4FBNA

Insights into structural integration of the plcgamma regulatory region and mechanism of autoinhibition and activation based on key roles of sh2 domains
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
243
structure length
232
Chain Sequence
NEKWFHGKLGAGDGRHIAERLLTEYCIETGAPDGSFLVRESETFVGDYTLSFWRNGKVQHCRIHSRQDAGTPKFFLTDNLVFDSLYDLITHYQQVPLRCNEFEMRLSEPVPQTNAHESKEWYHASLTRAQAEHMLMRVPRDGAFLVRKRNEPNSYAISFRAEGKIKHCRVQQEGQTVMLGNSEFDSLVDLISYYEKHPLYRKMKLRYPINEEALEKIGTAEPDYGYVEANPM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural and Functional Integration of the PLCgamma Interaction Domains Critical for Regulatory Mechanisms and Signaling Deregulation.
pubmed doi rcsb
molecule keywords 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase ga
molecule tags Hydrolase
source organism Homo sapiens
total genus 58
structure length 232
sequence length 243
ec nomenclature ec 3.1.4.11: Phosphoinositide phospholipase C.
pdb deposition date 2012-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00017 SH2 SH2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.505.10 Alpha Beta 2-Layer Sandwich SHC Adaptor Protein SH2 domain 4fbnA02
3.30.505.10 Alpha Beta 2-Layer Sandwich SHC Adaptor Protein SH2 domain 4fbnA01
4H34A 3PJPA 3VS6A 4FBNA 3BUMB 4F5BA 1BF5A 5IBMA 3K2MA 1SHAA 1AYDA 1O4DA 1GHUA 3VS4A 3VRYA 3OVEA 1LUNA 2H46E 2H5KA 1X6CA 1CJ1A 4XZ1A 1UUSA 1O4HA 1I3ZA 2SHPA 1ZFPE 1O44A 1H9OA 3US4A 1R1QA 2K79B 4FL2A 2IZVA 3BKBA 1D4TA 2BBUA 1HCTB 2MRKA 1O45A 4EY0A 1TCEA 2LNWA 5DC0B 2L4KA 1O4JA 3OV1A 4JEGA 4LUDA 1A1AA 1OO4A 3TKZA 2C9WA 3T04A 2MC1A 1FU5A 1AOTF 1O4LA 2HUWA 3OB2B 3WA4A 1CSZA 1KA7A 2QMSA 3PFVA 1SKJA 3VRRA 1O4IA 1O4CA 1FBZA 1X27A 3IN7A 1QCFA 5EHPA 2LQWA 2EKXA 3BUXB 3VS7A 3PLFB 2RMXA 1LUIA 5J3XA 2L6KA 2PLEA 1O4NA 3BUNB 3MXYA 3EAZA 2DX0A 2FCIA 3TL0A 1AD5A 1D1ZA 3MAZA 1A1CA 3VROA 2CI9A 3N8MA 1AYCA 4JGHA 1MW4A 1A07A 5EG3B 1FU6A 1TZEE 3PSJA 1KC2A 4K44A 2MK2A 3QWYA 4JE4A 4P9VA 2C0TA 4QSYA 4A4BA 2EO6A 3IN8A 2LNXA 2DLZA 4NWFA 1BM2A 1O4FA 1G83A 3HHMB 2H8HA 2CS0A 2C0IA 1BHHB 2DLYA 2CBLA 4OHEA 4D8KA 1LKLA 1GRIA 1B47A 2Y1MA 3S8OA 5DC9A 4H1OA 4NWGA 1A1EA 1JYQA 4TZIA 2AOAA 2K7AB 1BG1A 1BFIA 4P9ZA 1JYUA 1KA6A 1BFJA 1O47A 2ETZA 3GXWA 3CXLA 4K2RA 4M4ZA 2C0OA 5GJIA 2PLDA 5EHRA 1O46A 4GWFA 4OHDA 1NZVA 1IJRA 2DCRA 3S8LA 1QADA 4F5AA 3PSKA 3OP0A 3VS5A 4ROJA 4E68A 4DGXA 1UURA 1FMKA 2EYVA 5DF6A 1O4GA 4OHIA 1LUKA 4EIHA 1OPLA 1AB2A 1A1BA 3C7IA 3UYOA 5HKYA 3UF4A 1FHSA 2EOBA 2GE9A 2IUHA 1AYAA 2Y1NA 4K45A 3VS3A 2Y3AB 1Y1UA 5AXIA 2PTKA 1BKLA 1FYRA 2FO0A 4U1PA 1SPRA 2LQNA 2OZOA 1O41A 1MILA 2CRHA 1Y57A 1BHHA 2DVJA 3N7YA 2ABLA 3N84A 1BKMA 2L3TA 1AYBA 5I6VA 1YVHA 1FBVA 2CR4A 1O4EA 1JYRA 3HIZB 4OHHA 5CDWA 2MRJA 5BO4A 3QWXX 3VRPA 5HKWA 1LKKA 1JU5A 2ECDA 4F59A 1O42A 1O4KA 2IUIA 2HDVA 1O48A 3M7FA 4OHLA 1O4BA 1QG1E 1O4OA 1Z3KA 1NZLA 1R1PA 1BMBA 2PNAA 2HDXA 5DC4A 2KNOA 3CD3A 3GXXA 5GJHA 5EELA 2RVFA 1RPYA 1O4RA 1A08A 3VS1A 3VS2A 1RJAA 2AOBA 2HCKA 3PS5A 1KSWA 2JYQA 3S9KA 1YVLA 4GL9E 4A4CA 3VRQA 2RSYA 1OPKA 2EYZA 1AOUF 1CWDL 2MQIA 5AULA 3EACA 1O4PA 3IMDA 4FL3A 1P13A 2CIAA 2DM0A 5IBSA 1IS0A 1LCJA 4E93A 4GPLB 4X6SA 1X0NA 2GSBA 1BHFA 1CWEA 1F1WA 3ZNIA 2XP1A 2VIFA 1PICA 1O4MA 1O49A 1RQQC 2OQ1A 2B3OA 1CSYA 4WWQA 3MXCA 3BUWB 1LCKA 2KK6A 3OB1B 5KAZA 4K11A 2PNBA 1O4QA 3KFJA 1HCSB 5HKZA 3PQZA 2SRCA 2EL8A 3CWGA 3CBLA 1NRVA 1SHBA 2EYYA 1LUMA 1R1SA 3GQIB 3HCKA 3S8NA 2HMHA 2CI8A 1D4WA 4XZ0A 1SHDA 4U17A 1F2FA 2IUGA 5EEQA 2YU7A 1SPSA 1A81A 2LCTA 4LUEA 1BLJA 3VS0A 2AUGA 1M61A 1XA6A 3IMJA 3VGOA 2EU0A 1OO3A 2YSXA 3VRNA 1O4AA 4DGPA 3BUOB 1A09A 1M27A 4L1BB 1JWOA 1O43A 2RORA 1BLKA 5D0JA 1WQUA 2EO3A 1K9AA 3VRZA 3NHNA
chains in the Genus database with same CATH superfamily
4H34A 3PJPA 3VS6A 4FBNA 3BUMB 4F5BA 1BF5A 5IBMA 3K2MA 1SHAA 1AYDA 1O4DA 1GHUA 3VS4A 3VRYA 3OVEA 1LUNA 2H46E 2H5KA 1X6CA 1CJ1A 4XZ1A 1UUSA 1O4HA 1I3ZA 2SHPA 1ZFPE 1O44A 1H9OA 3US4A 1R1QA 2K79B 4FL2A 2IZVA 3BKBA 1D4TA 2BBUA 1HCTB 2MRKA 1O45A 4EY0A 1TCEA 2LNWA 5DC0B 2L4KA 1O4JA 3OV1A 4JEGA 4LUDA 1A1AA 1OO4A 3TKZA 2C9WA 3T04A 2MC1A 1FU5A 1AOTF 1O4LA 2HUWA 3OB2B 3WA4A 1CSZA 1KA7A 2QMSA 3PFVA 1SKJA 3VRRA 1O4IA 1O4CA 1FBZA 1X27A 3IN7A 1QCFA 5EHPA 2LQWA 2EKXA 3BUXB 3VS7A 3PLFB 2RMXA 1LUIA 5J3XA 2L6KA 2PLEA 1O4NA 3BUNB 3MXYA 3EAZA 2DX0A 2FCIA 3TL0A 1AD5A 1D1ZA 3MAZA 1A1CA 3VROA 2CI9A 3N8MA 1AYCA 4JGHA 1MW4A 1A07A 5EG3B 1FU6A 1TZEE 3PSJA 1KC2A 4K44A 2MK2A 3QWYA 4JE4A 4P9VA 2C0TA 4QSYA 2KGYA 2EO6A 3IN8A 4A4BA 2LNXA 2DLZA 4NWFA 1BM2A 1O4FA 1G83A 3HHMB 2H8HA 2CS0A 2C0IA 1BHHB 2DLYA 2CBLA 4OHEA 4D8KA 1LKLA 1GRIA 1B47A 2Y1MA 3S8OA 5DC9A 4H1OA 4NWGA 1A1EA 1JYQA 4TZIA 2AOAA 2K7AB 1BG1A 1BFIA 4P9ZA 1JYUA 1KA6A 1BFJA 1O47A 2ETZA 3GXWA 3CXLA 4K2RA 4M4ZA 2C0OA 5GJIA 2PLDA 5EHRA 1O46A 4GWFA 4OHDA 1NZVA 1IJRA 2DCRA 3S8LA 1QADA 4F5AA 3PSKA 3OP0A 3VS5A 4ROJA 4E68A 4DGXA 1UURA 1FMKA 2EYVA 5DF6A 1O4GA 4OHIA 1LUKA 3K2TA 4EIHA 1OPLA 1AB2A 1A1BA 3C7IA 3UYOA 5HKYA 3UF4A 1FHSA 2EOBA 2GE9A 2IUHA 1AYAA 2Y1NA 4K45A 3VS3A 2Y3AB 1Y1UA 5AXIA 2PTKA 1BKLA 1FYRA 2FO0A 4U1PA 1SPRA 2LQNA 2OZOA 1O41A 1MILA 2CRHA 1Y57A 1BHHA 2DVJA 3N7YA 2ABLA 3N84A 1BKMA 2L3TA 1AYBA 5I6VA 1YVHA 1FBVA 2CR4A 1O4EA 1JYRA 3HIZB 4OHHA 5CDWA 2MRJA 5BO4A 3QWXX 3VRPA 5HKWA 1LKKA 1JU5A 2ECDA 4F59A 1O42A 1O4KA 2IUIA 2HDVA 1O48A 3M7FA 4OHLA 1O4BA 1QG1E 1O4OA 1Z3KA 1NZLA 1R1PA 1BMBA 2PNAA 2HDXA 5DC4A 2KNOA 3CD3A 3GXXA 5GJHA 5EELA 2RVFA 1RPYA 1O4RA 1A08A 3VS1A 3VS2A 1RJAA 2AOBA 2HCKA 3PS5A 1KSWA 2JYQA 3S9KA 1YVLA 4GL9E 4A4CA 3VRQA 2RSYA 1OPKA 2EYZA 1AOUF 1CWDL 2MQIA 5AULA 3EACA 1O4PA 3IMDA 4FL3A 1P13A 2CIAA 2DM0A 5IBSA 1IS0A 1LCJA 4E93A 4GPLB 4X6SA 1X0NA 2GSBA 1BHFA 1CWEA 1F1WA 3ZNIA 2XP1A 2VIFA 1PICA 1O4MA 1O49A 1RQQC 2OQ1A 2B3OA 1CSYA 4WWQA 3MXCA 3LYVA 3BUWB 1LCKA 2KK6A 3OB1B 5KAZA 4K11A 2PNBA 1O4QA 3KFJA 1HCSB 5HKZA 3PQZA 2SRCA 2EL8A 3CWGA 3CBLA 1NRVA 1SHBA 2EYYA 1LUMA 1R1SA 3GQIB 3HCKA 3S8NA 2HMHA 2CI8A 1D4WA 4XZ0A 1SHDA 4U17A 1F2FA 2IUGA 5EEQA 2YU7A 1SPSA 1A81A 2LCTA 4LUEA 1BLJA 3VS0A 2AUGA 1M61A 1XA6A 3IMJA 3VGOA 2EU0A 1OO3A 2LRAA 2YSXA 3VRNA 1O4AA 4DGPA 3BUOB 1A09A 1M27A 4L1BB 1JWOA 1O43A 2RORA 1BLKA 5D0JA 1WQUA 2EO3A 1K9AA 3VRZA 3NHNA
chains in the Genus database with same CATH topology
4H34A 3PJPA 3VS6A 4FBNA 3BUMB 4F5BA 1BF5A 5IBMA 3K2MA 1SHAA 1AYDA 1O4DA 1GHUA 3VS4A 3VRYA 3OVEA 1LUNA 2H46E 2H5KA 1X6CA 1CJ1A 4XZ1A 1UUSA 1O4HA 1I3ZA 2SHPA 1ZFPE 1O44A 1H9OA 3US4A 1R1QA 2K79B 4FL2A 2IZVA 3BKBA 1D4TA 2BBUA 1HCTB 2MRKA 1O45A 4EY0A 1TCEA 2LNWA 5DC0B 2L4KA 1O4JA 3OV1A 4JEGA 4LUDA 1A1AA 1OO4A 3TKZA 2C9WA 3T04A 2MC1A 1FU5A 1AOTF 1O4LA 2HUWA 3OB2B 3WA4A 1CSZA 1KA7A 2QMSA 3PFVA 1SKJA 3VRRA 1O4IA 1O4CA 1FBZA 1X27A 3IN7A 1QCFA 5EHPA 2LQWA 2EKXA 3BUXB 3VS7A 3PLFB 2RMXA 1LUIA 5J3XA 2L6KA 2PLEA 1O4NA 3BUNB 3MXYA 3EAZA 2DX0A 2FCIA 3TL0A 1AD5A 1D1ZA 3MAZA 1A1CA 3VROA 2CI9A 3N8MA 1AYCA 4JGHA 1MW4A 1A07A 5EG3B 1FU6A 1TZEE 3PSJA 1KC2A 4K44A 2MK2A 3QWYA 4JE4A 4P9VA 2C0TA 4QSYA 4A4BA 2EO6A 3IN8A 2LNXA 2DLZA 4NWFA 1BM2A 1O4FA 1G83A 3HHMB 2H8HA 2CS0A 2C0IA 1BHHB 2DLYA 2CBLA 4OHEA 4D8KA 1LKLA 1GRIA 1B47A 2Y1MA 3S8OA 5DC9A 4H1OA 4NWGA 1A1EA 1JYQA 4TZIA 2AOAA 2K7AB 1BG1A 1BFIA 4P9ZA 1JYUA 1KA6A 1BFJA 1O47A 2ETZA 3GXWA 3CXLA 4K2RA 4M4ZA 2C0OA 5GJIA 2PLDA 5EHRA 1O46A 4GWFA 4OHDA 1NZVA 1IJRA 2DCRA 3S8LA 1QADA 4F5AA 3PSKA 3OP0A 3VS5A 4ROJA 4E68A 4DGXA 1UURA 1FMKA 2EYVA 5DF6A 1O4GA 4OHIA 1LUKA 4EIHA 1OPLA 1AB2A 1A1BA 3C7IA 3UYOA 5HKYA 3UF4A 1FHSA 2EOBA 2GE9A 2IUHA 1AYAA 2Y1NA 4K45A 3VS3A 2Y3AB 1Y1UA 5AXIA 2PTKA 1BKLA 1FYRA 2FO0A 4U1PA 1SPRA 2LQNA 2OZOA 1O41A 1MILA 2CRHA 1Y57A 1BHHA 2DVJA 3N7YA 2ABLA 3N84A 1BKMA 2L3TA 1AYBA 5I6VA 1YVHA 1FBVA 2CR4A 1O4EA 1JYRA 3HIZB 4OHHA 5CDWA 2MRJA 5BO4A 3QWXX 3VRPA 5HKWA 1LKKA 1JU5A 2ECDA 4F59A 1O42A 1O4KA 2IUIA 2HDVA 1O48A 3M7FA 4OHLA 1O4BA 1QG1E 1O4OA 1Z3KA 1NZLA 1R1PA 1BMBA 2PNAA 2HDXA 5DC4A 2KNOA 3CD3A 3GXXA 5GJHA 5EELA 2RVFA 1RPYA 1O4RA 1A08A 3VS1A 3VS2A 1RJAA 2AOBA 2HCKA 3PS5A 1KSWA 2JYQA 3S9KA 1YVLA 4GL9E 4A4CA 3VRQA 2RSYA 1OPKA 2EYZA 1AOUF 1CWDL 2MQIA 5AULA 3EACA 1O4PA 3IMDA 4FL3A 1P13A 2CIAA 2DM0A 5IBSA 1IS0A 1LCJA 4E93A 4GPLB 4X6SA 1X0NA 2GSBA 1BHFA 1CWEA 1F1WA 3ZNIA 2XP1A 2VIFA 1PICA 1O4MA 1O49A 1RQQC 2OQ1A 2B3OA 1CSYA 4WWQA 3MXCA 3BUWB 1LCKA 2KK6A 3OB1B 5KAZA 4K11A 2PNBA 1O4QA 3KFJA 1HCSB 5HKZA 3PQZA 2SRCA 2EL8A 3CWGA 3CBLA 1NRVA 1SHBA 2EYYA 1LUMA 1R1SA 3GQIB 3HCKA 3S8NA 2HMHA 2CI8A 1D4WA 4XZ0A 1SHDA 4U17A 1F2FA 2IUGA 5EEQA 2YU7A 1SPSA 1A81A 2LCTA 4LUEA 1BLJA 3VS0A 2AUGA 1M61A 1XA6A 3IMJA 3VGOA 2EU0A 1OO3A 2YSXA 3VRNA 1O4AA 4DGPA 3BUOB 1A09A 1M27A 4L1BB 1JWOA 1O43A 2RORA 1BLKA 5D0JA 1WQUA 2EO3A 1K9AA 3VRZA 3NHNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H34 A;  3PJP A;  3VS6 A;  4FBN A;  3BUM B;  4F5B A;  1BF5 A;  5IBM A;  3K2M A;  1SHA A;  1AYD A;  1O4D A;  1GHU A;  3VS4 A;  3VRY A;  3OVE A;  1LUN A;  2H46 E;  2H5K A;  1X6C A;  1CJ1 A;  4XZ1 A;  1UUS A;  1O4H A;  1I3Z A;  2SHP A;  1ZFP E;  1O44 A;  1H9O A;  3US4 A;  1R1Q A;  2K79 B;  4FL2 A;  2IZV A;  3BKB A;  1D4T A;  2BBU A;  1HCT B;  2MRK A;  1O45 A;  4EY0 A;  1TCE A;  2LNW A;  5DC0 B;  2L4K A;  1O4J A;  3OV1 A;  4JEG A;  4LUD A;  1A1A A;  1OO4 A;  3TKZ A;  2C9W A;  3T04 A;  2MC1 A;  1FU5 A;  1AOT F;  1O4L A;  2HUW A;  3OB2 B;  3WA4 A;  1CSZ A;  1KA7 A;  2QMS A;  3PFV A;  1SKJ A;  3VRR A;  1O4I A;  1O4C A;  1FBZ A;  1X27 A;  3IN7 A;  1QCF A;  5EHP A;  2LQW A;  2EKX A;  3BUX B;  3VS7 A;  3PLF B;  2RMX A;  1LUI A;  5J3X A;  2L6K A;  2PLE A;  1O4N A;  3BUN B;  3MXY A;  3EAZ A;  2DX0 A;  2FCI A;  3TL0 A;  1AD5 A;  1D1Z A;  3MAZ A;  1A1C A;  3VRO A;  2CI9 A;  3N8M A;  1AYC A;  4JGH A;  1MW4 A;  1A07 A;  5EG3 B;  1FU6 A;  1TZE E;  3PSJ A;  1KC2 A;  4K44 A;  2MK2 A;  3QWY A;  4JE4 A;  4P9V A;  2C0T A;  4QSY A;  4A4B A;  2EO6 A;  3IN8 A;  2LNX A;  2DLZ A;  4NWF A;  1BM2 A;  1O4F A;  1G83 A;  3HHM B;  2H8H A;  2CS0 A;  2C0I A;  1BHH B;  2DLY A;  2CBL A;  4OHE A;  4D8K A;  1LKL A;  1GRI A;  1B47 A;  2Y1M A;  3S8O A;  5DC9 A;  4H1O A;  4NWG A;  1A1E A;  1JYQ A;  4TZI A;  2AOA A;  2K7A B;  1BG1 A;  1BFI A;  4P9Z A;  1JYU A;  1KA6 A;  1BFJ A;  1O47 A;  2ETZ A;  3GXW A;  3CXL A;  4K2R A;  4M4Z A;  2C0O A;  5GJI A;  2PLD A;  5EHR A;  1O46 A;  4GWF A;  4OHD A;  1NZV A;  1IJR A;  2DCR A;  3S8L A;  1QAD A;  4F5A A;  3PSK A;  3OP0 A;  3VS5 A;  4ROJ A;  4E68 A;  4DGX A;  1UUR A;  1FMK A;  2EYV A;  5DF6 A;  1O4G A;  4OHI A;  1LUK A;  4EIH A;  1OPL A;  1AB2 A;  1A1B A;  3C7I A;  3UYO A;  5HKY A;  3UF4 A;  1FHS A;  2EOB A;  2GE9 A;  2IUH A;  1AYA A;  2Y1N A;  4K45 A;  3VS3 A;  2Y3A B;  1Y1U A;  5AXI A;  2PTK A;  1BKL A;  1FYR A;  2FO0 A;  4U1P A;  1SPR A;  2LQN A;  2OZO A;  1O41 A;  1MIL A;  2CRH A;  1Y57 A;  1BHH A;  2DVJ A;  3N7Y A;  2ABL A;  3N84 A;  1BKM A;  2L3T A;  1AYB A;  5I6V A;  1YVH A;  1FBV A;  2CR4 A;  1O4E A;  1JYR A;  3HIZ B;  4OHH A;  5CDW A;  2MRJ A;  5BO4 A;  3QWX X;  3VRP A;  5HKW A;  1LKK A;  1JU5 A;  2ECD A;  4F59 A;  1O42 A;  1O4K A;  2IUI A;  2HDV A;  1O48 A;  3M7F A;  4OHL A;  1O4B A;  1QG1 E;  1O4O A;  1Z3K A;  1NZL A;  1R1P A;  1BMB A;  2PNA A;  2HDX A;  5DC4 A;  2KNO A;  3CD3 A;  3GXX A;  5GJH A;  5EEL A;  2RVF A;  1RPY A;  1O4R A;  1A08 A;  3VS1 A;  3VS2 A;  1RJA A;  2AOB A;  2HCK A;  3PS5 A;  1KSW A;  2JYQ A;  3S9K A;  1YVL A;  4GL9 E;  4A4C A;  3VRQ A;  2RSY A;  1OPK A;  2EYZ A;  1AOU F;  1CWD L;  2MQI A;  5AUL A;  3EAC A;  1O4P A;  3IMD A;  4FL3 A;  1P13 A;  2CIA A;  2DM0 A;  5IBS A;  1IS0 A;  1LCJ A;  4E93 A;  4GPL B;  4X6S A;  1X0N A;  2GSB A;  1BHF A;  1CWE A;  1F1W A;  3ZNI A;  2XP1 A;  2VIF A;  1PIC A;  1O4M A;  1O49 A;  1RQQ C;  2OQ1 A;  2B3O A;  1CSY A;  4WWQ A;  3MXC A;  3BUW B;  1LCK A;  2KK6 A;  3OB1 B;  5KAZ A;  4K11 A;  2PNB A;  1O4Q A;  3KFJ A;  1HCS B;  5HKZ A;  3PQZ A;  2SRC A;  2EL8 A;  3CWG A;  3CBL A;  1NRV A;  1SHB A;  2EYY A;  1LUM A;  1R1S A;  3GQI B;  3HCK A;  3S8N A;  2HMH A;  2CI8 A;  1D4W A;  4XZ0 A;  1SHD A;  4U17 A;  1F2F A;  2IUG A;  5EEQ A;  2YU7 A;  1SPS A;  1A81 A;  2LCT A;  4LUE A;  1BLJ A;  3VS0 A;  2AUG A;  1M61 A;  1XA6 A;  3IMJ A;  3VGO A;  2EU0 A;  1OO3 A;  2YSX A;  3VRN A;  1O4A A;  4DGP A;  3BUO B;  1A09 A;  1M27 A;  4L1B B;  1JWO A;  1O43 A;  2ROR A;  1BLK A;  5D0J A;  1WQU A;  2EO3 A;  1K9A A;  3VRZ A;  3NHN A; 
#chains in the Genus database with same CATH topology
 4H34 A;  3PJP A;  3VS6 A;  4FBN A;  3BUM B;  4F5B A;  1BF5 A;  5IBM A;  3K2M A;  1SHA A;  1AYD A;  1O4D A;  1GHU A;  3VS4 A;  3VRY A;  3OVE A;  1LUN A;  2H46 E;  2H5K A;  1X6C A;  1CJ1 A;  4XZ1 A;  1UUS A;  1O4H A;  1I3Z A;  2SHP A;  1ZFP E;  1O44 A;  1H9O A;  3US4 A;  1R1Q A;  2K79 B;  4FL2 A;  2IZV A;  3BKB A;  1D4T A;  2BBU A;  1HCT B;  2MRK A;  1O45 A;  4EY0 A;  1TCE A;  2LNW A;  5DC0 B;  2L4K A;  1O4J A;  3OV1 A;  4JEG A;  4LUD A;  1A1A A;  1OO4 A;  3TKZ A;  2C9W A;  3T04 A;  2MC1 A;  1FU5 A;  1AOT F;  1O4L A;  2HUW A;  3OB2 B;  3WA4 A;  1CSZ A;  1KA7 A;  2QMS A;  3PFV A;  1SKJ A;  3VRR A;  1O4I A;  1O4C A;  1FBZ A;  1X27 A;  3IN7 A;  1QCF A;  5EHP A;  2LQW A;  2EKX A;  3BUX B;  3VS7 A;  3PLF B;  2RMX A;  1LUI A;  5J3X A;  2L6K A;  2PLE A;  1O4N A;  3BUN B;  3MXY A;  3EAZ A;  2DX0 A;  2FCI A;  3TL0 A;  1AD5 A;  1D1Z A;  3MAZ A;  1A1C A;  3VRO A;  2CI9 A;  3N8M A;  1AYC A;  4JGH A;  1MW4 A;  1A07 A;  5EG3 B;  1FU6 A;  1TZE E;  3PSJ A;  1KC2 A;  4K44 A;  2MK2 A;  3QWY A;  4JE4 A;  4P9V A;  2C0T A;  4QSY A;  2KGY A;  2EO6 A;  3IN8 A;  4A4B A;  2LNX A;  2DLZ A;  4NWF A;  1BM2 A;  1O4F A;  1G83 A;  3HHM B;  2H8H A;  2CS0 A;  2C0I A;  1BHH B;  2DLY A;  2CBL A;  4OHE A;  4D8K A;  1LKL A;  1GRI A;  1B47 A;  2Y1M A;  3S8O A;  5DC9 A;  4H1O A;  4NWG A;  1A1E A;  1JYQ A;  4TZI A;  2AOA A;  2K7A B;  1BG1 A;  1BFI A;  4P9Z A;  1JYU A;  1KA6 A;  1BFJ A;  1O47 A;  2ETZ A;  3GXW A;  3CXL A;  4K2R A;  4M4Z A;  2C0O A;  5GJI A;  2PLD A;  5EHR A;  1O46 A;  4GWF A;  4OHD A;  1NZV A;  1IJR A;  2DCR A;  3S8L A;  1QAD A;  4F5A A;  3PSK A;  3OP0 A;  3VS5 A;  4ROJ A;  4E68 A;  4DGX A;  1UUR A;  1FMK A;  2EYV A;  5DF6 A;  1O4G A;  4OHI A;  1LUK A;  3K2T A;  4EIH A;  1OPL A;  1AB2 A;  1A1B A;  3C7I A;  3UYO A;  5HKY A;  3UF4 A;  1FHS A;  2EOB A;  2GE9 A;  2IUH A;  1AYA A;  2Y1N A;  4K45 A;  3VS3 A;  2Y3A B;  1Y1U A;  5AXI A;  2PTK A;  1BKL A;  1FYR A;  2FO0 A;  4U1P A;  1SPR A;  2LQN A;  2OZO A;  1O41 A;  1MIL A;  2CRH A;  1Y57 A;  1BHH A;  2DVJ A;  3N7Y A;  2ABL A;  3N84 A;  1BKM A;  2L3T A;  1AYB A;  5I6V A;  1YVH A;  1FBV A;  2CR4 A;  1O4E A;  1JYR A;  3HIZ B;  4OHH A;  5CDW A;  2MRJ A;  5BO4 A;  3QWX X;  3VRP A;  5HKW A;  1LKK A;  1JU5 A;  2ECD A;  4F59 A;  1O42 A;  1O4K A;  2IUI A;  2HDV A;  1O48 A;  3M7F A;  4OHL A;  1O4B A;  1QG1 E;  1O4O A;  1Z3K A;  1NZL A;  1R1P A;  1BMB A;  2PNA A;  2HDX A;  5DC4 A;  2KNO A;  3CD3 A;  3GXX A;  5GJH A;  5EEL A;  2RVF A;  1RPY A;  1O4R A;  1A08 A;  3VS1 A;  3VS2 A;  1RJA A;  2AOB A;  2HCK A;  3PS5 A;  1KSW A;  2JYQ A;  3S9K A;  1YVL A;  4GL9 E;  4A4C A;  3VRQ A;  2RSY A;  1OPK A;  2EYZ A;  1AOU F;  1CWD L;  2MQI A;  5AUL A;  3EAC A;  1O4P A;  3IMD A;  4FL3 A;  1P13 A;  2CIA A;  2DM0 A;  5IBS A;  1IS0 A;  1LCJ A;  4E93 A;  4GPL B;  4X6S A;  1X0N A;  2GSB A;  1BHF A;  1CWE A;  1F1W A;  3ZNI A;  2XP1 A;  2VIF A;  1PIC A;  1O4M A;  1O49 A;  1RQQ C;  2OQ1 A;  2B3O A;  1CSY A;  4WWQ A;  3MXC A;  3LYV A;  3BUW B;  1LCK A;  2KK6 A;  3OB1 B;  5KAZ A;  4K11 A;  2PNB A;  1O4Q A;  3KFJ A;  1HCS B;  5HKZ A;  3PQZ A;  2SRC A;  2EL8 A;  3CWG A;  3CBL A;  1NRV A;  1SHB A;  2EYY A;  1LUM A;  1R1S A;  3GQI B;  3HCK A;  3S8N A;  2HMH A;  2CI8 A;  1D4W A;  4XZ0 A;  1SHD A;  4U17 A;  1F2F A;  2IUG A;  5EEQ A;  2YU7 A;  1SPS A;  1A81 A;  2LCT A;  4LUE A;  1BLJ A;  3VS0 A;  2AUG A;  1M61 A;  1XA6 A;  3IMJ A;  3VGO A;  2EU0 A;  1OO3 A;  2LRA A;  2YSX A;  3VRN A;  1O4A A;  4DGP A;  3BUO B;  1A09 A;  1M27 A;  4L1B B;  1JWO A;  1O43 A;  2ROR A;  1BLK A;  5D0J A;  1WQU A;  2EO3 A;  1K9A A;  3VRZ A;  3NHN A; 
#chains in the Genus database with same CATH homology
 4H34 A;  3PJP A;  3VS6 A;  4FBN A;  3BUM B;  4F5B A;  1BF5 A;  5IBM A;  3K2M A;  1SHA A;  1AYD A;  1O4D A;  1GHU A;  3VS4 A;  3VRY A;  3OVE A;  1LUN A;  2H46 E;  2H5K A;  1X6C A;  1CJ1 A;  4XZ1 A;  1UUS A;  1O4H A;  1I3Z A;  2SHP A;  1ZFP E;  1O44 A;  1H9O A;  3US4 A;  1R1Q A;  2K79 B;  4FL2 A;  2IZV A;  3BKB A;  1D4T A;  2BBU A;  1HCT B;  2MRK A;  1O45 A;  4EY0 A;  1TCE A;  2LNW A;  5DC0 B;  2L4K A;  1O4J A;  3OV1 A;  4JEG A;  4LUD A;  1A1A A;  1OO4 A;  3TKZ A;  2C9W A;  3T04 A;  2MC1 A;  1FU5 A;  1AOT F;  1O4L A;  2HUW A;  3OB2 B;  3WA4 A;  1CSZ A;  1KA7 A;  2QMS A;  3PFV A;  1SKJ A;  3VRR A;  1O4I A;  1O4C A;  1FBZ A;  1X27 A;  3IN7 A;  1QCF A;  5EHP A;  2LQW A;  2EKX A;  3BUX B;  3VS7 A;  3PLF B;  2RMX A;  1LUI A;  5J3X A;  2L6K A;  2PLE A;  1O4N A;  3BUN B;  3MXY A;  3EAZ A;  2DX0 A;  2FCI A;  3TL0 A;  1AD5 A;  1D1Z A;  3MAZ A;  1A1C A;  3VRO A;  2CI9 A;  3N8M A;  1AYC A;  4JGH A;  1MW4 A;  1A07 A;  5EG3 B;  1FU6 A;  1TZE E;  3PSJ A;  1KC2 A;  4K44 A;  2MK2 A;  3QWY A;  4JE4 A;  4P9V A;  2C0T A;  4QSY A;  4A4B A;  2EO6 A;  3IN8 A;  2LNX A;  2DLZ A;  4NWF A;  1BM2 A;  1O4F A;  1G83 A;  3HHM B;  2H8H A;  2CS0 A;  2C0I A;  1BHH B;  2DLY A;  2CBL A;  4OHE A;  4D8K A;  1LKL A;  1GRI A;  1B47 A;  2Y1M A;  3S8O A;  5DC9 A;  4H1O A;  4NWG A;  1A1E A;  1JYQ A;  4TZI A;  2AOA A;  2K7A B;  1BG1 A;  1BFI A;  4P9Z A;  1JYU A;  1KA6 A;  1BFJ A;  1O47 A;  2ETZ A;  3GXW A;  3CXL A;  4K2R A;  4M4Z A;  2C0O A;  5GJI A;  2PLD A;  5EHR A;  1O46 A;  4GWF A;  4OHD A;  1NZV A;  1IJR A;  2DCR A;  3S8L A;  1QAD A;  4F5A A;  3PSK A;  3OP0 A;  3VS5 A;  4ROJ A;  4E68 A;  4DGX A;  1UUR A;  1FMK A;  2EYV A;  5DF6 A;  1O4G A;  4OHI A;  1LUK A;  4EIH A;  1OPL A;  1AB2 A;  1A1B A;  3C7I A;  3UYO A;  5HKY A;  3UF4 A;  1FHS A;  2EOB A;  2GE9 A;  2IUH A;  1AYA A;  2Y1N A;  4K45 A;  3VS3 A;  2Y3A B;  1Y1U A;  5AXI A;  2PTK A;  1BKL A;  1FYR A;  2FO0 A;  4U1P A;  1SPR A;  2LQN A;  2OZO A;  1O41 A;  1MIL A;  2CRH A;  1Y57 A;  1BHH A;  2DVJ A;  3N7Y A;  2ABL A;  3N84 A;  1BKM A;  2L3T A;  1AYB A;  5I6V A;  1YVH A;  1FBV A;  2CR4 A;  1O4E A;  1JYR A;  3HIZ B;  4OHH A;  5CDW A;  2MRJ A;  5BO4 A;  3QWX X;  3VRP A;  5HKW A;  1LKK A;  1JU5 A;  2ECD A;  4F59 A;  1O42 A;  1O4K A;  2IUI A;  2HDV A;  1O48 A;  3M7F A;  4OHL A;  1O4B A;  1QG1 E;  1O4O A;  1Z3K A;  1NZL A;  1R1P A;  1BMB A;  2PNA A;  2HDX A;  5DC4 A;  2KNO A;  3CD3 A;  3GXX A;  5GJH A;  5EEL A;  2RVF A;  1RPY A;  1O4R A;  1A08 A;  3VS1 A;  3VS2 A;  1RJA A;  2AOB A;  2HCK A;  3PS5 A;  1KSW A;  2JYQ A;  3S9K A;  1YVL A;  4GL9 E;  4A4C A;  3VRQ A;  2RSY A;  1OPK A;  2EYZ A;  1AOU F;  1CWD L;  2MQI A;  5AUL A;  3EAC A;  1O4P A;  3IMD A;  4FL3 A;  1P13 A;  2CIA A;  2DM0 A;  5IBS A;  1IS0 A;  1LCJ A;  4E93 A;  4GPL B;  4X6S A;  1X0N A;  2GSB A;  1BHF A;  1CWE A;  1F1W A;  3ZNI A;  2XP1 A;  2VIF A;  1PIC A;  1O4M A;  1O49 A;  1RQQ C;  2OQ1 A;  2B3O A;  1CSY A;  4WWQ A;  3MXC A;  3BUW B;  1LCK A;  2KK6 A;  3OB1 B;  5KAZ A;  4K11 A;  2PNB A;  1O4Q A;  3KFJ A;  1HCS B;  5HKZ A;  3PQZ A;  2SRC A;  2EL8 A;  3CWG A;  3CBL A;  1NRV A;  1SHB A;  2EYY A;  1LUM A;  1R1S A;  3GQI B;  3HCK A;  3S8N A;  2HMH A;  2CI8 A;  1D4W A;  4XZ0 A;  1SHD A;  4U17 A;  1F2F A;  2IUG A;  5EEQ A;  2YU7 A;  1SPS A;  1A81 A;  2LCT A;  4LUE A;  1BLJ A;  3VS0 A;  2AUG A;  1M61 A;  1XA6 A;  3IMJ A;  3VGO A;  2EU0 A;  1OO3 A;  2YSX A;  3VRN A;  1O4A A;  4DGP A;  3BUO B;  1A09 A;  1M27 A;  4L1B B;  1JWO A;  1O43 A;  2ROR A;  1BLK A;  5D0J A;  1WQU A;  2EO3 A;  1K9A A;  3VRZ A;  3NHN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...