4FAOE

Specificity and structure of a high affinity activin-like 1 (alk1) signaling complex
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
91
structure length
91
Chain Sequence
RECIYYNANWELERTNQSGLERCEGEQDKRLHCYASWRNSSGTIELVKKGCWLDDFNCYDRQECVATEENPQVYFCCCEGNFCNERFTHLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Specificity and Structure of a High Affinity Activin Receptor-like Kinase 1 (ALK1) Signaling Complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/signaling protein
molecule keywords Growth/differentiation factor 2
total genus 19
structure length 91
sequence length 91
chains with identical sequence F, K, L, Q, R, W, X, e, f, k, l
ec nomenclature ec 2.7.11.30: Receptor protein serine/threonine kinase.
pdb deposition date 2012-05-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 4faoE00
1NYSA 2ABXA 4P7UA 1S4YA 2GOOC 3KFDE 4XJJA 1CODA 2HLRA 2H62C 1HAJA 1B41B 1IDLA 1JGKA 1FASA 1LX5B 2N99A 1LSIA 1CTXA 1KL8A 5IMYC 2H64C 1CB9A 1HC9B 2VLWA 1COEA 1VB0A 1ZADA 1BTEA 1KBSA 5DZ5A 1MAHF 2CRTA 2QJ9C 3NH7A 2BTXA 5DU1A 1KFHA 1YWHA 3FEVA 2H7ZB 1ABTA 1TXAA 2OFSA 2MJ4A 1FF4A 2I9BE 1F94A 1TXBA 1LXHA 1CDRA 1QKDA 1CXOA 2NBTA 2CTXA 3LAQU 1PLOA 2ERAA 1RL5A 2UWRA 1CDQA 1NTXA 2H64B 2L03A 1KTZB 2FD6U 1IK8A 1NYUA 1QM7A 2QJAC 3NDSA 1CCQA 1KC4A 1IJCA 3BT1U 2K3GA 2MHYA 1FFJA 1KBTA 5DO6A 4BIKB 4RUDA 1IKCA 1IDIA 1G6MA 2GOOB 2JVEA 1KU6B 2BHIA 1REWC 3NEQA 1FRAA 1W6BA 1NEAA 6EBXA 2PJYC 3U74U 1KS6A 1V6PA 1DRSA 1KXIA 1HC9A 1RGJA 2QJBC 1I02A 5EBXA 3U73U 2LA1A 3QB4B 2CRSA 1QKEA 1ONJA 1TGXA 2H62D 4BDTB 2LCRA 1ERAA 1CHVS 1KBAA 2JQPA 4QTIU 1CREA 4AEAA 1M9ZA 2QC1A 1XT3A 3EBXA 4EY8B 2PJYB 4IYEA 2L5SA 3KFDI 1JBDA 1NORA 1TFSA 4HQPF 1H0JA 3BT2U 1UG4A 4OM4A 4ZQYA 3EVSC 3ERAA 2MUOA 1FSSB 1CVOA 1CDSA 1CDTA 1HOYA 2CCXA 1ERGA 1CRFA 2H5FA 4FAOE 4OM5A 1BXPA 4DO8A 1NXBA 2H7ZA 2HLQA 5IMTD 4FAOC 1FSCA 1JE9A 1F8UB 3PLCA 1L4WA 1IDHA 2CDXA 2J8BA 1IQ9A 4LFTA 1LJZA 2X8BB 2MJ0A 4UY2C 1NTNA 1HAAA 2MJYA 2H8UA 1MR6A 2MFAA 1CXNA 2UX2A 3VTSA 1IDGA 1LXGA 1ES7B 3HH7A 2MUPA
chains in the Genus database with same CATH superfamily
1NYSA 2ABXA 4P7UA 1S4YA 2GOOC 3KFDE 4XJJA 1CODA 2HLRA 2H62C 1HAJA 1B41B 1IDLA 1JGKA 1FASA 1LX5B 2N99A 1LSIA 1CTXA 1KL8A 5IMYC 2H64C 1CB9A 1HC9B 2VLWA 1COEA 1VB0A 1ZADA 1BTEA 1KBSA 5DZ5A 1MAHF 2CRTA 2QJ9C 3NH7A 2BTXA 5DU1A 1KFHA 1YWHA 3FEVA 2H7ZB 1ABTA 1TXAA 2OFSA 2MJ4A 1FF4A 2I9BE 1F94A 1TXBA 4KSNA 1LXHA 1CDRA 1QKDA 1CXOA 2NBTA 2CTXA 3LAQU 1PLOA 2ERAA 1RL5A 2UWRA 1CDQA 1NTXA 2H64B 2L03A 1KTZB 2FD6U 1IK8A 1NYUA 1QM7A 2QJAC 3NDSA 1CCQA 1KC4A 1IJCA 3BT1U 2K3GA 2MHYA 1FFJA 1KBTA 5DO6A 4BIKB 4RUDA 1IKCA 1IDIA 1G6MA 2GOOB 2JVEA 1KU6B 2BHIA 1REWC 3NEQA 1FRAA 1W6BA 1NEAA 6EBXA 2PJYC 3U74U 1KS6A 1V6PA 1DRSA 1KXIA 1HC9A 1RGJA 2QJBC 1I02A 5EBXA 3U73U 2LA1A 3QB4B 2CRSA 1QKEA 1ONJA 1TGXA 2H62D 4BDTB 2LCRA 1ERAA 1CHVS 1KBAA 2JQPA 4QTIU 1CREA 4AEAA 1M9ZA 2QC1A 1XT3A 3EBXA 4EY8B 2PJYB 4IYEA 2L5SA 3KFDI 1JBDA 1NORA 1TFSA 4HQPF 1H0JA 3BT2U 1UG4A 4OM4A 4ZQYA 3EVSC 3ERAA 2MUOA 1FSSB 1CVOA 1CDSA 1CDTA 1HOYA 2CCXA 1ERGA 1CRFA 2H5FA 4FAOE 4OM5A 1BXPA 4DO8A 1NXBA 2H7ZA 2HLQA 5IMTD 4FAOC 1FSCA 1JE9A 1F8UB 3PLCA 1L4WA 1IDHA 2CDXA 2J8BA 1IQ9A 4LFTA 1LJZA 2X8BB 2MJ0A 4UY2C 1NTNA 1HAAA 2MJYA 2H8UA 1MR6A 2MFAA 1CXNA 2UX2A 3VTSA 1IDGA 1LXGA 1ES7B 3HH7A 2MUPA
chains in the Genus database with same CATH topology
1NYSA 2ABXA 4P7UA 1S4YA 2GOOC 3KFDE 4XJJA 1CODA 2HLRA 2H62C 1HAJA 1B41B 1IDLA 1JGKA 1FASA 1LX5B 2N99A 1LSIA 1CTXA 1KL8A 5IMYC 2H64C 1CB9A 1HC9B 2VLWA 1COEA 1VB0A 1ZADA 1BTEA 1KBSA 5DZ5A 1MAHF 2CRTA 2QJ9C 3NH7A 2BTXA 5DU1A 1KFHA 1YWHA 3FEVA 2H7ZB 1ABTA 1TXAA 2OFSA 2MJ4A 1FF4A 2I9BE 1F94A 1TXBA 4KSNA 1LXHA 1CDRA 1QKDA 1CXOA 2NBTA 2CTXA 3LAQU 1PLOA 2ERAA 1RL5A 2UWRA 1CDQA 1NTXA 2H64B 2L03A 1KTZB 2FD6U 1IK8A 1NYUA 1QM7A 2QJAC 3NDSA 1CCQA 1KC4A 1IJCA 3BT1U 2K3GA 2MHYA 1FFJA 1KBTA 5DO6A 4BIKB 4RUDA 1IKCA 1IDIA 1G6MA 2GOOB 2JVEA 1KU6B 2BHIA 1REWC 3NEQA 1FRAA 1W6BA 1NEAA 6EBXA 2PJYC 3U74U 1KS6A 1V6PA 1DRSA 1KXIA 1HC9A 1RGJA 2QJBC 1I02A 5EBXA 3U73U 2LA1A 3QB4B 2CRSA 1QKEA 1ONJA 1TGXA 2H62D 4BDTB 2LCRA 1ERAA 1CHVS 1KBAA 2JQPA 4QTIU 1CREA 4AEAA 1M9ZA 2QC1A 1XT3A 3EBXA 4EY8B 2PJYB 4IYEA 2L5SA 3KFDI 1JBDA 1NORA 1TFSA 4HQPF 1H0JA 3BT2U 1UG4A 4OM4A 4ZQYA 3EVSC 3ERAA 2MUOA 1FSSB 1CVOA 1CDSA 1CDTA 1HOYA 2CCXA 1ERGA 1CRFA 2H5FA 4FAOE 4OM5A 1BXPA 4DO8A 1NXBA 2H7ZA 2HLQA 5IMTD 4FAOC 1FSCA 1JE9A 1F8UB 3PLCA 1L4WA 1IDHA 2CDXA 2J8BA 1IQ9A 4LFTA 1LJZA 2X8BB 2MJ0A 4UY2C 1NTNA 1HAAA 2MJYA 2H8UA 1MR6A 2MFAA 1CXNA 2UX2A 3VTSA 1IDGA 1LXGA 1ES7B 3HH7A 2MUPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NYS A;  2ABX A;  4P7U A;  1S4Y A;  2GOO C;  3KFD E;  4XJJ A;  1COD A;  2HLR A;  2H62 C;  1HAJ A;  1B41 B;  1IDL A;  1JGK A;  1FAS A;  1LX5 B;  2N99 A;  1LSI A;  1CTX A;  1KL8 A;  5IMY C;  2H64 C;  1CB9 A;  1HC9 B;  2VLW A;  1COE A;  1VB0 A;  1ZAD A;  1BTE A;  1KBS A;  5DZ5 A;  1MAH F;  2CRT A;  2QJ9 C;  3NH7 A;  2BTX A;  5DU1 A;  1KFH A;  1YWH A;  3FEV A;  2H7Z B;  1ABT A;  1TXA A;  2OFS A;  2MJ4 A;  1FF4 A;  2I9B E;  1F94 A;  1TXB A;  1LXH A;  1CDR A;  1QKD A;  1CXO A;  2NBT A;  2CTX A;  3LAQ U;  1PLO A;  2ERA A;  1RL5 A;  2UWR A;  1CDQ A;  1NTX A;  2H64 B;  2L03 A;  1KTZ B;  2FD6 U;  1IK8 A;  1NYU A;  1QM7 A;  2QJA C;  3NDS A;  1CCQ A;  1KC4 A;  1IJC A;  3BT1 U;  2K3G A;  2MHY A;  1FFJ A;  1KBT A;  5DO6 A;  4BIK B;  4RUD A;  1IKC A;  1IDI A;  1G6M A;  2GOO B;  2JVE A;  1KU6 B;  2BHI A;  1REW C;  3NEQ A;  1FRA A;  1W6B A;  1NEA A;  6EBX A;  2PJY C;  3U74 U;  1KS6 A;  1V6P A;  1DRS A;  1KXI A;  1HC9 A;  1RGJ A;  2QJB C;  1I02 A;  5EBX A;  3U73 U;  2LA1 A;  3QB4 B;  2CRS A;  1QKE A;  1ONJ A;  1TGX A;  2H62 D;  4BDT B;  2LCR A;  1ERA A;  1CHV S;  1KBA A;  2JQP A;  4QTI U;  1CRE A;  4AEA A;  1M9Z A;  2QC1 A;  1XT3 A;  3EBX A;  4EY8 B;  2PJY B;  4IYE A;  2L5S A;  3KFD I;  1JBD A;  1NOR A;  1TFS A;  4HQP F;  1H0J A;  3BT2 U;  1UG4 A;  4OM4 A;  4ZQY A;  3EVS C;  3ERA A;  2MUO A;  1FSS B;  1CVO A;  1CDS A;  1CDT A;  1HOY A;  2CCX A;  1ERG A;  1CRF A;  2H5F A;  4FAO E;  4OM5 A;  1BXP A;  4DO8 A;  1NXB A;  2H7Z A;  2HLQ A;  5IMT D;  4FAO C;  1FSC A;  1JE9 A;  1F8U B;  3PLC A;  1L4W A;  1IDH A;  2CDX A;  2J8B A;  1IQ9 A;  4LFT A;  1LJZ A;  2X8B B;  2MJ0 A;  4UY2 C;  1NTN A;  1HAA A;  2MJY A;  2H8U A;  1MR6 A;  2MFA A;  1CXN A;  2UX2 A;  3VTS A;  1IDG A;  1LXG A;  1ES7 B;  3HH7 A;  2MUP A; 
#chains in the Genus database with same CATH topology
 1NYS A;  2ABX A;  4P7U A;  1S4Y A;  2GOO C;  3KFD E;  4XJJ A;  1COD A;  2HLR A;  2H62 C;  1HAJ A;  1B41 B;  1IDL A;  1JGK A;  1FAS A;  1LX5 B;  2N99 A;  1LSI A;  1CTX A;  1KL8 A;  5IMY C;  2H64 C;  1CB9 A;  1HC9 B;  2VLW A;  1COE A;  1VB0 A;  1ZAD A;  1BTE A;  1KBS A;  5DZ5 A;  1MAH F;  2CRT A;  2QJ9 C;  3NH7 A;  2BTX A;  5DU1 A;  1KFH A;  1YWH A;  3FEV A;  2H7Z B;  1ABT A;  1TXA A;  2OFS A;  2MJ4 A;  1FF4 A;  2I9B E;  1F94 A;  1TXB A;  4KSN A;  1LXH A;  1CDR A;  1QKD A;  1CXO A;  2NBT A;  2CTX A;  3LAQ U;  1PLO A;  2ERA A;  1RL5 A;  2UWR A;  1CDQ A;  1NTX A;  2H64 B;  2L03 A;  1KTZ B;  2FD6 U;  1IK8 A;  1NYU A;  1QM7 A;  2QJA C;  3NDS A;  1CCQ A;  1KC4 A;  1IJC A;  3BT1 U;  2K3G A;  2MHY A;  1FFJ A;  1KBT A;  5DO6 A;  4BIK B;  4RUD A;  1IKC A;  1IDI A;  1G6M A;  2GOO B;  2JVE A;  1KU6 B;  2BHI A;  1REW C;  3NEQ A;  1FRA A;  1W6B A;  1NEA A;  6EBX A;  2PJY C;  3U74 U;  1KS6 A;  1V6P A;  1DRS A;  1KXI A;  1HC9 A;  1RGJ A;  2QJB C;  1I02 A;  5EBX A;  3U73 U;  2LA1 A;  3QB4 B;  2CRS A;  1QKE A;  1ONJ A;  1TGX A;  2H62 D;  4BDT B;  2LCR A;  1ERA A;  1CHV S;  1KBA A;  2JQP A;  4QTI U;  1CRE A;  4AEA A;  1M9Z A;  2QC1 A;  1XT3 A;  3EBX A;  4EY8 B;  2PJY B;  4IYE A;  2L5S A;  3KFD I;  1JBD A;  1NOR A;  1TFS A;  4HQP F;  1H0J A;  3BT2 U;  1UG4 A;  4OM4 A;  4ZQY A;  3EVS C;  3ERA A;  2MUO A;  1FSS B;  1CVO A;  1CDS A;  1CDT A;  1HOY A;  2CCX A;  1ERG A;  1CRF A;  2H5F A;  4FAO E;  4OM5 A;  1BXP A;  4DO8 A;  1NXB A;  2H7Z A;  2HLQ A;  5IMT D;  4FAO C;  1FSC A;  1JE9 A;  1F8U B;  3PLC A;  1L4W A;  1IDH A;  2CDX A;  2J8B A;  1IQ9 A;  4LFT A;  1LJZ A;  2X8B B;  2MJ0 A;  4UY2 C;  1NTN A;  1HAA A;  2MJY A;  2H8U A;  1MR6 A;  2MFA A;  1CXN A;  2UX2 A;  3VTS A;  1IDG A;  1LXG A;  1ES7 B;  3HH7 A;  2MUP A; 
#chains in the Genus database with same CATH homology
 1NYS A;  2ABX A;  4P7U A;  1S4Y A;  2GOO C;  3KFD E;  4XJJ A;  1COD A;  2HLR A;  2H62 C;  1HAJ A;  1B41 B;  1IDL A;  1JGK A;  1FAS A;  1LX5 B;  2N99 A;  1LSI A;  1CTX A;  1KL8 A;  5IMY C;  2H64 C;  1CB9 A;  1HC9 B;  2VLW A;  1COE A;  1VB0 A;  1ZAD A;  1BTE A;  1KBS A;  5DZ5 A;  1MAH F;  2CRT A;  2QJ9 C;  3NH7 A;  2BTX A;  5DU1 A;  1KFH A;  1YWH A;  3FEV A;  2H7Z B;  1ABT A;  1TXA A;  2OFS A;  2MJ4 A;  1FF4 A;  2I9B E;  1F94 A;  1TXB A;  4KSN A;  1LXH A;  1CDR A;  1QKD A;  1CXO A;  2NBT A;  2CTX A;  3LAQ U;  1PLO A;  2ERA A;  1RL5 A;  2UWR A;  1CDQ A;  1NTX A;  2H64 B;  2L03 A;  1KTZ B;  2FD6 U;  1IK8 A;  1NYU A;  1QM7 A;  2QJA C;  3NDS A;  1CCQ A;  1KC4 A;  1IJC A;  3BT1 U;  2K3G A;  2MHY A;  1FFJ A;  1KBT A;  5DO6 A;  4BIK B;  4RUD A;  1IKC A;  1IDI A;  1G6M A;  2GOO B;  2JVE A;  1KU6 B;  2BHI A;  1REW C;  3NEQ A;  1FRA A;  1W6B A;  1NEA A;  6EBX A;  2PJY C;  3U74 U;  1KS6 A;  1V6P A;  1DRS A;  1KXI A;  1HC9 A;  1RGJ A;  2QJB C;  1I02 A;  5EBX A;  3U73 U;  2LA1 A;  3QB4 B;  2CRS A;  1QKE A;  1ONJ A;  1TGX A;  2H62 D;  4BDT B;  2LCR A;  1ERA A;  1CHV S;  1KBA A;  2JQP A;  4QTI U;  1CRE A;  4AEA A;  1M9Z A;  2QC1 A;  1XT3 A;  3EBX A;  4EY8 B;  2PJY B;  4IYE A;  2L5S A;  3KFD I;  1JBD A;  1NOR A;  1TFS A;  4HQP F;  1H0J A;  3BT2 U;  1UG4 A;  4OM4 A;  4ZQY A;  3EVS C;  3ERA A;  2MUO A;  1FSS B;  1CVO A;  1CDS A;  1CDT A;  1HOY A;  2CCX A;  1ERG A;  1CRF A;  2H5F A;  4FAO E;  4OM5 A;  1BXP A;  4DO8 A;  1NXB A;  2H7Z A;  2HLQ A;  5IMT D;  4FAO C;  1FSC A;  1JE9 A;  1F8U B;  3PLC A;  1L4W A;  1IDH A;  2CDX A;  2J8B A;  1IQ9 A;  4LFT A;  1LJZ A;  2X8B B;  2MJ0 A;  4UY2 C;  1NTN A;  1HAA A;  2MJY A;  2H8U A;  1MR6 A;  2MFA A;  1CXN A;  2UX2 A;  3VTS A;  1IDG A;  1LXG A;  1ES7 B;  3HH7 A;  2MUP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...