4FAKA

Crystal structure of orfx in complex with s-adenosylmethionine
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
Knots found
sequence length
163
structure length
163
Chain Sequence
AAEFMKITILAVGKLKEKYWKQAIAEYEKRLGPYTKIDIIEVPDEKAPENMSDKEIEQVKEKEGQRILAKIKPQSTVITLEIQGKMLSSEGLAQELNQRMTQGQSDFVFVIGGSNGLHKDVLQRSNYALSFSKMTFPHQMMRVVLIEQVYRAFKIMRGEAYHK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Characterization of the Staphylococcus aureus rRNA Methyltransferase Encoded by orfX, the Gene Containing the Staphylococcal Chromosome Cassette mec (SCCmec) Insertion Site.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Transferase, ribosomal protein
molecule keywords Ribosomal RNA large subunit methyltransferase H
total genus 53
structure length 163
sequence length 163
other databases KnotProt 2.0: K +31
ec nomenclature ec 2.1.1.177: 23S rRNA (pseudouridine(1915)-N(3))-methyltransferase.
pdb deposition date 2012-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02590 SPOUT_MTase Predicted SPOUT methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1280.10 Alpha Beta 3-Layer(aba) Sandwich Alpha/beta knot Alpha/beta knot 4fakA00
2I6DA 4XBOA 4CNEA 3IEFA 1X7OA 2O3AA 3N4JA 4YPZA 3OIJA 1VH0A 3ILKA 5D9FA 1O6DA 4YQ0A 2EGWA 5FAIA 2V3JA 4YQLA 4L69A 4YQRA 4PZKA 4YPWA 2HA8A 5CO4A 4YQKA 4YQNA 4YQSA 4YQ4A 4YQQA 4YQBA 2QWVA 2EGVA 1NS5A 1TO0A 3NK6A 4CNDA 3AI9X 4YQ7A 4H3ZA 3BBEA 1V6ZA 4YVGA 4E8BA 1MXIA 3KTYA 4MCBA 1X7PA 1UALA 4YPYA 4YQPA 3E5YA 4YVJA 4RG1A 3O7BA 4YVKA 5GM8A 3KNUA 3N4KA 4MCCA 4CNFA 2YY8A 4H3YA 3KY7A 1VHYA 1V2XA 2CX8A 4JALA 4YQIA 1Z85A 1ZJRA 3AIAA 4YPXA 3NK7A 4FAKA 2V3KA 1IPAA 5GMBA 4MCDA 4YQ6A 1NXZA 4JAKA 3GYQA 1UAKA 1OY5A 4YQ5A 4YVIA 3DCMX 1UAMA 4YQ3A 4YQ1A 2Z0YA 3KW2A 4YQ2A 4IG6A 4X3LA 2QMMA 3OINA 1UAJA 3L8UA 3BBDA 5GMCA 3BBHA 4YQOA 1GZ0A 1J85A 1VHKA 3OIIA 4YQJA 4CNGA 3ONPA 4YQGA 4X3MA 4YQ8A 3IC6A 4YQAA 4YQCA 4J3CA 4YQDA 1K3RA 3QUVA 4YQTA 4YVHA 4YQ9A 1P9PA 4KDZA 3AXZA 4KGNA
chains in the Genus database with same CATH superfamily
2I6DA 4XBOA 4CNEA 3IEFA 1X7OA 2O3AA 3N4JA 4YPZA 3OIJA 1VH0A 3ILKA 5D9FA 1O6DA 4YQ0A 2EGWA 5FAIA 2V3JA 4YQLA 4L69A 4YQRA 4PZKA 4YPWA 2HA8A 5CO4A 4YQKA 4YQNA 4YQSA 4YQ4A 4YQQA 4YQBA 2QWVA 2EGVA 1NS5A 1TO0A 3NK6A 4FMWA 4CNDA 3AI9X 4YQ7A 4H3ZA 3BBEA 1V6ZA 4YVGA 4E8BA 1MXIA 3KTYA 4MCBA 1X7PA 1UALA 4YPYA 4YQPA 3E5YA 4YVJA 4RG1A 3O7BA 4YVKA 5GM8A 3KNUA 3N4KA 4MCCA 4CNFA 2YY8A 4H3YA 3KY7A 1VHYA 1V2XA 2CX8A 4JALA 4YQIA 1Z85A 1ZJRA 3AIAA 4YPXA 3NK7A 4FAKA 2V3KA 1IPAA 5GMBA 4MCDA 4YQ6A 1NXZA 4JAKA 3GYQA 1UAKA 1OY5A 4YQ5A 4YVIA 3DCMX 1UAMA 4YQ3A 4YQ1A 2Z0YA 3KW2A 4YQ2A 4IG6A 4X3LA 2QMMA 3OINA 1UAJA 4JWGA 3L8UA 4JWHA 3BBDA 5GMCA 3BBHA 4YQOA 1GZ0A 1J85A 1VHKA 3OIIA 4YQJA 4CNGA 3ONPA 4YQGA 4X3MA 4YQ8A 3IC6A 4JWJA 4YQAA 4YQCA 4J3CA 4YQDA 1K3RA 3QUVA 4YQTA 4YVHA 4YQ9A 1P9PA 4JWFA 4KDZA 3AXZA 4KGNA
chains in the Genus database with same CATH topology
2I6DA 4XBOA 4CNEA 3IEFA 1X7OA 2O3AA 3N4JA 4YPZA 3OIJA 1VH0A 3ILKA 5D9FA 1O6DA 4YQ0A 2EGWA 5FAIA 2V3JA 4YQLA 4L69A 4YQRA 4PZKA 4YPWA 2HA8A 5CO4A 4YQKA 4YQNA 4YQSA 4YQ4A 4YQQA 4YQBA 2QWVA 2EGVA 1NS5A 1TO0A 3NK6A 4FMWA 4CNDA 3AI9X 4YQ7A 4H3ZA 3BBEA 1V6ZA 4YVGA 4E8BA 1MXIA 3KTYA 4MCBA 1X7PA 1UALA 4YPYA 4YQPA 3E5YA 4YVJA 4RG1A 3O7BA 4YVKA 5GM8A 3KNUA 3N4KA 4MCCA 4CNFA 2YY8A 4H3YA 3KY7A 1VHYA 1V2XA 2CX8A 4JALA 4YQIA 1Z85A 1ZJRA 3AIAA 4YPXA 3NK7A 4FAKA 2V3KA 1IPAA 5GMBA 4MCDA 4YQ6A 1NXZA 4JAKA 3GYQA 1UAKA 1OY5A 4YQ5A 4YVIA 3DCMX 1UAMA 4YQ3A 4YQ1A 2Z0YA 3KW2A 4YQ2A 4IG6A 4X3LA 2QMMA 3OINA 1UAJA 4JWGA 3L8UA 4JWHA 3BBDA 5GMCA 3BBHA 4YQOA 1GZ0A 1J85A 1VHKA 3OIIA 4YQJA 4CNGA 3ONPA 4YQGA 4X3MA 4YQ8A 3IC6A 4JWJA 4YQAA 4YQCA 4J3CA 4YQDA 1K3RA 3QUVA 4YQTA 4YVHA 4YQ9A 1P9PA 4JWFA 4KDZA 3AXZA 4KGNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2I6D A;  4XBO A;  4CNE A;  3IEF A;  1X7O A;  2O3A A;  3N4J A;  4YPZ A;  3OIJ A;  1VH0 A;  3ILK A;  5D9F A;  1O6D A;  4YQ0 A;  2EGW A;  5FAI A;  2V3J A;  4YQL A;  4L69 A;  4YQR A;  4PZK A;  4YPW A;  2HA8 A;  5CO4 A;  4YQK A;  4YQN A;  4YQS A;  4YQ4 A;  4YQQ A;  4YQB A;  2QWV A;  2EGV A;  1NS5 A;  1TO0 A;  3NK6 A;  4CND A;  3AI9 X;  4YQ7 A;  4H3Z A;  3BBE A;  1V6Z A;  4YVG A;  4E8B A;  1MXI A;  3KTY A;  4MCB A;  1X7P A;  1UAL A;  4YPY A;  4YQP A;  3E5Y A;  4YVJ A;  4RG1 A;  3O7B A;  4YVK A;  5GM8 A;  3KNU A;  3N4K A;  4MCC A;  4CNF A;  2YY8 A;  4H3Y A;  3KY7 A;  1VHY A;  1V2X A;  2CX8 A;  4JAL A;  4YQI A;  1Z85 A;  1ZJR A;  3AIA A;  4YPX A;  3NK7 A;  4FAK A;  2V3K A;  1IPA A;  5GMB A;  4MCD A;  4YQ6 A;  1NXZ A;  4JAK A;  3GYQ A;  1UAK A;  1OY5 A;  4YQ5 A;  4YVI A;  3DCM X;  1UAM A;  4YQ3 A;  4YQ1 A;  2Z0Y A;  3KW2 A;  4YQ2 A;  4IG6 A;  4X3L A;  2QMM A;  3OIN A;  1UAJ A;  3L8U A;  3BBD A;  5GMC A;  3BBH A;  4YQO A;  1GZ0 A;  1J85 A;  1VHK A;  3OII A;  4YQJ A;  4CNG A;  3ONP A;  4YQG A;  4X3M A;  4YQ8 A;  3IC6 A;  4YQA A;  4YQC A;  4J3C A;  4YQD A;  1K3R A;  3QUV A;  4YQT A;  4YVH A;  4YQ9 A;  1P9P A;  4KDZ A;  3AXZ A;  4KGN A; 
#chains in the Genus database with same CATH topology
 2I6D A;  4XBO A;  4CNE A;  3IEF A;  1X7O A;  2O3A A;  3N4J A;  4YPZ A;  3OIJ A;  1VH0 A;  3ILK A;  5D9F A;  1O6D A;  4YQ0 A;  2EGW A;  5FAI A;  2V3J A;  4YQL A;  4L69 A;  4YQR A;  4PZK A;  4YPW A;  2HA8 A;  5CO4 A;  4YQK A;  4YQN A;  4YQS A;  4YQ4 A;  4YQQ A;  4YQB A;  2QWV A;  2EGV A;  1NS5 A;  1TO0 A;  3NK6 A;  4FMW A;  4CND A;  3AI9 X;  4YQ7 A;  4H3Z A;  3BBE A;  1V6Z A;  4YVG A;  4E8B A;  1MXI A;  3KTY A;  4MCB A;  1X7P A;  1UAL A;  4YPY A;  4YQP A;  3E5Y A;  4YVJ A;  4RG1 A;  3O7B A;  4YVK A;  5GM8 A;  3KNU A;  3N4K A;  4MCC A;  4CNF A;  2YY8 A;  4H3Y A;  3KY7 A;  1VHY A;  1V2X A;  2CX8 A;  4JAL A;  4YQI A;  1Z85 A;  1ZJR A;  3AIA A;  4YPX A;  3NK7 A;  4FAK A;  2V3K A;  1IPA A;  5GMB A;  4MCD A;  4YQ6 A;  1NXZ A;  4JAK A;  3GYQ A;  1UAK A;  1OY5 A;  4YQ5 A;  4YVI A;  3DCM X;  1UAM A;  4YQ3 A;  4YQ1 A;  2Z0Y A;  3KW2 A;  4YQ2 A;  4IG6 A;  4X3L A;  2QMM A;  3OIN A;  1UAJ A;  4JWG A;  3L8U A;  4JWH A;  3BBD A;  5GMC A;  3BBH A;  4YQO A;  1GZ0 A;  1J85 A;  1VHK A;  3OII A;  4YQJ A;  4CNG A;  3ONP A;  4YQG A;  4X3M A;  4YQ8 A;  3IC6 A;  4JWJ A;  4YQA A;  4YQC A;  4J3C A;  4YQD A;  1K3R A;  3QUV A;  4YQT A;  4YVH A;  4YQ9 A;  1P9P A;  4JWF A;  4KDZ A;  3AXZ A;  4KGN A; 
#chains in the Genus database with same CATH homology
 2I6D A;  4XBO A;  4CNE A;  3IEF A;  1X7O A;  2O3A A;  3N4J A;  4YPZ A;  3OIJ A;  1VH0 A;  3ILK A;  5D9F A;  1O6D A;  4YQ0 A;  2EGW A;  5FAI A;  2V3J A;  4YQL A;  4L69 A;  4YQR A;  4PZK A;  4YPW A;  2HA8 A;  5CO4 A;  4YQK A;  4YQN A;  4YQS A;  4YQ4 A;  4YQQ A;  4YQB A;  2QWV A;  2EGV A;  1NS5 A;  1TO0 A;  3NK6 A;  4FMW A;  4CND A;  3AI9 X;  4YQ7 A;  4H3Z A;  3BBE A;  1V6Z A;  4YVG A;  4E8B A;  1MXI A;  3KTY A;  4MCB A;  1X7P A;  1UAL A;  4YPY A;  4YQP A;  3E5Y A;  4YVJ A;  4RG1 A;  3O7B A;  4YVK A;  5GM8 A;  3KNU A;  3N4K A;  4MCC A;  4CNF A;  2YY8 A;  4H3Y A;  3KY7 A;  1VHY A;  1V2X A;  2CX8 A;  4JAL A;  4YQI A;  1Z85 A;  1ZJR A;  3AIA A;  4YPX A;  3NK7 A;  4FAK A;  2V3K A;  1IPA A;  5GMB A;  4MCD A;  4YQ6 A;  1NXZ A;  4JAK A;  3GYQ A;  1UAK A;  1OY5 A;  4YQ5 A;  4YVI A;  3DCM X;  1UAM A;  4YQ3 A;  4YQ1 A;  2Z0Y A;  3KW2 A;  4YQ2 A;  4IG6 A;  4X3L A;  2QMM A;  3OIN A;  1UAJ A;  4JWG A;  3L8U A;  4JWH A;  3BBD A;  5GMC A;  3BBH A;  4YQO A;  1GZ0 A;  1J85 A;  1VHK A;  3OII A;  4YQJ A;  4CNG A;  3ONP A;  4YQG A;  4X3M A;  4YQ8 A;  3IC6 A;  4JWJ A;  4YQA A;  4YQC A;  4J3C A;  4YQD A;  1K3R A;  3QUV A;  4YQT A;  4YVH A;  4YQ9 A;  1P9P A;  4JWF A;  4KDZ A;  3AXZ A;  4KGN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...