4FAOC

Specificity and structure of a high affinity activin-like 1 (alk1) signaling complex
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
75
structure length
75
Chain Sequence
PLVTCTCESPHCKGPTCRGAWCTVVLVREEGRHPQEHRGCGNLHRELCRGRPTEFVNHYCCDSHLCNHNVSLVLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Specificity and Structure of a High Affinity Activin Receptor-like Kinase 1 (ALK1) Signaling Complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/signaling protein
molecule keywords Growth/differentiation factor 2
total genus 12
structure length 75
sequence length 75
chains with identical sequence D, I, J, O, P, U, V, c, d, i, j
ec nomenclature ec 2.7.11.30: Receptor protein serine/threonine kinase.
pdb deposition date 2012-05-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 4faoC00
1RGJA 1KU6B 2QJ9C 1UG4A 1REWC 3U73U 1ERAA 2CRTA 2H5FA 1TXAA 1KL8A 1CXOA 1LXHA 2UX2A 1DRSA 1XT3A 1FF4A 1LXGA 1IK8A 1QKDA 3NDSA 2H64B 3EVSC 4P7UA 1CDQA 1NYUA 2H62C 1NYSA 2K3GA 2PJYC 1NEAA 1NTNA 3FEVA 4RUDA 1FASA 2MJ0A 1F94A 2MJ4A 1CDRA 3QB4B 3ERAA 1KBTA 1KFHA 3NH7A 2HLRA 2CTXA 1VB0A 4FAOC 5DZ5A 1IJCA 1FSCA 1LJZA 1TFSA 2J8BA 2BHIA 4LFTA 2HLQA 3HH7A 1F8UB 1IDIA 3BT1U 4EY8B 3NEQA 2N99A 1RL5A 1JBDA 4AEAA 2CDXA 5DO6A 1FRAA 2QC1A 1W6BA 1LSIA 2CRSA 1HC9A 1BXPA 1FFJA 1KS6A 1H0JA 1IDLA 1B41B 1IKCA 1KBAA 1G6MA 1S4YA 4OM5A 1NXBA 1QKEA 4OM4A 4BIKB 1YWHA 2X8BB 2JQPA 1JE9A 2H64C 1M9ZA 1KC4A 3LAQU 2MUPA 4FAOE 2H7ZA 6EBXA 1HOYA 1TGXA 1I02A 3KFDE 4QTIU 1LX5B 2LA1A 1FSSB 3KFDI 1CDTA 1HAAA 2MJYA 1CHVS 1COEA 2MHYA 5DU1A 1ZADA 2L5SA 1IDHA 1CVOA 1NTXA 4ZQYA 1HAJA 2H7ZB 1CXNA 2GOOB 1JGKA 1CRFA 4UY2C 3BT2U 1TXBA 2I9BE 1PLOA 1KXIA 4XJJA 2QJBC 2ERAA 1ABTA 1KBSA 2ABXA 2QJAC 4DO8A 5IMYC 1CODA 2MUOA 2PJYB 1BTEA 1HC9B 2JVEA 1MR6A 1IDGA 3U74U 1L4WA 2LCRA 3PLCA 4HQPF 1KTZB 2GOOC 2H62D 2OFSA 1CCQA 1ONJA 1CB9A 5EBXA 1ES7B 1CTXA 1NORA 5IMTD 1V6PA 3VTSA 2H8UA 1ERGA 1IQ9A 2MFAA 2NBTA 2UWRA 2CCXA 2BTXA 2VLWA 4IYEA 2FD6U 1CREA 1MAHF 4BDTB 2L03A 1QM7A 1CDSA 3EBXA
chains in the Genus database with same CATH superfamily
1RGJA 1KU6B 2QJ9C 1UG4A 1REWC 3U73U 1ERAA 2CRTA 2H5FA 1TXAA 1KL8A 1CXOA 1LXHA 2UX2A 1DRSA 1XT3A 1FF4A 1LXGA 1IK8A 1QKDA 3NDSA 2H64B 3EVSC 4P7UA 1CDQA 1NYUA 2H62C 1NYSA 2K3GA 2PJYC 1NEAA 1NTNA 3FEVA 4RUDA 1FASA 2MJ0A 1F94A 4KSNA 2MJ4A 1CDRA 3QB4B 3ERAA 1KBTA 1KFHA 3NH7A 2HLRA 2CTXA 1VB0A 4FAOC 5DZ5A 1IJCA 1FSCA 1LJZA 1TFSA 2J8BA 2BHIA 4LFTA 2HLQA 3HH7A 1F8UB 1IDIA 3BT1U 4EY8B 3NEQA 2N99A 1RL5A 1JBDA 4AEAA 2CDXA 5DO6A 1FRAA 2QC1A 1W6BA 1LSIA 2CRSA 1HC9A 1BXPA 1FFJA 1KS6A 1H0JA 1IDLA 1B41B 1IKCA 1KBAA 1G6MA 1S4YA 4OM5A 1NXBA 1QKEA 4OM4A 4BIKB 1YWHA 2X8BB 2JQPA 1JE9A 2H64C 1M9ZA 1KC4A 3LAQU 2MUPA 4FAOE 2H7ZA 6EBXA 1HOYA 1TGXA 1I02A 3KFDE 4QTIU 1LX5B 2LA1A 1FSSB 3KFDI 1CDTA 1HAAA 2MJYA 1CHVS 1COEA 2MHYA 5DU1A 1ZADA 2L5SA 1IDHA 1CVOA 1NTXA 4ZQYA 1HAJA 2H7ZB 1CXNA 2GOOB 1JGKA 1CRFA 4UY2C 3BT2U 1TXBA 2I9BE 1PLOA 1KXIA 4XJJA 2QJBC 2ERAA 1ABTA 1KBSA 2ABXA 2QJAC 4DO8A 5IMYC 1CODA 2MUOA 2PJYB 1BTEA 1HC9B 2JVEA 1MR6A 1IDGA 3U74U 1L4WA 2LCRA 3PLCA 4HQPF 1KTZB 2GOOC 2H62D 2OFSA 1CCQA 1ONJA 1CB9A 5EBXA 1ES7B 1CTXA 1NORA 5IMTD 1V6PA 3VTSA 2H8UA 1ERGA 1IQ9A 2MFAA 2NBTA 2UWRA 2CCXA 2BTXA 2VLWA 4IYEA 2FD6U 1CREA 1MAHF 4BDTB 2L03A 1QM7A 1CDSA 3EBXA
chains in the Genus database with same CATH topology
1RGJA 1KU6B 2QJ9C 1UG4A 1REWC 3U73U 1ERAA 2CRTA 2H5FA 1TXAA 1KL8A 1CXOA 1LXHA 2UX2A 1DRSA 1XT3A 1FF4A 1LXGA 1IK8A 1QKDA 3NDSA 2H64B 3EVSC 4P7UA 1CDQA 1NYUA 2H62C 1NYSA 2K3GA 2PJYC 1NEAA 1NTNA 3FEVA 4RUDA 1FASA 2MJ0A 1F94A 4KSNA 2MJ4A 1CDRA 3QB4B 3ERAA 1KBTA 1KFHA 3NH7A 2HLRA 2CTXA 1VB0A 4FAOC 5DZ5A 1IJCA 1FSCA 1LJZA 1TFSA 2J8BA 2BHIA 4LFTA 2HLQA 3HH7A 1F8UB 1IDIA 3BT1U 4EY8B 3NEQA 2N99A 1RL5A 1JBDA 4AEAA 2CDXA 5DO6A 1FRAA 2QC1A 1W6BA 1LSIA 2CRSA 1HC9A 1BXPA 1FFJA 1KS6A 1H0JA 1IDLA 1B41B 1IKCA 1KBAA 1G6MA 1S4YA 4OM5A 1NXBA 1QKEA 4OM4A 4BIKB 1YWHA 2X8BB 2JQPA 1JE9A 2H64C 1M9ZA 1KC4A 3LAQU 2MUPA 4FAOE 2H7ZA 6EBXA 1HOYA 1TGXA 1I02A 3KFDE 4QTIU 1LX5B 2LA1A 1FSSB 3KFDI 1CDTA 1HAAA 2MJYA 1CHVS 1COEA 2MHYA 5DU1A 1ZADA 2L5SA 1IDHA 1CVOA 1NTXA 4ZQYA 1HAJA 2H7ZB 1CXNA 2GOOB 1JGKA 1CRFA 4UY2C 3BT2U 1TXBA 2I9BE 1PLOA 1KXIA 4XJJA 2QJBC 2ERAA 1ABTA 1KBSA 2ABXA 2QJAC 4DO8A 5IMYC 1CODA 2MUOA 2PJYB 1BTEA 1HC9B 2JVEA 1MR6A 1IDGA 3U74U 1L4WA 2LCRA 3PLCA 4HQPF 1KTZB 2GOOC 2H62D 2OFSA 1CCQA 1ONJA 1CB9A 5EBXA 1ES7B 1CTXA 1NORA 5IMTD 1V6PA 3VTSA 2H8UA 1ERGA 1IQ9A 2MFAA 2NBTA 2UWRA 2CCXA 2BTXA 2VLWA 4IYEA 2FD6U 1CREA 1MAHF 4BDTB 2L03A 1QM7A 1CDSA 3EBXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RGJ A;  1KU6 B;  2QJ9 C;  1UG4 A;  1REW C;  3U73 U;  1ERA A;  2CRT A;  2H5F A;  1TXA A;  1KL8 A;  1CXO A;  1LXH A;  2UX2 A;  1DRS A;  1XT3 A;  1FF4 A;  1LXG A;  1IK8 A;  1QKD A;  3NDS A;  2H64 B;  3EVS C;  4P7U A;  1CDQ A;  1NYU A;  2H62 C;  1NYS A;  2K3G A;  2PJY C;  1NEA A;  1NTN A;  3FEV A;  4RUD A;  1FAS A;  2MJ0 A;  1F94 A;  2MJ4 A;  1CDR A;  3QB4 B;  3ERA A;  1KBT A;  1KFH A;  3NH7 A;  2HLR A;  2CTX A;  1VB0 A;  4FAO C;  5DZ5 A;  1IJC A;  1FSC A;  1LJZ A;  1TFS A;  2J8B A;  2BHI A;  4LFT A;  2HLQ A;  3HH7 A;  1F8U B;  1IDI A;  3BT1 U;  4EY8 B;  3NEQ A;  2N99 A;  1RL5 A;  1JBD A;  4AEA A;  2CDX A;  5DO6 A;  1FRA A;  2QC1 A;  1W6B A;  1LSI A;  2CRS A;  1HC9 A;  1BXP A;  1FFJ A;  1KS6 A;  1H0J A;  1IDL A;  1B41 B;  1IKC A;  1KBA A;  1G6M A;  1S4Y A;  4OM5 A;  1NXB A;  1QKE A;  4OM4 A;  4BIK B;  1YWH A;  2X8B B;  2JQP A;  1JE9 A;  2H64 C;  1M9Z A;  1KC4 A;  3LAQ U;  2MUP A;  4FAO E;  2H7Z A;  6EBX A;  1HOY A;  1TGX A;  1I02 A;  3KFD E;  4QTI U;  1LX5 B;  2LA1 A;  1FSS B;  3KFD I;  1CDT A;  1HAA A;  2MJY A;  1CHV S;  1COE A;  2MHY A;  5DU1 A;  1ZAD A;  2L5S A;  1IDH A;  1CVO A;  1NTX A;  4ZQY A;  1HAJ A;  2H7Z B;  1CXN A;  2GOO B;  1JGK A;  1CRF A;  4UY2 C;  3BT2 U;  1TXB A;  2I9B E;  1PLO A;  1KXI A;  4XJJ A;  2QJB C;  2ERA A;  1ABT A;  1KBS A;  2ABX A;  2QJA C;  4DO8 A;  5IMY C;  1COD A;  2MUO A;  2PJY B;  1BTE A;  1HC9 B;  2JVE A;  1MR6 A;  1IDG A;  3U74 U;  1L4W A;  2LCR A;  3PLC A;  4HQP F;  1KTZ B;  2GOO C;  2H62 D;  2OFS A;  1CCQ A;  1ONJ A;  1CB9 A;  5EBX A;  1ES7 B;  1CTX A;  1NOR A;  5IMT D;  1V6P A;  3VTS A;  2H8U A;  1ERG A;  1IQ9 A;  2MFA A;  2NBT A;  2UWR A;  2CCX A;  2BTX A;  2VLW A;  4IYE A;  2FD6 U;  1CRE A;  1MAH F;  4BDT B;  2L03 A;  1QM7 A;  1CDS A;  3EBX A; 
#chains in the Genus database with same CATH topology
 1RGJ A;  1KU6 B;  2QJ9 C;  1UG4 A;  1REW C;  3U73 U;  1ERA A;  2CRT A;  2H5F A;  1TXA A;  1KL8 A;  1CXO A;  1LXH A;  2UX2 A;  1DRS A;  1XT3 A;  1FF4 A;  1LXG A;  1IK8 A;  1QKD A;  3NDS A;  2H64 B;  3EVS C;  4P7U A;  1CDQ A;  1NYU A;  2H62 C;  1NYS A;  2K3G A;  2PJY C;  1NEA A;  1NTN A;  3FEV A;  4RUD A;  1FAS A;  2MJ0 A;  1F94 A;  4KSN A;  2MJ4 A;  1CDR A;  3QB4 B;  3ERA A;  1KBT A;  1KFH A;  3NH7 A;  2HLR A;  2CTX A;  1VB0 A;  4FAO C;  5DZ5 A;  1IJC A;  1FSC A;  1LJZ A;  1TFS A;  2J8B A;  2BHI A;  4LFT A;  2HLQ A;  3HH7 A;  1F8U B;  1IDI A;  3BT1 U;  4EY8 B;  3NEQ A;  2N99 A;  1RL5 A;  1JBD A;  4AEA A;  2CDX A;  5DO6 A;  1FRA A;  2QC1 A;  1W6B A;  1LSI A;  2CRS A;  1HC9 A;  1BXP A;  1FFJ A;  1KS6 A;  1H0J A;  1IDL A;  1B41 B;  1IKC A;  1KBA A;  1G6M A;  1S4Y A;  4OM5 A;  1NXB A;  1QKE A;  4OM4 A;  4BIK B;  1YWH A;  2X8B B;  2JQP A;  1JE9 A;  2H64 C;  1M9Z A;  1KC4 A;  3LAQ U;  2MUP A;  4FAO E;  2H7Z A;  6EBX A;  1HOY A;  1TGX A;  1I02 A;  3KFD E;  4QTI U;  1LX5 B;  2LA1 A;  1FSS B;  3KFD I;  1CDT A;  1HAA A;  2MJY A;  1CHV S;  1COE A;  2MHY A;  5DU1 A;  1ZAD A;  2L5S A;  1IDH A;  1CVO A;  1NTX A;  4ZQY A;  1HAJ A;  2H7Z B;  1CXN A;  2GOO B;  1JGK A;  1CRF A;  4UY2 C;  3BT2 U;  1TXB A;  2I9B E;  1PLO A;  1KXI A;  4XJJ A;  2QJB C;  2ERA A;  1ABT A;  1KBS A;  2ABX A;  2QJA C;  4DO8 A;  5IMY C;  1COD A;  2MUO A;  2PJY B;  1BTE A;  1HC9 B;  2JVE A;  1MR6 A;  1IDG A;  3U74 U;  1L4W A;  2LCR A;  3PLC A;  4HQP F;  1KTZ B;  2GOO C;  2H62 D;  2OFS A;  1CCQ A;  1ONJ A;  1CB9 A;  5EBX A;  1ES7 B;  1CTX A;  1NOR A;  5IMT D;  1V6P A;  3VTS A;  2H8U A;  1ERG A;  1IQ9 A;  2MFA A;  2NBT A;  2UWR A;  2CCX A;  2BTX A;  2VLW A;  4IYE A;  2FD6 U;  1CRE A;  1MAH F;  4BDT B;  2L03 A;  1QM7 A;  1CDS A;  3EBX A; 
#chains in the Genus database with same CATH homology
 1RGJ A;  1KU6 B;  2QJ9 C;  1UG4 A;  1REW C;  3U73 U;  1ERA A;  2CRT A;  2H5F A;  1TXA A;  1KL8 A;  1CXO A;  1LXH A;  2UX2 A;  1DRS A;  1XT3 A;  1FF4 A;  1LXG A;  1IK8 A;  1QKD A;  3NDS A;  2H64 B;  3EVS C;  4P7U A;  1CDQ A;  1NYU A;  2H62 C;  1NYS A;  2K3G A;  2PJY C;  1NEA A;  1NTN A;  3FEV A;  4RUD A;  1FAS A;  2MJ0 A;  1F94 A;  4KSN A;  2MJ4 A;  1CDR A;  3QB4 B;  3ERA A;  1KBT A;  1KFH A;  3NH7 A;  2HLR A;  2CTX A;  1VB0 A;  4FAO C;  5DZ5 A;  1IJC A;  1FSC A;  1LJZ A;  1TFS A;  2J8B A;  2BHI A;  4LFT A;  2HLQ A;  3HH7 A;  1F8U B;  1IDI A;  3BT1 U;  4EY8 B;  3NEQ A;  2N99 A;  1RL5 A;  1JBD A;  4AEA A;  2CDX A;  5DO6 A;  1FRA A;  2QC1 A;  1W6B A;  1LSI A;  2CRS A;  1HC9 A;  1BXP A;  1FFJ A;  1KS6 A;  1H0J A;  1IDL A;  1B41 B;  1IKC A;  1KBA A;  1G6M A;  1S4Y A;  4OM5 A;  1NXB A;  1QKE A;  4OM4 A;  4BIK B;  1YWH A;  2X8B B;  2JQP A;  1JE9 A;  2H64 C;  1M9Z A;  1KC4 A;  3LAQ U;  2MUP A;  4FAO E;  2H7Z A;  6EBX A;  1HOY A;  1TGX A;  1I02 A;  3KFD E;  4QTI U;  1LX5 B;  2LA1 A;  1FSS B;  3KFD I;  1CDT A;  1HAA A;  2MJY A;  1CHV S;  1COE A;  2MHY A;  5DU1 A;  1ZAD A;  2L5S A;  1IDH A;  1CVO A;  1NTX A;  4ZQY A;  1HAJ A;  2H7Z B;  1CXN A;  2GOO B;  1JGK A;  1CRF A;  4UY2 C;  3BT2 U;  1TXB A;  2I9B E;  1PLO A;  1KXI A;  4XJJ A;  2QJB C;  2ERA A;  1ABT A;  1KBS A;  2ABX A;  2QJA C;  4DO8 A;  5IMY C;  1COD A;  2MUO A;  2PJY B;  1BTE A;  1HC9 B;  2JVE A;  1MR6 A;  1IDG A;  3U74 U;  1L4W A;  2LCR A;  3PLC A;  4HQP F;  1KTZ B;  2GOO C;  2H62 D;  2OFS A;  1CCQ A;  1ONJ A;  1CB9 A;  5EBX A;  1ES7 B;  1CTX A;  1NOR A;  5IMT D;  1V6P A;  3VTS A;  2H8U A;  1ERG A;  1IQ9 A;  2MFA A;  2NBT A;  2UWR A;  2CCX A;  2BTX A;  2VLW A;  4IYE A;  2FD6 U;  1CRE A;  1MAH F;  4BDT B;  2L03 A;  1QM7 A;  1CDS A;  3EBX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...