYYGMDYWGQGTSVTVSSAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Three-dimensional structure of a fluorescein-Fab complex crystallized in 2-methyl-2,4-pentanediol.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immunoglobulin
molecule keywords IGG2A-KAPPA 4-4-20 FAB (LIGHT CHAIN)
total genus 38
structure length 216
sequence length 216
ec nomenclature
pdb deposition date 1989-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4fabH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4fabH01
3KLDA 3L3HB 1X5YA 1S7VA 2C4XA 2FBJL 3IXTB 1KJMA 3MFGB 2XNAB 4JFFA 3M17B 4HIIB 1Y6MR 1XF2B 1UZ8A 2J8UE 4NDMA 2EH7H 1T6WA 4P3DB 2FBOJ 4I3RH 4JHZA 5C92A 2CIIB 3VFUB 1RMFH 3WHXB 4XZUA 2DKSA 5J11B 1MQ8A 5DS8A 4YHLL 3QNZA 4JKMA 1CDYA 5C0AE 5T3XH 5C0CE 4CN4A 1AXTL 4ORGB 3I02B 5JHDD 1PAMA 1S8DA 3NA9H 3RUGB 4PJ8A 3RHWF 1VFUA 3GBNL 4S0TD 1PG7W 1FG2B 5IHBA 2ED8A 5C8JB 5IEHB 1IFHH 1CWVA 4NZUH 4QTHA 4MXWL 5CEYA 1H8OA 2YD9A 1IQWL 5JR1H 1P4IH 2BNRD 4LPXA 4KKLD 2HMIC 4L8DA 2DLFL 3Q6GL 3S4SB 3JTTA 2WIMA 3D2UD 4XPTL 1ND0B 3EBAA 4DK6A 4Q9QL 1T2QH 2DQDH 2CUHA 4LQFL 1YNKL 4Z7WE 4Z76B 1XCTB 3VFTA 1AQDB 2NY0C 1J0HA 3MOBL 1P2CA 3OKKB 2RB8A 3BI9X 3HZYA 4Y0GA 1J1OL 3KPSD 2PO6C 5JPNA 4HC1H 4DQOL 1A6UH 5J56B 2EZ0D 5C0GB 2AS5M 3C8KB 5HVFB 4IRJC 3V4UL 3NVQA 2WK2A 3O6KH 3RWDB 5ILTL 4OKDA 1PQZA 3BAEL 1R3LA 4HD9A 5CIPB 4JZNA 4MD4A 4LDEB 4ZSOE 1W2KT 3L5IA 4XP9H 4ZNCD 3E6HA 2DTML 3CSYA 2ATPA 2EC8A 4QWWD 1T2QL 2DQDL 3HG1D 4K3DL 1YY9C 4HUNB 4JDZA 1E28A 2WQRA 2MQCA 4WFFD 3E1F1 3TBVA 5C0JA 4G8IB 5C07B 4XVUC 1LHZA 4NBXB 4I18A 3MR9B 4PGBB 1RAMA 4L29A 5C08A 4S10A 1S9XB 5B4MC 3AU1B 1S7WA 3NACH 1H8NA 3KYNA 5DHVA 2EDOA 4R4BA 2HTKC 2VSDA 4Z8FH 4F80A 3GRWA 3VXMA 3STBA 3HAEG 4I3SH 3N85H 4IOIB 4QRQB 4A6YH 4PGCA 1YEJL 5M95B 3TYGH 3RPIA 4X98A 4MAUH 2HFFB 5CZXC 4ZUTA 4JY4A 1DQLL 3QDME 4UIKL 4UI2A 3VXRE 3O0RH 5E00A 1I1YA 2NY1C 4JVUA 5GIRA 1KJ3L 2PYEA 4ZS6D 1XIWC 5E7BA 3QULA 3PL6A 4PJ7B 1EERB 1MI5D 1M4KA 3I3EA 5EUOE 3GSWA 5D6DA 1R5IB 1RIUH 4S1QH 4H20H 4WWKA 3WLBB 1W8OA 1U91B 2VLKB 1IT9H 2LU4A 4NNXA 1BX2A 2E6PA 4Q0XH 3JWOL 2B1AH 3BZ4B 3MLYH 1HNGA 3EIFA 4H26A 4HJ0D 2AV1B 3ZKND 3IS0X 4YH6A 2R4RH 3DTXA 2X05A 1MFAH 5EU5B 3GMPB 4KWUA 4X6CE 5AYUH 5IBUB 4C56A 3OKOB 4ZAKD 4Z0XA 3LKNB 1WK0A 3AVEA 4JO2H 4HUUA 2WWMD 1FN4B 3REWA 2YBRA 5IESH 5DK2A 4RQQA 4PJ9D 3MLWH 3A6CH 1RZ8A 3LZFH 4TULL 4K94C 5DD0L 5JW3H 1T1ZA 1UACH 4LVEA 4KRMB 3GJEB 5A16B 3K2UL 3PWPD 4RGMC 4Z6AT 1DFBH 5EO0A 3VFNB 3U9UA 4YHOH 3ALPA 5EFIB 1C5BL 3E2HC 2OTPA 1I7UA 4JFZL 1MFDH 4Q0XL 5HHME 1RU9H 1KXVC 5C0BE 5LJYH 4F9PC 4LBEB 1DBKH 3T3MF 4ZUWA 2FHCA 1FFPB 4P5TD 1AO7E 3B5TA 3D18B 4YQXH 4ELMA 5HBBA 1DCLA 3KS0H 3WFDL 1MFEL 5F9OL 4MYWB 4Y7MA 5CSGA 1KTKE 4LGSB 4JFDA 4HWEL 1FC1A 4XX1E 1P7HL 5MEQB 5KSBB 3AFLA 1SEBA 4NKIH 4J3WA 4LCCC 1L0YA 3OF6A 2XWTA 1NGWB 4JN2B 2BXYA 2DD8H 3QNYA 3DX9B 4QRRA 4ZO7A 1EAPB 2GFBA 2EXYD 4F7MA 1QQDB 4P23D 1F58L 4KY1H 3TCLB 2Z31B 4G7VH 4YHZL 4EVNA 4JPWH 1CXFA 1NGQH 4GKSA 3QQ3B 1F8TH 3NZ8A 3V4VL 1ZLWH 3CXDL 4GKNA 3ARFA 4HBCH 4IMLA 3EO1B 1T7WA 4G42A 4OM0H 1INQB 2F58L 2YZ8A 3GKWH 1LK3L 4TNVF 2HKFL 1IKNA 1GGCH 3RGVA 2AK4B 4NQUA 4I77H 4KHTH 2H26B 4PRPD 5IJKA 1IGIH 4ZOAA 4M7JL 4KK6C 4B5EA 5IW6B 1BVZA 2B0SL 3JXAA 2FJHB 5DJ8B 3BKCH 1GIGL 4AQOA 3LEYL 3IDMB 2FL5A 2XRAL 4XBGB 3F62A 2FD6L 3OGCB 4CMMA 1JV5B 1Q0YH 1MCEA 1DUYB 4NYLB 5JUEH 3H9SE 4WU5A 1IM3A 4OGYH 5JZ7C 3VI3F 3MLSH 5I8EB 2YPLA 4XAKD 5AZEL 1E6JH 3T8XB 3TWCL 2P5EE 5GZOD 4PB0H 3VGAB 2CIIA 3TA3B 3CVIH 4XZUB 1QFWL 3O3AB 2OP4H 2FNBA 1DANT 1T5WB 4LHUG 4HDIB 4DKFL 1GZPB 1TJHL 2Z31C 43CAA 2J6EL 3CCHB 3OTTA 4FQXA 4UT7L 1JZ7A 3FOLB 1I9IL 2X4RA 4XRCA 1W0WB 1TQBB 4OLYH 4P46A 1U8HA 3BPLB 4UQ3A 4RZCA 5BQ7A 3B9VA 4WCYL 2A6KA 1LDSA 3F65A 3IU4H 3O3UN 4OLZH 4EN3B 3DHJA 5ECJE 1T7VA 4P49A 3NIDF 3NCYS 3TNMA 1NFDB 5TGBA 4ENEC 5KSVB 4ZUVB 1MCOH 2NY6B 2VB5A 2ZUTA 3RVTC 3FO0L 1CIUA 3G04B 3GSUB 5KSAB 2ATKA 2XICA 3QT2A 4GW4B 5BS0A 2DQUL 3EDFA 2DKMA 1QRND 4GRWH 5DK0B 1CD1B 2VLME 2XFXA 4KMQA 2DS4A 3EYUL 5ACZA 1Z6JT 3D0LA 5EIIB 2YPLE 4F9PA 2IQAA 5D96B 2NXZD 2VITB 3VFUA 2D0FA 1YNKH 4LSVH 1RIVH 4NBYB 4J2XA 4RA3A 3WFHB 4WUUD 2B5IC 2MWCA 5K9JL 4RMSA 1YMHB 5DURD 2XN9E 1Q9WB 1CFQA 5D2LE 3UZVB 2DTSA 5MERB 3CDGB 5EULV 2IANE 2P7TA 1J88A 4HWEH 2EDTA 1FG2A 5ESAA 3VXPB 2ESVA 3UTPD 1QBML 4OFIA 4JJ5B 5D4QA 1YEHH 2WANA 3THMH 1UH3A 4S0SD 1N0LA 4P4KD 4BELD 1F90H 3IJSA 1B90A 5F71A 4L8DB 3S4SA 3GBMH 4XTRC 4GXVL 4X7SH 4N0UE 1F4HA 1MAJA 3O9WC 3GJFK 3KR3H 3VWKC 1U3HB 3T2QA 4CVUA 1KLGB 2PTUA 4H1LB 1F4YL 3P0VL 4LNRB 3JV0A 5CD3A 2BHYA 3FAXA 4NKDB 3VWJB 3RVWD 1TCRB 5GGTA 2P44B 4AIZB 2ZNXA 2WUCH 5JXAL 2W0FA 2A6DB 4NUGH 1J0YA 2GAZB 2GYSA 3SN6N 2GSGB 4PJ5B 2H8PA 3RJDA 1HH6A 2EZ0C 2IANA 4ONFL 5DURB 5HPMB 2F5BL 3PE9A 4NQVA 2RFXA 3UP1A 2X4QB 4PTTA 3PQYD 4U1LB 3O3DA 3QUXD 4EXPX 4LKCB 4GXVH 5JQ6L 1TQBC 3TBVB 2W60A 5EUOB 4UOW0 1JPGB 3QEQA 4HFUL 2R69H 5FO7B 4R8WL 3SJVA 3VI4F 2B7DT 3TPUB 5EN2B 4XWGH 5KVEL 1BWMA 5FKPA 1RHHA 2PXYB 4MDJA 2Q1EA 4I0PC 4WCYH 3BZEB 2ZWLT 4GSDL 3BWAB 4F7PB 4NUGL 3MRQA 2X70A 3H3PL 1QEWA 3IFPA 4FQHA 3ARGC 2IJ0C 4XMPL 3TWCH 4ZO8A 1JGLH 1IGJB 2XN9D 1S7QA 5E2JA 1I1YB 3CDFA 2F8OA 5J9PB 2FECL 4GAGL 3V0VA 1I7RA 2KPNA 4RGOL 1A1NA 5DGRA 3VWJC 1UCBH 1DQJB 3VFSB 5FYKL 3P9WB 1NC2B 4NN6B 4WU7B 3OKNA 4JG1L 2VDOL 1RSFA 2F19L 3KPOB 1F6AB 4X4XB 1X3DA 1HHHB 4JFDB 3BZ4A 1QRNE 4R8WH 3UYRL 4JZJA 1RU9L 1MNUH 3RWCB 3MXVH 1WZLA 2YSSA 5FM5M 4B7IA 5DRWB 1ZMYA 4HW6A 4ODTH 1JPTL 4KK9C 2YD1A 4NHUA 4JN2A 4S11A 5C07D 3BQUD 5IB5A 3RWFA 4WTZA 5KN5A 1AGEB 4G8GA 4MAYC 2BNUA 3S5LB 15C8L 4EDWH 2P1YA 4PJXE 3OJ2C 1N59B 2R0KL 4M4PA 4WI5A 3UAJD 4Z8FL 4TSBL 4R4NC 1RZGB 1TTGA 2WBKA 2Y36H 5KVGL 4G42B 3TH3T 4UV7L 3KLHD 1IZKA 3GMOA 1NLBH 3MCG1 2FBJH 1S8DB 3U0PA 3RUGA 3SHSA 1U8JB 3L7FA 5GS1A 4YXLH 4L3EB 2OJZL 2XTJB 2HLAB 4K8RD 3I6GB 3QXWA 4I4WB 3PWUA 2ZG2A 5M7QA 4JZOB 1I3RB 2AXFB 4FXGB 5HHNA 4WFED 3BE1L 1RIUL 3HE7A 4NC1C 1NC4B 5KVEH 1SYVA 3FB5A 1AHWB 2EDYA 3KR3L 4ZPTB 5GS0D 3ARRA 1LVEA 1IM3B 3EJYC 3O3BB 1FSKB 2Y07H 2GJ6A 2WINA 4XHJC 4R26L 4ODTL 1Q0YL 1YJDC 1C12A 1DLHB 2ZCHH 1IM9A 1FNEA 4Y5VA 4ZDHB 2XYCA 2NMSA 2VLRE 4PJ7F 4LARL 1TPXB 4PGDB 5GHWH 3RWEA 3MRLB 1I4FB 1AGDB 3QUZB 1E6JL 1ZSDB 1RUAH 2Q86A 1H5BB 4XNQA 3HA0A 4CVZA 4L4VE 2X4RB 4LAJH 4XRCB 5J3HC 1A2YA 2W9EL 4P46B 4JRWA 4FQCL 3FKUS 3Q0HA 4YJZL 4MJ6B 1GC1C 2A6KB 2GJ6E 1GXEA 1VHPA 3M1BB 4HS3A 4UIMB 4XVJL 1VEOA 2LU7A 2XTJD 1FNFA 3DWTA 4DGVL 3TJEL 2VOTA 1CLCA 5DJ8A 1MREL 1NAMA 4D9LH 4XWOC 4RNRA 5JDJA 1MHHA 4U6VH 4BK4A 4LU5L 2KQMA 3DI2B 4QNPE 4HK3J 2QJDA 5CJOL 5IFJA 1D9KA 2MTPA 4WU5B 4J3TA 1AHWC 1JZ8A 2EKSA 2HA1A 4OLXL 3MUGB 5C0JB 4O9HH 5C07A 4JHAL 4C57C 3RNKB 1UWEH 1FFNA 3TN0C 3UDWC 4MAUL 4PGEB 4HS6A 3VXSB 3L3IB 1YEIL 5HY9A 2A9NL 3WFEH 1G7MB 5KANG 3VXMB 2G60L 4HDIA 4DKEH 5FYKH 5CGYC 3ZKMD 3DRTA 3L5HA 4YHNA 2MJWA 4YAQB 1JPFA 4KZDL 1ZS8B 5MENE 2F54B 5MERA 2Z35A 1K8IA 2IFFL 2W65B 5KSBF 3DUUA 4OB5H 4F3FB 1JGEA 1EEQA 1SMOA 4MX7A 5CEXB 2VR4A 4LHUD 3DXAD 4OJFL 1U8QB 4PBVC 4YPGA 1V3KA 3IDXH 4PJ5D 2NQCA 2CRYA 4HKXB 4UU9B 1XMWA 3FB7B 2GHWB 2DBJA 3N9GH 5INDA 1T66D 3D9AL 5A43C 2NY4B 4AEHH 1QBLH 3QDAA 5BS0B 5GGVY 3VRIA 4EQ2A 2MPAH 1KJ3H 3VFRB 5CD5C 5HHOA 3KPMB 3I6KB 2OLDA 2XIDA 2YN5A 5DJ2B 2IBZX 3LKNA 2C7UA 4BKLB 3BYTA 4S1QL 4X8JA 2EH8H 5DJAA 3WFEL 3PQYA 2Y6SC 5FKAB 5E9DB 2E6JA 4QRUA 4HWBH 3I02A 3OSKA 1TZIA 5HPOA 2A73B 4P2QE 5CD3B 4TNWK 1G6VK 4KHTL 3QPQC 3PABB 4IS6A 4LSPL 1MAKA 3TH4T 2ADIB 4QHKJ 4ZTOH 3GMLA 5EO0B 4Q9RH 4U7KA 3VFNA 5ISZA 1CFQB 4LASL 3IAQA 4N8CH 4FQPA 5IJKC 2G2RA 3G5XA 3H9SD 5ERWB 3RWJB 1YEDB 3CGTA 4AEIH 4UBDD 4HV8B 5JIHA 3OR6A 4YBQD 1JRHL 5JPMA 3ARFC 5IF0B 1KLFA 4M6OH 5H37H 2BOCB 1G6RL 1HWGB 3T0EA 5T3ZL 1U6AH 1V7MH 4C55A 3KPPA 4GRLB 3QEQB 5FO7A 3SJVB 4DKDC 1CZ8H 3DIFA 1JWSA 3TA3C 4PJHB 5HYJA 4GAJL 2FLBT 3QNYB 5JW4R 5B39G 2PXYA 3B6SB 4HWBL 4XPBH 1ZLUH 2ZCKH 5DO2C 3E6FA 3RVUD 1DBKL 4I3RL 3QQ3A 4NN7B 3W5NA 1FVCB 3CFIC 3NZHL 4MDIA 1R3KA 3JTSA 4OBRA 1NFDF 1LO5B 1A3RH 5C09A 5EU3A 1NMCC 3ES6A 4BSJA 1RJYA 1G7JB 4PJ9C 4Y2DA 3S3PA 2A6DA 1NGPH 5GXBB 2E7LC 4LLUB 4Q9CA 4KRPB 2BZDA 3RI5K 5FYLE 2ARJQ 4PRAA 2G5RA 5I8CB 4MNGB 2HJLB 1T1XA 2R0WH 1KFAL 4WUUA 4HUKB 1CICD 4JN1L 1HH9B 3OKDB 4JY6B 5IM7B 4DEPB 3O3DB 2NXZB 2VN4A 4PP2A 1C5CL 2JIXB 2YD5A 3MRMA 5SV4A 3S35H 2HFTA 4XP1L 2LVEA 2V9TA 3A6BH 3O4OB 1CS6A 4I2XA 1G9NH 4CVXA 3QIUD 3U0WH 5GSRA 3S37H 1IT9L 4WTXA 3UYRH 3V52L 2HFFA 4HG4K 2QADD 4UAOC 4MDJB 5GGVH 4YDKH 2DF3A 3KYOA 1J8HA 4XC3H 1IKFH 3NCMA 1ODAA 1JUFB 3BN9C 5T1KD 1PLGL 5EA0H 4DW2H 1JI2A 1J0JA 3A67L 1UADC 3HMXH 1LE9B 4GFTB 4X7TA 5I1DB 1LO0L 5C0ND 3KPSB 3X14B 1SYSA 2HVKA 2FEDC 1UM4L 4WNQA 2EYSA 3I6GA 2VLLB 3T65A 1WTLA 1AKJB 1YECL 4FZEL 1S78D 4TNVK 3DMMB 1NMAL 1UKQA 2EXWC 4RFOL 3LZFL 3W9EB 1L0QA 4I0KA 1Z5LB 1F45A 3L3KA 5DJZA 5DRXB 1B0RA 5DMIL 1EZVY 3E3QE 4CKVX 2QKIA 3MREB 4XCEB 5JLZB 4F2MA 1OAYH 4C56B 3G04A 2WINB 3BPCB 1OP9A 1ZLSL 1TLKA 1WJ3A 4NIKB 1FCCA 2N7BA 3KLAA 4JPVL 3FRUB 5HDQL 1PKQA 4HLJA 25C8H 3PUCA 5FUCE 2ADFL 1YNLL 3UTTD 1WWCA 3BP7A 5D2LA 5I74B 4IRJD 3FONB 3BH9A 5FO9B 3HAEA 2VUOA 3QQ9D 4HG4J 4RBPK 3NGBC 4ELKA 1U58A 2QQNL 3O45B 1J8HE 4D8PB 5IVNA 3D6GA 1FZJB 5K33A 4BSVA 1NJ9A 1WF5A 1ZHKB 5F6IC 4NQCA 4P4RA 4UIMA 5K93A 3WDJA 3D69A 4FQQB 5KVFH 3ALWA 3ARBC 1F8TL 2MHAA 1XCQA 4F7EB 1CFNB 2ZOLA 4OI9A 5MEQA 3QZWB 2DICA 1KJ2B 1OB1A 5AAMA 3CFJB 4PJEF 1G9EA 4IOSD 5CFHA 3SPVA 3CFDB 2ARWA 4O4YL 4CJ1A 2EKSB 5DMKA 2V2WA 1BGXL 2XG4A 3MUGA 2OMNA 4KI5D 1IE5A 1K3IA 4WO4B 4G9FD 4OCLC 4NDMB 4WW2C 5IVZA 3QJFB 3LAFA 4P3DA 2ZUQB 5JNYA 2V7HA 4LCWB 3FO1B 1BF2A 1CL7I 1A3RL 3FN0H 1YQVH 4ZDHA 5DSCB 3UTSD 5H94B 3GUTB 4FFZL 5IK3A 4JFDD 5LAXB 3FRPG 1JHTA 2YZ1A 4OV5B 3KJ4B 4EIGB 1INQA 3BGFB 3QB7C 3QQ4A 3F7VB 2C1PA 1WIUA 2OTWB 5F1NA 1MH5B 4P5TA 3OPZH 3VWJA 1TCRA 4RGND 2NXZC 4OZIB 4X9FA 5EORL 2F8VA 5EOCJ 2HH0L 1FV1B 1YC7A 1Q94A 2R2EB 5T3ZE 1JGUH 1MCKA 2Q7YB 1WBYB 3S98A 1WUNT 5L9DH 2X9WA 4AENB 4QWWC 2DQTL 2R29H 2WWMC 2KUTA 4KDTA 3Q2CA 1JHKH 4GG6E 1YMME 1EJOL 4ZFFA 1PYWA 3GK8H 4N8PA 3QIBD 3F7RA 4OLWL 4N8VA 1QSEE 3WHE0 4JY5H 4Z7VA 1MRDL 4M6NL 3I6KA 5EU6A 4EEEA 1AQDA 4XMKL 4GRLD 4F7CA 3RQ3A 3VXSA 3C08H 3ILQC 2NW2A 4FN0A 4OF8A 1CLYL 1I3UA 3I9GH 2X4OB 2AEPH 3U36B 5CMAA 3IF1B 3MNWB 1U8HB 2Q8AL 4WWKD 1MIML 3GMLB 3FFCE 2G75B 1F97A 4DK3A 1P2CB 3T4AB 4ONOA 4WEBL 3PL6D 4J8RA 2ZKHH 3RWJA 1PZ5A 4FXKB 2XA8L 5GISH 3SGKC 5I8KL 4CRPA 3HPLB 3WIHA 5BXFB 3WNMA 3QZWG 4XCCL 5CWSB 5CJ5A 1S9KC 2YEZA 4NSKB 4XMLH 5ANMA 2CKBH 1Z9MA 3IB4A 1HHHA 4NUJB 5DA0B 3CLFL 1IAIL 4RFEA 3BKJH 1BMGA 5HGAA 1MHEA 4WW2F 3KPMA 2AABL 5DRNB 1DLFH 2ICWI 3C6LA 1QSEA 5B3NA 4FXLA 4HSQA 1N4XH 1VPOL 5HVHC 4HLZG 4X4YA 4K2UH 1CDIA 4O5LH 4QRUB 4JEGB 5CD5D 1S3KH 3NH7H 3SDDA 4JQVA 2X7LB 5AUMB 4PJ5E 3CDGA 1OQOA 1BD2B 1FLTX 3VCLB 1BLNB 3K1DA 5HD8D 3SQOL 3U0PB 4KDWA 1AXTH 1BFSA 4P5TC 3B2UC 4X4MA 5J13C 4X9IA 1T1WB 5C09E 4NNXB 4U1JB 1FHGA 1PG7H 4LLVA 4MCZA 1A1OB 2BVEA 1X4YA 3PL6B 4PJ7A 12E8H 1HH9A 2V9RA 3IU4L 1X5LA 4OZFH 1DBML 1UWEL 1IAOB 2ZJSL 4W70A 5BOPA 4OD3L 3QUZC 1U8KA 2DOCA 3MRMB 2KBGA 3ZYOA 3VXSD 4PJIF 4G6MH 3LN4A 1QRNB 3GSRA 4Y1AA 5JHDE 3VE0A 3R1GH 5CIPH 2HLFC 2JK5A 1D6VH 4NRYB 5F88B 3O2DL 4H1LA 2EDJA 3SDCB 1JNNH 4BUHA 4KZDH 1XT5A 3WIFA 3R0MA 4G5ZL 3QIBA 4WI3A 2ADGA 4XCFL 1WBZB 1IEAB 4KC3B 2DLHA 3RX5A 5I30H 4ODHH 3NCEB 5FYLH 5BW7A 1U95B 3O6LH 1CGVA 2W0FB 2BSRA 1KIRA 1MFAL 2GAZA 3B9AA 4UT9L 3BW9A 3DRQB 4I8DA 3STZA 1WGOA 3BP4B 4LBEA 4BZ2H 3A67H 4N9GB 2ZJSH 1WICA 1BZ9A 4MMXC 1TJIH 5JHDA 2OQJA 1J05B 4KK5C 3ULVF 1JNHB 5IMLA 5LGKA 2G9HA 4BJLA 3FQWB 2I9LA 5TJWK 3FFDA 4PV9A 2DQGL 4Q2ZB 5C6PB 1D5ZA 2XWBA 5IVXF 1N6QL 2VLRD 3V6OE 2CK2A 5I9QC 5F7LB 1HHIA 1W72L 2AJZB 4MA7H 5HGGS 3O0RL 5B3JF 4U1NA 4RGOH 1K4DA 4HH9B 1ZT7B 5DHXB 4HH8A 4OLUH 1CICC 2IC2A 5D1QD 3MLVL 1M7XA 3UTSB 1KELL 5D5MA 1RUKL 4UZGA 3MA9H 3RAJH 2BFVH 1JVKA 4NN5B 2B2XH 5INCA 4H8WC 3U30B 2NY7H 1IGJA 3OKMB 4POUB 3QIUC 4GBXA 1P4BL 3GKZA 5MEOA 8CGTA 2FJGB 2PYEE 4RDQG 3V7AE 3CFEB 1FNAA 4JFPB 2O93L 1F4WL 1SM3L 1JPFB 5C6TL 3ZYJA 1GOHA 2A6JB 4U1MB 4UMGA 3NIDE 4L3ED 4O00A 1F6AA 2R39A 4NQCD 4V1DE 1F6FB 1XCQB 5T3ZD 4ORGA 3RDTA 2JCCB 2DJ4A 3LQMA 3IDGB 5TE7H 5ICYB 3TFKC 3S88H 5C71A 2VDQH 4UU9A 2R0ZH 5D6CB 4XB8A 3ROOB 3MREA 1F4XH 2FJHA 3T3ME 5JW4Q 1N7ML 3MXVL 4LCCA 2X42A 4XP1H 1LWRA 1J87A 4PREB 5IT2H 5D1XB 3X11A 4WUUE 3MOBH 3MV9E 5LAXA 3X13A 4M43L 5DEGB 4WHYH 3CCHA 5C7XL 2PW1A 2R0KH 1AIFB 5FOBA 3QIUB 1A6WL 1IRAY 2OTWA 5F1NB 4CAGA 3RWIB 4G43B 5FHAH 1AJ7L 4R97B 5AZEH 1CFVH 4KQ4H 1J10A 4P2QA 2DI8A 1LO0H 4OIIL 1Q94B 2R2EA 4N0RA 1NUGA 3F7QA 3R8BB 1S7XB 5DJXB 3IDNB 2UYLA 4Y4FB 5FO8A 4HT1L 4UTAH 3MODH 1XF3B 2NCMA 3LQAC 2VH5L 2VE6B 4KI5F 1MRCH 3WO4C 3L3GA 3QR2A 1RZIB 3V6OC 5C0DA 5KSAC 4MJ4A 2PXYC 1EHXA 3O4LA 5D2NB 3RWDA 3CC5B 4GAJH 2D4FA 4GOSA 1A1MA 3DSFL 5BVJA 2QR0B 4Z78A 1EUUA 5E2UH 2OX5A 3WUWG 3P77A 5E8OB 1EO8L 3RY4A 1MNUL 3H9ZA 3QJFA 4JKLA 3SE3C 3MROA 1MFBH 4P9HH 1X5FA 3GSUA 4K23H 3V6ZA 2DQFB 4M62L 1TVHA 2XWJB 2G5BA 1U3HD 1QKZL 4DCQB 1EHAA 5MP6L 2VISA 3QWOA 1BIIB 3U7YL 5CLWA 2OXHA 2WUBL 4TTDC 2UUDK 1EEYB 3I6LE 2FX7H 4AEFA 5AG9A 5B38B 2IEPA 1NMAH 1S7WB 1CFTA 4XBPA 3OR7A 4PJAF 4POZC 3EYFB 1JNJA 3R0NA 4GBXC 2P47B 5I6XB 2IAMC 1G7JA 3VXOA 1FE8H 2HFGL 4P59L 1CF8L 4P9HC 2D7PA 1ED3B 3IFLL 3EFDH 1YPZA 1RULL 1KCVH 3EOTH 4A2MA 1N64L 2Z8VC 1YUHB 2VDRL 5I1JH 5IB3A 3QI9A 5L88L 5C9KA 3TNNA 2DLGA 5HGAB 3UPAA 1XAUA 4WHDA 3QHZL 5BV7H 2FO1A 1KCRH 1GVIA 1DBBH 3GEWB 4KQ4L 5HDOA 3S36X 1KCUH 1OCWL 3MO1A 4UDTA 3CPLB 2W1NA 1YEHL 1A9EA 2CPCA 5C2BL 3BPNB 4OZGE 4LLYA 5F70A 4F33B 2ENSA 3P9MA 4FFZH 4JN1H 2X7LA 3GMPA 3CVHL 2EYTB 2MCPL 3B5HA 3I2CH 5HI3C 2IBBA 4DGYH 3P4MA 1JUFA 1ADQL 1CN4A 3O6FA 4KKNA 5CAYB 4WEUD 1J86A 3R06B 3HC3H 1BJ1H 5F44A 3EFFB 4P2RD 1IGFH 1P1ZA 3F7PC 5JQHC 5GGSY 4P5MB 1HDMA 2K7PA 4OT1L 2F9BT 1XGTB 2AJUL 4OFYA 4L4VB 2F15A 3BDYH 4UNTA 5L9DL 4YNYB 1AO7D 1IAOA 2A6IB 1U93B 2HG5A 3HMWH 2GT9B 5CCKH 2I26N 5D7SH 3TBTA 2DIJA 3MJ7A 3VFPA 2XKNB 4F2MB 4EI5D 3WCYA 2GJZA 5HI5C 3TPUA 1Q38A 4DFHA 3ZKXC 4WGVB 5F7DA 5C0EA 4QOKB 1QSFE 3UBXB 5E99H 2FHFA 3EYOA 4DAGL 3WIFB 2WMPA 3QIBB 4KH2A 3NABL 1QBMH 2IPUG 3MRQB 4JG1H 1JZ2A 3TP4A 3VGGA 1CGWA 3IFLH 2XWTB 4G7VL 2CIKB 1F4AA 2EECA 1XR9A 4NJAL 2NY4D 1TFHA 3S37X 4WDIB 1ZA6A 2X4UA 3X17A 3DXAA 2W91A 2AQ1A 1YYML 2VXSH 4OV6F 2Z8WC 4MS8D 3H7LA 1S7SB 1YN7A 2DLFH 3Q6GH 4Y16D 1EHLH 1CE6A 4J4PC 4M5ZH 4IIQC 1TJGH 2DDQL 1NC2A 2X4NA 4P4RB 1LMKA 4Z7NF 2GUOA 3ISWA 4IMLB 4Q58C 1I7RB 3QXAB 1QSFA 5DTFB 1LE5A 5I1IH 5E6IB 5DUML 2ED7A 3NIFE 3FFCA 3QZWA 2BOBA 2WWKO 1MI5E 3VD3A 1D7FA 4NGHL 3EYVA 4Y4HD 4BZYA 4YWGH 4IMKA 1MOEA 5DMKB 4J3VA 1I1FA 5E2WH 5DD3L 3NCYP 5GZNC 3QDMD 5CBEB 3DX6A 4X6EA 4Z7UA 1C8PA 1MWAL 2VSCA 4QHKI 4LSTH 4LCWA 5FK9A 1X7QB 1R0AL 2OXGA 4WUKL 1BQUA 1J0KA 2MOVA 1WBXB 4NOBA 5LKNA 1QPPA 4WW1B 3RKDC 1FL6B 2APTA 2BHUA 3BIBX 1FZOA 3U1SL 1X6LA 5E1AA 5K9OA 1T21A 7FABH 1X5AA 1VFOA 3SKMA 1OHQA 1E27A 4M7ZC 4S1RL 4YDIH 4BH7B 2VO5A 4XWOD 2IMNA 3RVXD 2F53B 5J6GA 4DZBB 4JAMA 4E42B 2UY6A 3HTLX 4MNQB 2QADC 3QIWB 2Y6SD 4N0CD 3IKCA 4QF1B 3BFOA 1QTYT 5ILTH 1I75A 4QRRE 1MVFA 5F9DC 1LP9E 4P57A 2YXFA 5EORH 3EJJX 2EDNA 4H25A 4ZUVA 5D1XA 4POYA 1JF1B 1BZQK 3LKQA 4PG2A 3SY0A 2DL9A 4KKBD 4L3AA 2KKQA 5F7HA 4IRSC 4LK4A 2FZ3A 2EIDA 5HJ3A 4UINH 1GGIH 3MRNA 4OT1H 4C4KO 3CFEA 3D0LB 1NCCH 5EIIA 1K85A 5HDQH 2X1PA 4IIQA 3CIQA 4UT9H 4JFXB 2OZ4L 2WV3A 4K8RL 2OZ4A 3U48A 1G7IB 1K5NB 1S5IH 5EZIH 4PRBB 5EU7E 1SY6H 1WVZA 1MJUL 1NAMB 1JYNA 4Z7WF 2MCPH 5KW9L 1A7PH 1N2RB 3UJIL 1NH6A 5C0DB 4BM7A 3MOAL 5IMMB 5IB2A 4EKXA 1MCIA 5BVJB 4OLVH 5ESAB 3V6FB 5ALCH 3K1KC 1WIOA 3JV4A 1I85A 3CZJA 2O5YL 1N5YL 3RNKA 2PTTB 3MZGB 1BAFL 1MHCB 3HNTH 2GEEA 1ZEAH 3W11C 1Z9LA 5MEPA 1Q8MA 3W2DL 5E4IA 3T3PF 1KEML 1OTTD 2GK0A 3F7YB 4PTUA 1IC5L 3WD5H 4X4YB 1FIGL 4HIEA 4U6VL 1I3VA 5DEGA 1PZUB 3GGWB 3VRJB 4F15B 5C1MB 2HT2D 1FNGA 1MCSA 4M03A 1ZS8A 4ZXBD 5HHVL 5HGBA 1FYTE 2NY3C 1Q0XH 3UTQB 1UVQA 2CKBA 5DI8A 1CFNA 1AI1H 4X99A 5CEYB 3IDNA 4CADB 3K74B 2XN9A 4HKXA 1Y18B 2R2BA 3CFDA 2DTMH 1D5XB 3WMSA 3DX8B 1J1XL 4DGIL 2K1MA 1KEGL 2ZUXA 1K9TA 5T1LB 1GGYA 1I9RL 4X6BB 1HH6B 2IANB 4Y5YB 1O0VA 5KS9B 3LPGA 6CGTA 2GSIB 3ROLB 3V4PH 3QEQD 3SJVD 2RHEA 2YA2A 5D7KE 4WFHE 4WY7L 2HWZL 4U1LA 2PW2B 4FNLL 5DD5L 3WFDH 4Z9KB 4F58L 4NJ9H 2FX9L 2ADGB 3GI9H 3N85L 4A6YL 3PGDB 4FQXC 1JPGA 1EEYA 2ZG1A 5C0GA 4OUUA 3QHFH 5DJAB 3SDXA 3BGMA 3QRGH 4WI9A 3OKKA 3TM6A 3BT2H 1NEZA 3CZFA 3E2HB 1N26A 3X12A 4KKAD 4EIZC 4JGJA 1LP9B 4LOUC 2ATPB 3BISA 3KYMA 4JLRB 4JPWL 2PETA 2YD4A 4NPYA 4YZFF 1P7QD 2H2PC 3FQTB 2A0LD 4YR6A 2M8XA 1VACB 1W0VB 1HHIB 3TZVB 1X5ZA 2VLKE 4F7CB 4PIRF 5CUSL 3FO9A 5E5RB 5F7DB 2CLVB 5IHUH 3FQNA 4OCWH 1Q0XL 3WXWL 3B6SA 1NCCL 3PP3K 5DD1H 4LSDA 1C16A 4LSUL 2UWEF 3RPIB 3WJLA 2YSSB 5IBLC 5INCB 1KIUA 1S7TA 3T4AA 1YJDL 2VL5B 3DXAB 3DO7A 3LEVH 4PRDA 5TDOA 1T6VN 2H32A 3VGBA 4U7SA 5IBTH 2B4CH 3EYQD 1DFBL 1RK0B 1AR1D 2NW3B 2HJLA 1Q9LA 2K7QA 3PHOB 5DQDL 5DTFA 1U3HC 1T0NA 4L8SA 5GJSH 2FB4H 5ESQB 3LPFA 4LLUA 5IM7A 5HHMB 5C0BB 4QRPA 1R5IA 1FZMB 4WWKB 1Y0LB 4HF5L 1GC1L 1QKZH 4NO2A 2Z93B 4J3XA 4J3UA 1ZHBB 3KNBB 1M6OA 4HHAA 4YBLC 5FDWA 5EZIL 1KXQE 2Z91A 4ZYKA 5F6IB 3AUVA 4XNMB 4OZGF 1JIBA 2BVOB 5GRUH 1AHWA 3UCRA 5I1AA 3T77A 4JDVA 4UDUA 3BSZH 2WBJD 4PRHA 5DUBB 3B2UD 5DJCB 3C9NB 5EPMA 5GGSB 4I9WD 5I75C 3EFDL 5TF0A 5JQ6H 1LO2L 1CG9B 1ZGLP 4P2QB 2PF6A 4FFYL 1E27B 3HC3L 3HNVL 3RL1A 2X4NB 1Z5LA 1G9NC 4P46D 4MLIA 1ZLSH 5DDHA 2UYLB 4LCUA 4HMCA 4YXKL 3MYJA 4JAMB 4E42A 3KJ4C 5IQ7L 4AMKL 3ILQD 4EBQL 1NDGB 4NRYA 3WLWC 1BQHG 5FUZL 5C2BH 4Z7WA 5EZJB 1I7TA 1Z0MA 5FYJE 2VXTL 4ISVB 4WRLA 1JN6A 4QHUA 4ZD3H 1ZA3B 5F7WC 1T83A 2V2TB 2YPLD 4OGYL 5L2KE 4QTIL 4NKQB 5HDLA 4QRRB 2CO7B 1L0XA 3S6CA 3LMJH 1GYAA 3HE7C 5T5NF 1S9WA 1NC4D 3BP7B 4V1DB 2GTZB 1A14L 3BH9B 5FO9A 4HX1A 1ONQA 2XA8H 4I77L 2YPVH 3N0PB 4JFZH 5E1AB 1I7ZA 4P2YA 3O2VL 5DWUH 1NCBL 4XB7A 5F7FA 3NOIA 3NIGE 5CCKL 5I1JL 4Q6IA 1A7RL 4YHYB 1I1AA 4HWBA 1NCAL 1NLDL 2AGJL 1UKTA 3ZE0F 4Y4FC 3ARFD 1YEFH 4M1CC 32C2B 3VDBA 5DJ6B 1OARL 1A7PL 4MD0A 2BNQA 1VFAB 3RIAF 3FN0L 3NCJH 1H15B 1WZ1L 3VFWB 1JJUA 1CVRA 2DQEL 4Y16A 4MNGE 1MFCH 3RZCD 2PTTA 2LTQB 3LKPA 4QRRD 5GS3A 1ORQA 4ODWB 3O41A 1UM5H 3O3AA 5BCAA 2A9ML 4DGYL 1RURH 5TQ2H 4YIQB 4LLYB 5CINH 1CE1H 4MVBD 3D25B 3Q1SL 4PJDB 4YQXL 5HTSA 5D7LE 3WD5L 3FMGH 1YN6A 4OLEA 1ZLWK 5L7XL 3IDUA 3T4YA 5EIQA 1CD9B 5I8CA 3P4MB 2IWGA 4PJGE 5JOPD 3J8F7 3KLSA 2BRRL 4GO6B 2C1PB 5IJVB 4DW2L 3VWKA 2E9WA 5FIEA 4JANB 3ARGA 4M7ZB 5KG9B 1NFDA 3VXME 1OSPL 1GGUA 4PJFA 4OZIA 3LRHA 2BVPA 1ZXQA 5IR1B 3PWPA 5C3LD 3KXFA 2Y23A 4X6CA 1SEQL 1YEDA 4XNZB 1KN2L 5CIPA 2RCSL 4R0LC 3U7WL 5FF6A 4TQEH 4OIIH 2XKNA 1RJLB 2WWKT 5I71B 4XXDA 3O6FD 3WE6A 3O4OC 5HI4C 3BDXA 1NMCB 4U1HB 5IEKA 3QCVH 4C56D 1EX0A 2UZIH 1FCGA 2CDGA 1AY1H 4OLUL 5D72L 5LBSH 2XA3A 2GK0B 3KPRB 4XNUL 3ZDYE 3WN5C 5D71H 5GPRA 3KHQA 2NY2D 3K4ZA 1NLDH 1T2XA 2FX9H 2P24B 1FNHA 2EIZA 1TCMA 4NWTL 5A40E 4LLMA 4OM1H 5ENWB 3LIZH 5DD5H 1K6QH 2FEDD 5FO8B 1U8NB 1E6OL 4ZXBC 3WS3B 2LE9A 2AV7A 4YE4L 3LSOA 1OGAB 1S5HA 5B8CA 5GRJH 2FO4B 5IG7A 2IALB 1PD6A 4LSQL 4ZO9A 2DAVA 3NCCB 4NM4H 5C0FA 4FXKA 5I15H 4GAYA 2DQIL 3CMOL 1P7KA 3LN5A 5SWQA 1NCWL 1N4XL 4JM2B 5BJTB 3GHEL 4KJYB 1BP3B 3RVTD 2F8XC 1G9NL 5ANMB 4HAFA 5AZ2H 3LS5L 5I71C 1EO5A 4WGWB 1JZ6A 1RJZA 3ZTNL 5F6HI 3LQZB 4X80H 4LPVA 5IHZB 1IL1A 3BPLC 4ELME 5B38A 1X7QA 1RIVL 1UXWB 2JIXA 3N1GC 2XACC 1MLBB 1VKXB 4OF6A 3OKOA 4KGLA 2ZUQC 4M9PA 4Z0XB 4HJ0C 4RBPH 2R1XA 3LN9A 5B38G 3KPRD 4P9MH 2QL1A 3REVA 3ZKNC 4B53A 5GSRB 3VXOB 4PRDB 3QEQE 3SJVE 5C0RL 1FGNH 1M7IA 3D85D 5EUKA 4QEGA 2D0GA 1OVZA 4G6KH 3CH8A 3W0WB 2YK1L 3O4LD 2NW3A 1LP9A 1UJ3C 3TBSA 1M7DB 3H0TA 4Y8AA 4MCZB 3SDAA 3ARBB 1YJDH 5IB3B 3QDJB 4P3CH 3KPSA 3X14A 2CUMA 3SDYL 2DWEB 2C1OA 2OI9C 3W2DH 3BPOC 1BJ8A 1CFBA 3IFNL 2Z91B 4HULB 1V3MA 4NC0B 4P2QD 4CUCA 2D2OA 4OCMC 1KJVA 3B4NA 1QLFA 4KVCH 1FYTD 4F33A 1FIEA 5I1CH 3O8XB 4GMTH 3V0WH 2AK1L 1E4XH 1T83C 4MA3B 5HHPB 4QHLB 4NQDA 3CK0H 3TVMC 1EFXA 1JRHH 1Y6NR 2Z92B 4Y4KD 1D6EB 5HGHB 1KIRB 4D0BB 2VAAB 4WJ5A 3DVFA 3EFFA 4HIJA 3EDKA 3GO1L 4LPWA 2H3NB 3BZEA 1UB5B 3ZKQD 2R23B 4Z5RA 3MJGX 4JHAH 5J6HB 1WCQA 2BY0A 5T5FL 2EDRA 4WV1B 1S7QB 4L4VA 1NL0L 3CX5K 1IARB 5EB9A 3S8WA 4FTVE 3UTZA 4HAGA 3MRCA 4LDLB 4JFOA 3FMGL 1ZKAA 1DQJA 3VFSA 4D0CA 1P4LB 2YKLH 4QRPB 1UM6H 4PY7A 1A3LH 4U1NB 4X0KB 1NGYA 4FNLH 4U6XB 2VZSA 2DMBA 1MLCA 5GRWA 5EBMB 1CLZH 4BZ2L 3FTGB 4ISVA 1MCPH 2ZOLB 3FFDB 3UTOA 3WDHA 2I9TB 3UBXG 2M1KA 4I1NB 2XQYG 2C9AA 1OW0A 5DRWA 4BQBA 4UDUB 2DQJH 1PEWA 2D3VA 5AD0B 1C08B 3RU8H 2DLIA 4XC1H 3PV6B 1AGEA 4HIEB 1UT9A 4HXBH 5L2KA 1U92A 3OG6B 1XGRB 4NO5A 3L5JA 1II4E 2HKHL 3EYUH 4G7YH 3MRRB 1L7TH 5IK3B 3U46B 3MLVH 4I4WA 1NAMH 2NLJA 1EBAA 2BRQA 5C0IA 2JCCA 3QDHA 5F3BB 1R5VA 4X99B 3BMVA 2E7LA 5ELIA 1I1CA 1SYVB 4JRYB 3IRPX 4OTXH 1MELA 5EO9B 1JHLL 3N1PC 3IDYC 5HDBF 2YUXA 4MD0B 4XPBL 3DSNA 1AQKH 4MQSB 3AM8C 4OQTA 3RDTB 5SWZB 4L4VD 3QUYD 2HWZH 3MBXH 3BUYB 4GLRH 1ORQB 4ODWA 1S7UA 1S9YA 3D87B 4L8CA 4UB0L 4Q74A 3GFUA 1WBXA 5C0RH 4FQ2L 3BQUC 1MQKL 3B9KB 4XNQB 3WKMH 1U8LB 3DMMC 3BYYA 1NGQL 3BD3A 3MRDB 4RCAA 3FB6B 4NQDD 2QADB 3QIWC 4JE4B 3B9DA 3CX2A 1FBIL 3TO4C 2GTZA 5K9OB 1IBGH 4G5ZH 4POZD 3SKNA 2H9GA 4KK6D 3BD5A 4OFPA 1JZ4A 1D5MB 1KB5A 2E9JA 4YXLL 4XH2B 1OTTC 4KGJA 4BH7A 3CZFB 2HVJA 4APQD 4LEOB 4GW5A 4OZ4A 4Y4FA 1A4JB 4FA8A 3T0AA 2D7TL 2OTUA 4OCSH 3CXHK 5IMKB 1CGXA 2UZYB 3AXLB 1PKOA 3SGJC 4JRXD 4PUBL 5D96C 4QTHB 1NBYA 4IEFB 2CGRH 3NAAH 4ZOBA 5C0CB 3SDAD 1U41A 1HQ4A 5DMGD 3B43A 3RJQB 5EOTA 5C6WH 5DYOA 5E99L 2BSTA 2VE6A 3MFFA 3QWRD 3B9EA 5F9WC 3RX7A 2VL4A 3TLRA 4JFQB 4FMKA 3TEUA 1JPSL 2H2SD 1D9KB 1KYOJ 4HC1L 3L3IA 5EWIH 1KB5L 1INDL 5ESVB 3A6OA 3DPBA 3MJ9A 4RIRB 3T1FB 4JFFB 3F12B 3VFGL 3HI6L 4IHOA 5TH2A 5FGRA 4RMWA 1OTSC 2PO6D 2Q8BL 3O6MH 1GAFH 3V6ZB 5CKAA 1QLEL 1QFPA 1QSED 3C6LD 4GJTB 5CS7A 5MI0B 2D4DA 1G7MA 4LLMB 3L1OL 1JGDA 3OKEA 5B39A 4HUVB 3L6FA 5EBLB 1XGUB 3EO9H 5MEND 4XWGL 1U8MA 5HYSA 3MUHL 4JM2D 1J11A 4K23L 4DN3L 5I1KL 3PNWA 4Q7DA 3TN0A 4RDQF 5KS9E 1MRFL 4PJXB 1CLZL 5C86A 1JHKL 1JGEB 3HUJA 3STLA 1MCOL 5IEHA 2R4SH 5GHWL 4M7LL 1PG7L 2GITA 1FZMA 1MPAL 1SMAA 2HT2C 4NZTL 1T1WA 2D7NA 5IQ9B 3GJFB 4L1HA 4PD4K 3RNQB 3MV7E 4NNYA 2RFXB 3JUYA 4OAWB 3DO3A 1CT8B 2COQA 3F7YA 3G6JA 5EH1A 3O11B 1SJXA 3LDBC 1JE6A 2VNCA 35C8L 3GSXA 3AU1A 2H6PB 4WHTB 1SJEB 3ET9F 3CXDH 5E1HB 5DJ2A 5FYLL 3QAZB 4AQ1B 2ADIA 3JWDL 4Y19D 4Y1AB 3VE0B 1B0WA 2QHRL 5BO1L 3VDCA 1NAKH 5GRZA 4XCFH 1YYLL 3CPLA 3L5XH 4K94H 2YRZA 1TZIB 1YY8B 2JELH 4U1IB 1UA6L 3GIZH 2WW8A 2IF7A 2P5EA 2DM2A 3ME0A 4FQLH 4X80L 4OB5L 3OB8A 5SWZE 3BH8A 4YHYC 3JVGC 2R4RL 2BJMH 2OL3H 3SEPA 1DE4B 4NHCH 5D93C 1A6TA 4KRLB 3R06A 1C1EH 1VFBA 4HLZH 4GRMB 4U6YA 4MB5A 2ICWJ 4Y5XB 3WNNA 3ELAT 4C59B 5L2JB 2A9NH 1RZJC 2NY2B 2VZUA 2K9UA 4NFBA 2CD0A 1BEYL 3VWKD 4D2NA 5CZKA 3WNOA 4D0DB 5EDXA 3MRKA 4LCIL 4U1GB 1KJVB 3SBWC 1T66C 5ID0A 1DL7L 3QXVA 2CDEB 5E8DH 3BRFA 4GRWE 3W9DA 1ZA3A 1K8DB 1LILA 1RZFL 3HAEH 4F57H 2ADJB 2O5YH 1N5YH 2BVTA 4NBZB 4UQ2A 2N4IA 4UV4L 5GS2D 3NFNA 4LSSH 3G5YB 2C3WA 2YBRB 2P8LB 4LKXB 4UUJB 1T3FB 1XGQB 3B2VL 5E03A 3ES6B 3IDXL 1D5IL 5M94B 1YQVL 5T1MB 3U7YH 5JXED 3NFSL 4U31A 4OCWL 5EUKB 2AK1H 1WC7A 4MJID 3TZVC 1P53A 4CDGC 1K3ZA 1MRDH 2BY3A 3H3PH 4R7DB 3INUL 1WZ1H 3I50H 3IGAB 4R6UA 4YXHH 1AGCB 2EDFA 3NN8B 3W11D 3MUZ1 1F4XL 4XP9L 4W6WB 1I8KA 4MQTB 2VC2L 4PY7B 3IJHB 4R0LB 1ZE3C 4RFOH 4U6XA 2NY2C 1I1FB 5HHNB 1RIHL 3BESR 4MQ7B 2P46B 3HCVB 3OKDA 4PYGA 2VDLH 1T0MB 2A83A 2Q76A 2D7TH 4OCSL 3ARQA 1GZQB 2VQ1A 5E56A 3LQAL 1CXHA 5IHUL 4MA3A 1KV3A 5L7XH 2VLMD 1XF2A 1GOGA 1OAKL 1C12B 1WFNA 3RTQB 4WW1A 2DI9A 4TTDD 4HZAA 2DM3A 1F11A 3ZDZF 5I17A 3V8CA 4IMKC 2DYPD 4ZFGL 3OV6A 3X11B 2JLLA 4D3CL 4CNIA 3RGHA 4GKNB 2EEBA 1FAKT 3RWEB 3MRLA 2NXYD 4UT6H 1G0XA 3RU8L 4OKVA 4JM2F 2APFA 1TENA 1V7ML 2PW1B 2X4PA 1ZLUK 2WQ8A 5FXCH 3WV0A 4NT6B 3MRIA 3QHTC 2VDPL 4PJGA 4XI5C 3L95B 4JANA 3VI4E 4G43A 4XCYA 2ZUSA 1UWXK 4E41D 1IILE 2YC1B 4N5ED 2DJSA 4NN7C 1BOYA 5DJXA 3W81A 2GY7B 2F53A 2X89A 4KMTH 3HNVH 1RJLA 3PQYE 4GLRI 4JJHA 1RZ7L 3HAEB 3BPCA 5I1HH 1ZLVH 1FP5A 1BZ7B 1YNTB 3UO1H 2WSKA 3WJJC 4N8VG 2IAMB 3KHOA 2BSED 4GH7B 2FDBP 1OLLA 1QQDA 3TCLA 2J6EA 4BSWB 4LCWE 4DUXA 3NPSC 4JQXC 1EXUB 3FQRA 3L3OA 4E0RB 4WFHD 3HZMB 1QYGL 2B5IB 2G5BB 3FB8A 2VXVH 4XH2A 4YC2C 2BSSA 2FZ3B 4G9DB 3NFPB 2HTLC 4U1GC 2X1QA 3N50A 1DLFL 3IXAA 1CICB 4WHYG 1UCTA 4MVBC 4ZFZA 4PRPB 3GRWH 4CW1B 1JK8B 2R1WB 1OAUH 1KIPB 5JOPE 3RGVB 4JRYD 1FGVL 2C26A 5KSUA 2Z35B 3UJJL 5IFHH 2W9EH 4LHQB 1S5HB 4RRPA 3OJDA 5B8CB 1R5WA 1YMMA 3BOVA 2IALA 1WQVT 2EXWD 3U30C 3LN5B 4KZEH 4ODUA 2YKLL 5CEZL 1ED3A 1W8NA 3DJ9A 2VLJE 1A47A 5DT1L 3HC0B 5FGBA 5I16A 1BFTA 3F12A 4J1UB 1N5AA 3JV4B 5JTWA 5F7MC 1UFUA 5ACZB 2VMFA 3HR5B 4JHWL 1CTNA 1XGYH 1D3CA 3GGWA 3QP3A 3VRJA 3VRIB 5IHZA 5JNYB 2VWEC 4HX1B 12E8L 1FGNL 3FO1A 3H3KA 3G6JF 1YEJH 3KYNB 4YEEA 5DHVB 3PHQA 5ETUB 3UZQA 3REVB 5HYSB 5EUOF 1IGFL 4RAVA 1JWUA 4HIXL 4NKMA 1MH5A 4P5TB 4AH2B 1A4JA 4KMTL 3ZL4L 1HSAB 3T2NL 2CKBB 3DX8A 3L1OH 5ADOL 3HS0B 2JKXA 2A0LC 3ARBD 3QO1B 2WLZA 5KS9A 2XN9B 3H9SA 2GSIA 1IC1A 3KPSE 5ICXB 5J57B 4NQEA 5EZOH 4C58B 3DYMA 2ERJB 4APQB 4DAGH 2O5ZL 4ONHA 5D7JB 3RL2B 4N8VB 3BRGC 2X4OA 2H6PA 4WHTA 4DQOH 3MJ8B 4EI5B 1F90L 1HILA 5BZDA 1NBVL 3SE3A 2C3VB 4DKEL 1URLA 4NQDB 1TMCB 4X5XB 3AS1A 2AI0L 2VKXA 2OR8A 3L9RA 3MV7B 2QTEA 5D1ZA 4K71C 1JMXA 4O5LL 1DP0A 3IU3A 4YK4B 3ARGB 2H3NA 3LQAH 3BKYH 2H45A 4OUUB 5D2NC 2AXGB 4JO3H 2OR7A 3KYMB 2DWDB 5HI4D 2IH1A 3KXFB 5F7NC 4ETYA 1VFBB 2Q3ZA 2GSGA 4PJ5A 4F8TA 5FUZH 1A4KA 3WEXB 1UA6H 2EC9T 1IAIH 4X7EC 1NBZB 2VJXA 3OBAA 2P5ED 3BPOB 3HPLA 4YUEL 4M43H 3TC9A 3N1FC 4O2FA 1MHEB 4ELMB 5I1LB 3FO9B 5C0AD 4G80B 3DV6B 5GRYA 4NUJA 5CGTA 3O6KL 1EVUA 1BBDH 4ZXBB 3HB3C 4YR6B 1ITBB 1UM4H 3H9YA 4L9LA 4I0PD 4TSAL 4WEMB 4WHCA 4AL8H 4N90D 1G7HA 2ICCA 3MLXH 2MMXA 5E8DL 5IKCB 4AM0B 3RGVC 4LKXA 1NQBA 5FKPB 1L9NA 4ZTPH 3MLZL 4LVOB 1F00I 3WSQH 1RMFL 1QBBA 4YFEA 2F19H 4JRXE 4EVNB 4LNRA 5DMGC 3EJYD 1IGIL 5CINL 4M48L 2MCG1 3U46A 1X5IA 4KHXH 1M05A 3QQNA 5IMOA 5F3BA 4YHLH 5TE4L 3JSSA 5FHAL 2BDNH 5MENB 4JB9H 2H8PB 4P9ML 1OSZA 1S7RA 3QCUH 4EN3D 2P43B 3C08L 4FABL 4NC1E 4XPAL 1IZJA 4B0MM 1CXKA 3GMNB 1BQLH 4JZJB 4XNMA 1A7NL 1FVEA 3MNVB 3OXRA 1OAUL 1DQDL 2DRUA 3OX8B 4OZHF 2Z93A 5FDWB 1UJTA 1NCDH 5DJCA 1HCFX 3LV3A 3RWFB 3GSRB 2ENYA 4JG0H 2JK5B 4NJAH 1DBJL 1U95A 4L4TE 1PVHA 2Y7QB 1RHHB 5IP4A 1U8OB 3S3JA 3T77B 3JWDH 4XCCH 3ZE2F 5DVNA 5L8JB 3DGGA 1DSFH 3BP4A 1IEAA 1T5WA 3WIIH 2HFEB 3VGDA 4HFUH 1GZPA 1U8IB 5EBWB 2HRPL 4PLNC 4KRNA 4QGTA 3ZYIA 4ODSH 2IFGA 4NRXB 2NX5E 3L95A 1K6QL 4L8BA 4YDVA 1QBLL 2KZ1B 5HD8C 3G6DH 1DVFA 4G8EB 1NEZG 5E2TL 4NCC2 3SE4C 4XCNA 4N9GA 5F89A 1D5ZB 2XWBB 5J11C 2F5BH 5HXMA 1FJ1A 3OKNB 2CKNA 1VFMA 2NNAB 3EYSH 3NGBB 5C0CA 4QTIH 2W9DH 4IDLA 4U2ZA 5D72H 5LBSL 4GUPA 4TUJA 3KWWA 3OMZA 4FS0A 2V2TA 1OB1B 4H1LG 1EHLL 2JJSC 3BKMH 3S34L 4TRPL 1LEIA 2J88H 2F53E 2FGWH 4KHXL 1NKOA 2VIRA 3HI1A 1XZ0A 3RTQD 4HIJB 1NANH 2IQ9H 3GM0A 6FABL 1ZSDA 1DSFL 4JPKH 3ARYA 2B0SH 5HHXL 1FO0H 4YZFE 4XX1G 4KI5C 3QSKB 3PIQA 4G6JH 3HRPA 4Y4HB 4HGKC 4UOJA 5FAAA 3U4BH 3WXVH 4PLJC 3TO4D 1RV6X 5IGXH 4M5YL 3SGJA 5I2IB 2B8OT 1TZHB 4NZTH 3WNKA 3FFCD 3THML 4D94A 1G6RH 2AK4D 5JW3L 2WP3O 5A2IH 2NPLX 2VZ3A 2Q20A 4Q6IB 5F93C 1XF4B 5DC9B 1PX4A 1WITA 3D39D 2FB4L 1G7PB 2FGWL 4PREA 3UJJH 5DJ6A 4KJPD 2GJ6B 2BNQB 1KPRB 2J3SA 5T1DL 1CD0A 2IAMA 1CYGA 5GGQH 4HS6B 3D25A 3G6JE 4KDTC 3TO2B 1OARH 1A9BB 2VQUA 4TSBH 4JFFE 4XMLL 5KZCB 3MLRL 1IKFL 1H3VA 1RFDH 1KIQA 4KKCD 5F96L 1VESA 4PJIA 2NW2B 1YY8A 1HOCA 4QCIA 1GCFA 4H0IA 2E6QA 4KPHL 1J0IA 1XGYL 5TF1L 1K8IB 1PDKA 4RMTA 3GMRA 3U4BL 1YPZE 3WXVL 5F1OB 3QG6A 4GXUM 3UMTA 1KIPA 3SDXB 4XNYH 1RZIA 4YBHA 2VDQL 1Q9KA 1T04A 4PLOB 4ZMAT 1PZ5B 3CXHJ 4Y5XA 2FHBA 4MGXA 4Z78B 1FAIL 1HHJA 3KPQA 1MJ8H 2NY7L 3ULSB 3WE6B 4P2RA 1DBJH 3PXJA 4HWNA 3ABZA 2B1HL 4JO4L 2EDQA 4LHUB 1KGCD 1FFOB 2X4QA 4L9LC 1EFXD 1FC2D 1TJGL 2DDQH 1MEXL 4AEIL 2BJML 2OL3L 3VFRA 1J18A 4PJIE 5KTEL 2M26A 2XKSA 4U6TA 4Z76A 2WBJC 1OP3H 2CR3A 3UPCA 4DJMA 1VACA 2PUQT 1FYTA 3MOQA 1DVFC 2FX7L 2Q87A 4PGEA 5DC4B 4X8JB 2LVCA 2NYYC 4C54A 4MZ2A 1F6LL 3CVHH 1T20B 4U49A 3ZE0E 3QFJE 1RUAL 2KDGA 4KTDL 2APXA 2QQKH 3HZVB 4E5XB 1JL8A 1P84K 2JJUA 3L3DB 1G9ML 4WUKH 4PJEE 3HE6A 1U8NA 5IV2A 4LSQH 2P42B 4X6CF 3WS3A 4RAVB 2PCPA 1NBVH 4NKMB 4P2RE 4OCRL 4Z95L 2X9YA 2DWDA 4ZOCA 4J3SA 5T5NG 3HNTL 3K7UA 3TYFB 3UJTL 3HPJA 4LEXL 2VDML 1DN0B 4R7DA 5FYJL 4OM0L 2ESVD 4JQVC 2VERN 1I3GL 3SE8L 3D85A 3PWVB 3ZE1E 1FL5A 1R24A 5I30L 1WT5A 3IJHA 4R0LA 1FNSH 1QHOA 4NWUH 2V7NB 4OIAA 5F72S 2X9XA 5J1TC 3QFJA 1A1OA 1JGVH 1SBSL 2Y9RT 4XMKH 2NY5H 2KH2B 3C60A 2PR4L 5I0ZA 2GTWB 1BBDL 3TESA 1DZBA 1MLBA 5D7LA 3RY6C 3N9GL 3BIAX 3BKJL 5I1GL 1A7OL 5SX4I 1W72H 4LGPB 4Z7OE 5BRZD 5FA4B 1EJ6A 4DZ8B 1GAFL 1F11B 4Z7QF 4JDVB 4DTGL 3SGKA 1N8ZA 4D9QE 3PABA 1LO5A 2BC4B 2R1XB 1P7QB 4AZ8A 1RZJL 2IBZY 4HJGB 3GMOB 4TUKL 2HH0H 2YA0A 4YO0B 4XPGL 5DLMH 4HIXH 2ICES 2VKWA 1IGYB 4I13B 4OI8A 3H9HB 4JVPA 4QRTA 3ZSTA 4ONGH 1X5GA 4M3JA 5C9JB 3IS1X 5JIKA 5JXEC 4JRXB 2GT9A 3W82A 1EMTL 1NBZA 2AXJA 5JDSB 4PV8B 2AJYH 5GGVL 4X6DE 1CT8A 3G6JB 1HKLH 4KQ3L 2N1KA 1ZT4B 5DDHB 1QBAA 5KW9H 1KT2B 3CK0L 2BVUA 2DWEA 3V8OA 2KZWA 2VN7A 5HHOE 3ULVH 5EOCH 4ZUUB 4NHCL 1JI1A 4PV9B 3MJ7B 4NQXB 1MJUH 2VDPH 1B4RA 4K3GA 2JJTA 1DQDH 1JWSB 1ZTXL 1JGLL 3WJJA 1QZ1A 3AGVA 2ZZUT 3RA7L 1C7TA 4H8WH 3DI3B 1BFVL 1JNLH 4Z0BH 2R0LH 3WS6A 4U1IA 3D5OF 3I2CL 2GK2A 2FWOA 4XVUD 3KYOB 3MJ9L 4RX4D 3E0GA 4K71B 3ZDXF 2AKRB 5I18H 4E0RA 3VG9B 1IQDB 3ARXA 1FGVH 1EEZB 3SGEH 4H88L 2I27N 4MD5A 1K4CA 1MJ7L 3L5WB 3FFCB 1ONQB 3HHRB 2IPTH 5CEZD 1PLGH 3X3FL 4NC2B 3NZHH 2NX5D 2NY1D 1IEBA 5EZLB 2XV6B 2GUOB 5F96H 4LU5H 5I74C 1YEKH 3QUYC 1T1XB 4IRSA 2NX5A 4BUGA 5EBMA 3MGTA 3P2TA 3UPRA 2BOBB 4OZIF 1WWWX 4CN1A 1EA9C 3BSZL 5MI0C 1G1YA 4R2GC 1VGEL 1S7VB 4OZHE 2BCKA 1KJMB 4UIKH 4O2EA 4XP5L 1H15A 4ZSOA 2YRPA 3FT3A 3RZCB 3CVHA 5J1AB 4RX4A 4V2BA 1IQWH 4ZOEA 2OP4L 3HRZA 3ZKSD 1R3HB 3NBNA 3GNML 4DGVH 1GGIL 3DGGB 3VFMA 1C08A 2CXGA 2RJMA 5F7YC 2XNAA 3D39A 3OF6D 1RUKH 1E4WH 2D31B 3VG9C 1YY9D 3T2NH 3O2WH 2VLRB 4ELMF 3SE8H 5IFAH 3DRTB 5AYUL 4YHNB 5GGRY 1NMBH 2DQHL 4YIQA 3B3IB 5L2KB 1AGFB 1NJ9B 1ZHKA 3ZKXB 2ZUUA 5IIEB 1CDUA 3KVQA 4R7NB 2W59A 2H41A 4MNHA 3FZUD 1IC7H 2FCBA 1QR4A 1JP5A 4MNQA 2F5AL 1AKJA 1EVTC 2ZUVA 3L7EA 4G6AD 1J1OH 2Y5EA 4MQ7A 4M7KH 4E41B 3VWKB 1W0YT 4BZ1H 5GGUB 4LPUA 3W39B 3ZLQC 4B7LA 5D7IA 1QO3B 5ICXA 5I8EA 4A6YA 2BVPB 4TOYL 4LEXH 4Y4HC 1KPRA 5CZVH 3D39E 5DD6A 1BAFH 3C6SB 1JTPA 3AREB 5IVZB 4N5UA 1ZHNB 2FYYB 4LFHG 5DHVH 3RI5F 1I9IH 4H88H 1XH3A 4L1DA 1H8SA 1ZT1B 1WZKA 5H94A 2J8OA 1OAYL 1S9YB 5IW1B 1FORH 3MROB 4PRPE 1NUDA 3SKNB 4X5XA 2IH3B 4M93B 2DM4A 4G8FA 4EBQH 5FKAA 4ZAKA 4JFXA 1U8LA 1J1PL 1U58B 2WLYA 1IGCH 2HVJB 3DROB 4GW5B 4WW2B 5GGQL 4NNPL 5K9QI 5CSZA 4BH8B 3FL7A 1ZV5A 4RWHA 4JQIL 5EWIL 3QFJD 3UYPA 4ODSL 1JYVA 1A64A 1ACYH 4M1DL 1Q9KB 1T04B 5DVLA 5F9JB 1Q72L 5BV7C 1HXYA 2D7OA 4JZNB 5I19L 3M07A 1T22A 2AV7B 2NXYB 1T03H 3FCTB 3PWLB 5E08L 1NUFA 1YUHA 5LVEA 3IVKA 1GGCL 4V2CB 3CDCA 3O2VH 1D9KC 5J8OA 5BZWA 4LPCA 4L29B 2Y5TB 3BKML 3SOBH 2IQAB 1UJ3B 2P5WE 1U36A 2C3GA 4PS4L 2FSEA 5CSBA 2O61B 3GUTA 1B4JL 1F3RB 1A6WH 3MACH 2IQ9L 3WFBH 5IV2B 2CRIA 4ERSH 4PJIB 3QYCA 4ZUTB 4NQCE 3ORJA 4L3EE 4JB9L 4H5SA 1WFTA 5E9DE 1SY6L 5EU3B 3BZFA 3HI6H 4CBPA 3HG1A 3OKEB 4HUVA 1XGUA 3O6FB 1I8LC 5DI8B 1FL5B 1R24B 2VLKA 3UYOD 5E00B 2LV4A 3SDYH 5CP3A 1DDHB 2YS4A 5BV7B 3CX5J 5GISL 4ZFFB 5SWSA 1PYWB 5JOEA 3K81A 5DHYB 4X6BA 1JMZA 2J4WL 4Y5YC 3WXWH 4KK8D 3LDBB 5IQ9A 3RY5A 2L7JA 2YA1A 3WIIL 1KLGA 4NWTH 3D9AH 3I75B 4EXKA 1HIMH 1T20A 3LHPL 3GSNA 3CD4A 5IVXB 1EIBA 2P5EB 5C0AA 1KFAH 1F58H 4KY1L 1MCRA 3L3DA 3TH2T 3VXRB 2EE9A 1P7QA 4QHLA 1GGTA 1AH1A 2AEQL 1RUPH 2ICWB 2G75A 4M3KB 2DD8L 4JFEA 5E94B 2BNRA 5D93B 2L7UA 4KUCF 3EOAA 4G6ML 4LVHB 5C9JA 1A7NH 5FHBH 4MAYB 1U42A 1N7MH 4M7LT 3H3BC 4OQTL 2P48B 5CZXD 4R4FH 2L4OA 2YMXH 3O4LE 5F89B 5LG1A 4WO4C 3PWVA 3W9EA 1WAAE 1IAMA 3K2MC 4F7TB 4O02L 5L88H 5DFVD 5EFIA 3MRKB 4H20L 1HXMA 3NCFB 2BY1A 4KTYA 1BF8A 3VD7A 4QNPF 4S1DD 1RK1A 3OJVC 4I2XE 3T0EC 3UC0H 5C2UB 5EU6E 5IHLB 2ADJA 3WL9A 4WY7H 1LNUA 1JPTH 4UQ2B 2UUDH 5DQ9A 4OGZA 3VXSE 3W5MA 3FRUA 3C6LB 4NP4H 4S1SH 3SDXF 3FONA 2IGFH 2HKHH 4M7LH 1HSBA 4JKPH 4NQED 4A2LA 5J7CC 3NFNB 4QT5B 4KTDH 2I60H 4QYOA 1QFWH 3FO2A 1V05A 4YXHL 3PHSA 1HYSC 4PR5B 3T0VA 5EC2A 5DQDH 5DFWH 4F7MB 1BLNA 3P9LB 3C8HA 2AEIT 3IFOB 1FL6A 3FQXA 4UT7H 3ZE2E 3DUSB 5FV2A 3HB3D 5HYFA 2A38A 4L4TD 3GSVB 2Y06L 5F21B 5I0DA 3IFNH 4OF0A 5IQ7H 3SDAC 4MHHI 1G0DA 1I9EA 3QEHA 4X8XA 5D1QC 2XZCH 3FQWA 1R5VB 3IGAA 4Q2ZA 1HIML 2J8UA 3TO4B 5LQBL 3MRGA 4FTVA 3HFML 1G7PA 2H2PD 4NP4L 4S1SL 5IKCA 2H2SC 3SPVB 4K3EL 3FOMB 2EEAA 2V2XA 3ULUF 4ZYKB 1U0QA 2WBWB 3MPCA 4EUPG 1HK6A 3F6LA 3T09A 4PRNA 3PWJA 4NQSB 4OLVL 5GGTL 4U0QB 4HJJL 3ARDD 5IUSA 2X10A 1F2QA 1SY6A 3C6LC 4IRJA 5TE7L 3RDTC 1JHTB 1PBYA 4OV5A 3UTTA 5BW7C 1IJ9A 5TDPB 3GNMH 4XAKE 2X4PB 5I75B 3AY4C 2BFVL 1CZ8L 3P73B 2F58H 2OL3B 3GKWL 4XCYB 4HKBA 4YEFA 1I8IA 4X6DF 3L7EB 1BZ9B 5C3TA 2CJUH 3P30L 4EN3A 3HR6A 3IDGA 2K3TA 3CNKA 4NT6A 1KCKA 1ADQA 3OXRB 4XVTL 4LCUB 3MLPA 4PJAB 5CJXC 1JN6B 1QO3A 1SVZA 4AG4L 1KN4H 3P4OA 1GHFL 4HS8L 3IT8D 3ARDB 5FA3B 5T1KA 3RKDD 1MCBA 1NCNA 4HGMA 3M8OL 4FFWD 5DK0A 3QXTA 5CZVL 4U1SA 4GS7C 3CVHB 3QUML 5J1AA 2BNQE 1KXTB 4RAUB 4P99A 1HHGA 4GRWB 5DQJA 1MY7A 3U0TA 1OL0A 4QLRA 1N6UA 3DBXA 2NZ9C 4QY8A 3ZYZA 2F53D 3C5JA 4M61A 2RR3A 4IHOB 5TH2B 2AJUH 1BOGA 2FJGA 1FG9C 4G8EA 2CJUL 3P30H 2J88L 2PCPB 3IETB 3MJ6A 3V4PL 5IIEA 3FB8B 2I5YL 2GQHA 1MSPA 3MC0A 1HHKB 1L7IL 4KKCC 3B8YA 1U8MB 3VFWA 5B4MD 1YC8A 3MLWL 1Q9WA 1JK8A 3TGXA 5ICYA 1QYGH 2ICEB 4K3JL 2W0LA 4NSKA 3MLUL 2I07A 4G6AC 5DUPL 4P3CL 4PJCB 3AM8A 3ZDYF 3A0OA 1G84A 4M5YH 4LNVA 4G9FE 2EEDA 3K0WA 1OGAD 2VDMH 3N1MC 2CK0L 2WM0A 2M2DA 1ZAGA 3O41B 3QDMA 5HY9B 2N7AA 1MCNA 1QSEB 4M48H 5IW1A 1AFVL 1CLOH 1R3JA 4J1UA 3MV7D 2PW2A 4Y4HA 1N64H 1E4KC 3O8XD 3QEUB 3KPTA 5I1IL 2MSPA 1A8JH 3WHXA 3PGDA 2JJTC 3PHQB 3VRLE 2ADFH 3I84A 4HUWA 5BOZG 2DLTA 5F6HJ 4HJGA 2Y07L 2P8MB 1JFQL 4AEHL 3BHBB 2FR4A 2LU3A 5BMFH 2CRZA 5FB8B 4JY5L 3SO3B 3KS0J 1P5VA 3CU7A 3MLUH 4MAYD 5LGHH 4I3SL 1HXYB 2OI9B 5FF6B 3NCJL 4U1JA 3H7BA 3BH8B 4AIZA 4K2UL 4C56E 4OGAD 3SKOB 5JXEA 3K8MA 4DUVA 4X9GA 3LB6C 5E95B 4H8WL 3E8UL 3S36H 4KDVA 4WIQA 3QO1A 1HEZA 4OCYL 5HPMA 3VXRD 1OM3H 4OI7A 4LOUD 4NQXA 5KANI 3QPXH 3MO1B 4FQJH 4D9RE 5HVWA 3R4DA 3L9RB 3MV7A 3U82B 2ITCA 1HOCB 4OM1L 3FT2A 1X5JA 4QCIB 5ENWA 4IDJH 1GIGH 4L4JA 1OY3B 4YDLB 3BGFC 3MJ8A 4EI5A 4KI1A 1G6RB 2DJUA 2QSTA 3BWAA 5TPWH 3MA7B 3DECA 4WTZG 6FABH 2AKRA 5HYQB 4JZJC 4YE4H 1U3ZA 1OWRM 1OGAA 2IH1B 4GG8A 5TFSL 4ZS7L 1DUZB 3INUH 1OAXL 4EZMA 1T7YA 5IBUG 4JFHD 1HDMB 1T4KA 4NO3B 2Q8AH 4DOHB 3TBYA 3TT3H 3LSOB 2QQKL 4U0RC 1IGTB 2AEQH 1JF5A 3I6LD 4LHUA 2OQJB 1HXMB 4CGTA 2E9IA 4HZLA 3WHE1 3BP5B 4YHMH 1MHPH 2Y4SA 3LQZA 2HT3C 3E6HB 4XP6L 1LNUB 1WAAA 3LEXA 3MUY1 5I8KH 1A6PA 1MEXH 3WUWA 3T0EE 1XR8B 4ZTOL 3V95A 3CJJA 3HCVA 5CP3H 4MXVF 5KAQG 2BNUB 3QJHB 5F9OH 4NWUL 4NRZB 1KNOA 1S9XA 1PGRB 1UXWA 4XNZC 4J4PD 5C0AB 1M05B 4WI2A 1DN0A 5HVHB 3WDIA 3P9LA 3VGFA 2DIAA 1MFNA 1GPOH 3FQXB 4IOFD 5GS1B 3S35X 4OCRH 4Z95H 4P5KB 1A6ZB 4FG6D 3OGOE 4Y19E 3GSVA 3TN0D 4G3YH 3HI5H 1BEYH 1LK2A 5J4MA 2ZSWB 3BE1H 1TITA 4E41A 1KEGH 3QDJA 4JM4L 4FTVB 1LQSR 4OZIE 3ZDXE 3V0WL 1HNFA 4A6YB 5F9WB 3ZTNH 1HINH 5HHPA 2AQ2A 1FN4A 1FO0A 1DBBL 2NY5L 3PP4L 4Z7WB 3Q6FB 4IJ3C 1QNZL 4TN9A 2JJSA 1IGMH 2XI9A 3FAWA 1T1ZB 3V6OA 3K80A 2HFEA 3F8UB 4BZ1L 3QWRA 2IG2L 5DK2B 4RQQB 3FO2B 1UWXH 4DVRH 4P2OA 3ZE1F 1B2WH 2JTDA 3RFZC 1S9VB 1X5HA 4EUPA 1UQSB 5CSZB 2GJ6D 4JRXA 1CTOA 5A16A 3EZ8A 5GS0H 3RWHB 4M1GH 2MQ0A 1NGZA 3M1BA 4FTVD 1IC4H 3RIAK 2BSSB 3VW3L 3HE7D 1NGYB 4HKJB 5CJQH 3VGAC 1I9RH 5CILL 3QXAA 3VD5A 1XGPB 5I18L 3Q1SH 3VJ6B 3CU1A 3C5SB 3MRCB 3ULUE 3L3GB 3MRGB 2HTKD 4KJPC 4O2CB 2DN7A 4C83B 5E6ZA 2JCCE 1R3IL 4P57B 4PS4H 2FIKA 3IVKB 4M62H 1JYXA 3DARA 3AS3A 2R9HD 1KBGL 4O58H 1RUQL 3BMWA 5H8DA 5CBEA 1JF1A 3UXFA 1MCCA 3MBED 5LWYH 3QUYB 1LEIB 4ZS6C 3DBXB 4QY8B 3FO0H 1JZ5A 3BIKA 3BQUB 5KVFL 1UZ8B 3ZO0A 4MWFA 5C0IB 5D8JH 4MA8H 4LSTL 1KCSH 2EDHA 3MRJA 4PJDA 3GHBH 1BFOA 4OTXL 3S7GA 3U0WL 1IEBB 3BZFB 3B83A 2BERA 4HKBB 3MRPB 1LO4L 3KJ6H 1MF2H 5A2KH 1LK3H 1RZJH 1AC6A 3LOWA 3RP1A 4PLKC 1OD7A 3MQIA 4AH2A 5ALBL 5KG9A 1DUYA 4NYLA 5IMMA 3V52H 3UAJC 2P5WD 4L8CB 4X6FB 4YDIL 1OAZL 3LCYA 5I1GH 1LP9F 4Z7UE 3WKML 5FYLD 5DHYA 4KKAC 5I9QB 1YECH 4FZEH 1KBGH 1EO7A 1UEYA 3HNSL 4O58L 2ZCLH 2AERT 1AJ7H 4JGMA 2DQUH 4LLQB 3LKQB 1KYOK 1AD0B 4WFGE 1Z9OA 5A2FA 4YHML 5DVOA 3TJHD 4ETQA 4FQXB 5HHOB 3SE4A 1FSKC 4CMHB 3PWNB 5CILH 8FABA 1XCTA 1F3DJ 3C2AL 5GS0C 1RVFH 2OTUB 3CUPB 3QXDA 1CIDA 5ISZB 4F57L 2B39A 3QUXA 3U2SB 5B22A 2YRLA 2ZKHL 2UWEB 3PG2A 3HZYB 5FB8A 5SWSD 4DFIA 4LEOA 1W0WA 4PRBA 5F8QC 1OP5H 2XRAH 1X9QA 5ITFA 3MV01 3C8KA 1VGKB 3GJFH 4JPKL 4KRPD 1GSMA 1EGJH 2DLEA 3ZHLA 5KSAA 4OLZL 3G5XB 3Q5OA 3DURA 2X44D 1PQZB 4FQ1H 4Z7VB 1HQ4B 4LRIC 1ES0B 4JO1H 4CJ0A 3VFPB 4HMEA 1BFVH 1XEDA 3OR6B 3MRHB 3EYQC 1D5BA 1MQKH 2FATL 3GRWL 3PDOB 5DQ9B 1MWAB 4XPFH 4Y1AD 4TVPL 3KPLA 2LAAA 1QVOB 3IF1A 1MCDA 1YYLH 3L5XL 4GW1A 1G7HB 4UINL 4YHPA 2BK8A 2FH6A 3CLEL 4QXTA 2MQ3A 5FEBA 4TPRH 1OAKH 4KROB 4OZGB 5EG6C 4Y1AE 4F58H 1H3PH 4PJXA 4HUWB 1KEMH 2CUIA 3WFHA 3HZVA 2XZAH 3T08A 2EDWA 2SEBB 3T0BA 3V5HA 1LO3H 3TBYB 1R3KB 1IGTA 5C6TH 3TYFA 1INEH 2FX8L 4HFWB 1YA5A 5GIRB 1UACL 3KGRA 5F7EH 4NNYB 1LE5B 4I48B 5IB1A 4YGAB 1JPST 3OKLB 5LWYL 4P59H 2V5MA 3GSXB 3WLBA 1UJ3A 5ABDE 5IBLD 2YR3A 4MCYB 1OLZA 3O2DH 4I2XB 4CVXB 1IKNC 4YFLI 2QBWA 1DJSA 3QIBC 3DX6B 4X6EB 1QACA 2AV1A 5EOQH 4Q9RL 2ITCB 3FZUC 3C60B 5EO1B 1A3QA 1KC5H 4IRJB 3LV3B 5FDYA 3ZT6A 3MA7A 2VL5A 4RISH 4YX2H 1EFXB 3ARPA 1N0XH 2Z92A 3VH8G 4WFGD 4M8QB 1OCWH 4CDHA 3AROA 1INEL 2FX8H 4GG8B 3NCBB 1DUZA 3C5ZC 4MZ3A 1QFOA 1FZOB 3KPNB 3RBSA 4PJCF 1T7XA 1RK0A 2CXKA 5DRZB 4RGNE 2VLLA 1GPOL 3D1MC 1EPFA 5D1XC 4K3EH 4EOWL 3F58L 3U7AA 1CXEA 5F7KC 3S5LG 3PJSA 3QUKA 4GQ9L 1XF5A 4L3CB 4FZ8H 2VDOH 4PJAA 3VMPA 3W9DB 4MNQD 4YDJA 5DGQA 1V3LA 1ZHBA 3KNBA 2EH7L 2W60B 5EUOA 4D0CB 4HCRH 1HI6B 1RURL 2HFGH 2P8LA 4HPOL 2NNAA 2CLVA 1MUJB 3TBWB 1B0RB 4U3XA 5EC1A 1BGXH 3FTGA 3OAUH 3NPZB 2J6EH 2XTLA 1SEBB 1EUTA 1X4XA 3QJHA 2FLRT 4M9OA 2O5XH 1T3FA 4AY0A 4OGAC 1XGQA 5HJ3B 2VIRB 3BJ91 3S96A 2FWOB 2P5WA 1TQCC 1UQSA 3QBTB 5LGHL 5D2LB 2AABH 2BDNL 4NO0A 1S5IL 2CMRH 1V7NL 4P4KC 1OSPH 2ITDA 3V4UH 3SO3C 4GKSB 1AGCA 5DZLA 3EW3B 1H3TA 2FJFA 4WU7A 4ALAL 4PJDF 1QRKA 4PY8J 1QLRB 1A1NB 3S88L 2EC9U 2Z8RA 3RWCA 1H5BC 5KOMC 1WV7T 3GSNH 3KPOA 3FQUB 1KC5L 4Q97A 1I7TB 4I9WE 1M6OB 2NX5B 4W4OC 3P0YL 4PJAE 1HYSD 4ZSOB 4XHQA 3VXTA 4GQPH 3IDMA 3UTSA 3SGDI 5D5MB 2PKDA 4JPVH 3MBEA 3CFJA 1N59A 1KTDB 1R3HA 4KUCD 2XQYK 5JW5B 3QDMB 4X5LA 4Y4KA 4ZFOA 3GK8L 3RZCA 3DETC 4Y5XC 3QCTL 5D1QB 2DQIH 4XC1L 2Y72A 1S9VA 5HGBB 2HT3D 1I7ZB 3QO0B 4PRHE 3CFBB 2XTJC 1I1AD 2NZ9D 4OKVB 5I73C 3QUXC 3CDYA 4OF7A 1ZANH 3QQ4B 1DQTA 3B3IA 3HE7B 1WBYA 4TOYH 2FH8A 1A3LL 1KCSL 3PWUB 1T89A 2VDKL 5E2VH 3WSQL 5IB4B 3GBLA 2ERJC 4N0FA 4P23B 1NC4A 4HKZB 4KXZH 4PBWD 1XH3B 3DX7A 4JKKA 4HK0B 4JQIH 4MQXD 4PJCE 4FG6C 4HWZA 4BQ8A 5A2JH 1H5BA 1S78C 4ZAKB 1YDPA 2JJVA 3K8LA 4PJ9A 4UV7H 5DD0H 3T1FA 3QFDB 1OAZH 2ZUWA 5FOBB 3KG5A 2W0KA 3V79C 2X4SB 4UNUA 4YGVA 5KVDL 1CK0H 1I8IB 5HYQA 3MRJB 4FP8H 5KSUB 2EICA 1WAAF 4NCC1 3ZL4H 5IJVA 2HLFD 4LLWA 4ZNEE 1S7XA 3OG4B 3V9FA 3LRGA 3EO0A 3IXAB 3ZTJH 2QSQA 3C60C 1I9JH 4RWYL 5CBAA 1I1AB 4LCYA 4NQEE 3OB0K 4U2YA 4XC3L 3UEZA 3GI9L 1UH4A 2UVEA 4ZQKB 4JM2C 3WN5A 1CD8A 3VXPA 3VFOA 5E8OA 4JHWH 4MJIB 3G9VA 3TZVA 5E2WL 2MPAL 1KJ2H 2WBJA 3HC0A 4PRHD 3IJSB 4DCQA 2O5ZH 2CQVA 2CMRL 3TYGL 5KSBE 1T2JA 3EUUA 4KK5D 1UXSB 1KNOB 3V5KA 3SCMC 2I25N 2IMMA 2AK4E 4QXTB 5KVDH 3U6RB 1MAML 3EYSL 5DR5L 2O61A 5DFTA 4QRPD 5GJSL 5FECA 1CXLA 1MCWM 1HHKA 3QWQB 3QUXB 3U2SA 5IT2L 3LPWA 3UTTE 2AP2A 3SDDB 4N8CL 1UGNA 1BQHB 4NKDA 1A7QH 4BFEA 3MBEC 2W92A 3H9SB 3P0YH 3KXFD 3MLYL 1TVBA 3O81A 1J9CT 5E8EA 5INDB 4RMVA 3QI9B 5ALBH 2X41A 4JRYE 3OKLA 2EE6A 4RMRA 1F3JA 3GMQB 5A3IC 4R2GD 5GGRB 4PV8A 2PXYD 1RJZB 3MLXL 5IEKB 5SWSB 2OSLB 5C0NC 4JFYB 3I75A 5DO2D 4LAQH 4DWHA 4LKCA 1WT5C 1EAJA 4HBCL 4AIOA 3K2UH 4PRHB 3LKOB 4GG6F 1TIUA 3RKPA 2YOCA 4R4ND 3VXRA 4BFGA 3VXNB 4LRNL 4R3SA 2OBGA 1J12A 4KJWC 5DR5H 1YPZF 3TIDB 4KXZI 3GSNB 4R4FL 2G2RB 2R8SH 3EOAB 3JVGA 3D2UA 3MLTB 1BJMA 3BW9B 5I66B 5H37G 3IU3B 4YK4C 1CG9A 2NY3B 3HKFA 1PY4A 3FHQA 3OXSB 3O3EA 4F7TA 3CH1B 3VGEA 3MZTA 5JUEL 3JV6A 4F37K 3PJSB 3QUKB 4K7PL 5ISZD 3DV6A 1LD9B 1T0PB 4Y19B 3T0EB 5MP6H 4PPTA 4JKPL 4MD4B 3TBTB 3NABH 3IDYB 2HJFB 4KJYA 3C87A 5JHDB 2KL6A 3LKSA 1ZT7A 1U2CA 3DVIA 3F58H 5C0EB 1KB5H 2FIKB 5CGYD 3ZKMC 3FHAA 2HAZA 3EYOB 4OD1H 1N3NB 4LF3A 5T5FH 3A6BL 3OPZL 5D7IF 2R1YA 2DB8A 3E6FB 1LDPH 5E4EC 4WI8A 1RVFL 5E8PB 1UB6A 3ARSA 1A14H 1UEMA 2UVFA 1KG0A 1RULH 3EOTL 4D9LL 4XGZB 4BFIA 2CLRB 3MRBB 3QUMB 4G9FB 2O5XL