4FLIA

Human metap1 with bengamide analog y16, in mn form
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
304
structure length
304
Chain Sequence
YRYTGKLRPHYPLMPTRPVPSYIQRPDYADHPLGMSESEQALKGTSQIKLLSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCYPSPLNYYNFPKSCCTSVNEVICHGIPDRRPLQEGDIVNVDITLYRNGYHGDLNETFFVGEVDDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQANGFSVVRSYCGHGIHKLFHTAPNVPHYAKNKAVGVMKSGHVFTIEPMICEGGWQDETWPDGWTAVTRDGKRSAQFEHTLLVTDTGCEILTRRLDSARPHFMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of bengamide derivatives as inhibitors of methionine aminopeptidases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Methionine aminopeptidase 1
total genus 100
structure length 304
sequence length 304
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2012-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 4fliA00
1M35A 1YW7A 4U6ZA 4S2RP 4FLJA 3IU8A 1WL6A 2B3LA 3BIQA 2BHAA 4FO8A 2GU4A 3L7GA 1MATA 5D6FA 5D6EA 2ZSGA 1YVMA 3CTZA 3PKEA 4IPAA 2V3YA 1C21A 4A6VA 3BIPA 4FO7A 1KP0A 4S01A 1XGMA 2MATA 1B59A 2GZ5A 1W2MA 4U71A 1YW8A 2BH3A 2GG7A 2HOWA 3CB6A 2GG9A 4ZWOA 2BWVA 3CB5A 2ADUA 1QXZA 2BHCA 4IKUA 2Q93A 3RORA 2NQ7A 5CLSA 2Q96A 4IKRA 5CNXA 4A6WA 4Z7MA 1WKMA 4U6WA 4S2TP 5CDEA 1WBQA 3PKAA 4U6CA 1C27A 4U70A 5CDVA 1C24A 2GG8A 4IECA 2BN7A 4RGZ1 4RZZA 3FMRA 4IDYA 1CHMA 5JFRA 2EVMA 5CIKA 1KQ9A 2DFIA 1XNZA 2GG3A 4QR8A 1WLRA 4IF7A 1BN5A 5CDLA 1BOAA 4B28A 4ZWPA 2BWYA 4FUKA 4IKTA 3L24A 3FMQA 3MR1A 3MATA 5CE6A 2GG0A 1YW9A 4FLIA 4U6EA 1WN1A 4HXXA 1N51A 2EA4A 4U69A 1R5GA 4RZYA 4ZNGA 1WY2A 2G6PA 2BWXA 4MATA 3S6BA 4FLLA 2V6CA 4R60A 3BITA 1QXWA 3PKDA 4PV4A 4PNCA 1PV9A 2IW2A 1W7VA 2BWSA 3IU9A 4U1BA 2OAZA 2GG2A 3RVAA 1C23A 2BB7A 4ZWUA 1XGSA 2Q94A 2EVOA 2B3KA 3IU7A 2GU7A 4FKCA 4IU6A 2V3XA 4U73A 3PKCA 5FCHA 2GU6A 3Q6DA 4U75A 1Y1NA 2BHBA 4S00A 5E5BA 3PKBA 3FM3A 2GG5A 1C22A 1B6AA 2Q8KA 2BHDA 5JI6A 2EVCA 1XGOA 2GA2A 2Q92A 2BWUA 2BWTA 3IG4A 5FCFA 2Q95A 1WL9A 2EA2A 1R5HA 4KM3A 2OKNA 2P9AA 2B3HA 4U76A 3TB5A 2BWWA 2GGCA 2GGBA 2P99A 1XGNA 3MX6A 4U6JA 2GTXA 2P98A 1QZYA 2NQ6A 1A16A 3TAVA 4FLKA 5JHUA 1KQ0A 1QXYA 1R58A 1JAWA 1YJ3A 2GU5A 1O0XA 2V3ZA 4JUQA 4OOKA 4IKSA 4EGEA 3D27A
chains in the Genus database with same CATH superfamily
1M35A 1YW7A 4U6ZA 4S2RP 4FLJA 3IU8A 1WL6A 2B3LA 3BIQA 2BHAA 4FO8A 2GU4A 3L7GA 1MATA 5D6FA 5D6EA 2ZSGA 1YVMA 3CTZA 3PKEA 4IPAA 2V3YA 1C21A 4A6VA 3BIPA 4FO7A 1KP0A 4S01A 1XGMA 2MATA 1B59A 2GZ5A 1W2MA 4U71A 1YW8A 2BH3A 2GG7A 2HOWA 3CB6A 2GG9A 4ZWOA 2BWVA 3CB5A 2ADUA 1QXZA 2BHCA 4IKUA 2Q93A 3RORA 2NQ7A 5CLSA 2Q96A 4IKRA 5CNXA 4A6WA 4Z7MA 1WKMA 4U6WA 4S2TP 5CDEA 1WBQA 3PKAA 4U6CA 1C27A 4U70A 5CDVA 1C24A 2GG8A 4IECA 2BN7A 4RGZ1 4RZZA 3FMRA 4IDYA 1CHMA 5JFRA 2EVMA 5CIKA 1KQ9A 2DFIA 1XNZA 2GG3A 4QR8A 1WLRA 4IF7A 1BN5A 5CDLA 1BOAA 4B28A 4ZWPA 2BWYA 4FUKA 4IKTA 3L24A 3FMQA 3MR1A 3MATA 5CE6A 2GG0A 1YW9A 4FLIA 4U6EA 1WN1A 4HXXA 1N51A 2EA4A 4U69A 1R5GA 4RZYA 4ZNGA 1WY2A 2G6PA 2BWXA 4MATA 3S6BA 4FLLA 2V6CA 4R60A 3BITA 1QXWA 3PKDA 4PV4A 4PNCA 1PV9A 2IW2A 1W7VA 2BWSA 3IU9A 4U1BA 2OAZA 2GG2A 3RVAA 1C23A 2BB7A 4ZWUA 1XGSA 2Q94A 2EVOA 2B3KA 3IU7A 2GU7A 4FKCA 4IU6A 2V3XA 4U73A 3PKCA 5FCHA 2GU6A 3Q6DA 4U75A 1Y1NA 2BHBA 4S00A 5E5BA 3PKBA 3FM3A 2GG5A 1C22A 1B6AA 2Q8KA 2BHDA 5JI6A 2EVCA 1XGOA 2GA2A 2Q92A 2BWUA 2BWTA 3IG4A 5FCFA 2Q95A 1WL9A 2EA2A 1R5HA 4KM3A 2OKNA 2P9AA 2B3HA 4U76A 3TB5A 2BWWA 2GGCA 2GGBA 2P99A 1XGNA 3MX6A 4U6JA 2GTXA 2P98A 1QZYA 2NQ6A 1A16A 3TAVA 4FLKA 5JHUA 1KQ0A 1QXYA 1R58A 1JAWA 1YJ3A 2GU5A 1O0XA 2V3ZA 4JUQA 4OOKA 4IKSA 4EGEA 3D27A
chains in the Genus database with same CATH topology
1M35A 1YW7A 4U6ZA 4S2RP 4FLJA 3IU8A 1WL6A 2B3LA 3BIQA 2BHAA 4FO8A 2GU4A 3L7GA 1MATA 5D6FA 5D6EA 2ZSGA 1YVMA 3CTZA 3PKEA 4IPAA 2V3YA 1C21A 4A6VA 3BIPA 4FO7A 1KP0A 4S01A 1XGMA 2MATA 1B59A 2GZ5A 1W2MA 4U71A 1YW8A 2BH3A 2GG7A 2HOWA 3CB6A 2GG9A 4ZWOA 2BWVA 3CB5A 2ADUA 1QXZA 2BHCA 4IKUA 2Q93A 3RORA 2NQ7A 5CLSA 2Q96A 4IKRA 5CNXA 4A6WA 4Z7MA 1WKMA 4U6WA 4S2TP 5CDEA 1WBQA 3PKAA 4U6CA 1C27A 4U70A 5CDVA 1C24A 2GG8A 4IECA 2BN7A 4RGZ1 4RZZA 3FMRA 4IDYA 1CHMA 5JFRA 2EVMA 5CIKA 1KQ9A 2DFIA 1XNZA 2GG3A 4QR8A 1WLRA 4IF7A 1BN5A 5CDLA 1BOAA 4B28A 4ZWPA 2BWYA 4FUKA 4IKTA 3L24A 3FMQA 3MR1A 3MATA 5CE6A 2GG0A 1YW9A 4FLIA 4U6EA 1WN1A 4HXXA 1N51A 2EA4A 4U69A 1R5GA 4RZYA 4ZNGA 1WY2A 2G6PA 2BWXA 4MATA 3S6BA 4FLLA 2V6CA 4R60A 3BITA 1QXWA 3PKDA 4PV4A 4PNCA 1PV9A 2IW2A 1W7VA 2BWSA 3IU9A 4U1BA 2OAZA 2GG2A 3RVAA 1C23A 2BB7A 4ZWUA 1XGSA 2Q94A 2EVOA 2B3KA 3IU7A 2GU7A 4FKCA 4IU6A 2V3XA 4U73A 3PKCA 5FCHA 2GU6A 3Q6DA 4U75A 1Y1NA 2BHBA 4S00A 5E5BA 3PKBA 3FM3A 2GG5A 1C22A 1B6AA 2Q8KA 2BHDA 5JI6A 2EVCA 1XGOA 2GA2A 2Q92A 2BWUA 2BWTA 3IG4A 5FCFA 2Q95A 1WL9A 2EA2A 1R5HA 4KM3A 2OKNA 2P9AA 2B3HA 4U76A 3TB5A 2BWWA 2GGCA 2GGBA 2P99A 1XGNA 3MX6A 4U6JA 2GTXA 2P98A 1QZYA 2NQ6A 1A16A 3TAVA 4FLKA 5JHUA 1KQ0A 1QXYA 1R58A 1JAWA 1YJ3A 2GU5A 1O0XA 2V3ZA 4JUQA 4OOKA 4IKSA 4EGEA 3D27A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M35 A;  1YW7 A;  4U6Z A;  4S2R P;  4FLJ A;  3IU8 A;  1WL6 A;  2B3L A;  3BIQ A;  2BHA A;  4FO8 A;  2GU4 A;  3L7G A;  1MAT A;  5D6F A;  5D6E A;  2ZSG A;  1YVM A;  3CTZ A;  3PKE A;  4IPA A;  2V3Y A;  1C21 A;  4A6V A;  3BIP A;  4FO7 A;  1KP0 A;  4S01 A;  1XGM A;  2MAT A;  1B59 A;  2GZ5 A;  1W2M A;  4U71 A;  1YW8 A;  2BH3 A;  2GG7 A;  2HOW A;  3CB6 A;  2GG9 A;  4ZWO A;  2BWV A;  3CB5 A;  2ADU A;  1QXZ A;  2BHC A;  4IKU A;  2Q93 A;  3ROR A;  2NQ7 A;  5CLS A;  2Q96 A;  4IKR A;  5CNX A;  4A6W A;  4Z7M A;  1WKM A;  4U6W A;  4S2T P;  5CDE A;  1WBQ A;  3PKA A;  4U6C A;  1C27 A;  4U70 A;  5CDV A;  1C24 A;  2GG8 A;  4IEC A;  2BN7 A;  4RGZ 1;  4RZZ A;  3FMR A;  4IDY A;  1CHM A;  5JFR A;  2EVM A;  5CIK A;  1KQ9 A;  2DFI A;  1XNZ A;  2GG3 A;  4QR8 A;  1WLR A;  4IF7 A;  1BN5 A;  5CDL A;  1BOA A;  4B28 A;  4ZWP A;  2BWY A;  4FUK A;  4IKT A;  3L24 A;  3FMQ A;  3MR1 A;  3MAT A;  5CE6 A;  2GG0 A;  1YW9 A;  4FLI A;  4U6E A;  1WN1 A;  4HXX A;  1N51 A;  2EA4 A;  4U69 A;  1R5G A;  4RZY A;  4ZNG A;  1WY2 A;  2G6P A;  2BWX A;  4MAT A;  3S6B A;  4FLL A;  2V6C A;  4R60 A;  3BIT A;  1QXW A;  3PKD A;  4PV4 A;  4PNC A;  1PV9 A;  2IW2 A;  1W7V A;  2BWS A;  3IU9 A;  4U1B A;  2OAZ A;  2GG2 A;  3RVA A;  1C23 A;  2BB7 A;  4ZWU A;  1XGS A;  2Q94 A;  2EVO A;  2B3K A;  3IU7 A;  2GU7 A;  4FKC A;  4IU6 A;  2V3X A;  4U73 A;  3PKC A;  5FCH A;  2GU6 A;  3Q6D A;  4U75 A;  1Y1N A;  2BHB A;  4S00 A;  5E5B A;  3PKB A;  3FM3 A;  2GG5 A;  1C22 A;  1B6A A;  2Q8K A;  2BHD A;  5JI6 A;  2EVC A;  1XGO A;  2GA2 A;  2Q92 A;  2BWU A;  2BWT A;  3IG4 A;  5FCF A;  2Q95 A;  1WL9 A;  2EA2 A;  1R5H A;  4KM3 A;  2OKN A;  2P9A A;  2B3H A;  4U76 A;  3TB5 A;  2BWW A;  2GGC A;  2GGB A;  2P99 A;  1XGN A;  3MX6 A;  4U6J A;  2GTX A;  2P98 A;  1QZY A;  2NQ6 A;  1A16 A;  3TAV A;  4FLK A;  5JHU A;  1KQ0 A;  1QXY A;  1R58 A;  1JAW A;  1YJ3 A;  2GU5 A;  1O0X A;  2V3Z A;  4JUQ A;  4OOK A;  4IKS A;  4EGE A;  3D27 A; 
#chains in the Genus database with same CATH topology
 1M35 A;  1YW7 A;  4U6Z A;  4S2R P;  4FLJ A;  3IU8 A;  1WL6 A;  2B3L A;  3BIQ A;  2BHA A;  4FO8 A;  2GU4 A;  3L7G A;  1MAT A;  5D6F A;  5D6E A;  2ZSG A;  1YVM A;  3CTZ A;  3PKE A;  4IPA A;  2V3Y A;  1C21 A;  4A6V A;  3BIP A;  4FO7 A;  1KP0 A;  4S01 A;  1XGM A;  2MAT A;  1B59 A;  2GZ5 A;  1W2M A;  4U71 A;  1YW8 A;  2BH3 A;  2GG7 A;  2HOW A;  3CB6 A;  2GG9 A;  4ZWO A;  2BWV A;  3CB5 A;  2ADU A;  1QXZ A;  2BHC A;  4IKU A;  2Q93 A;  3ROR A;  2NQ7 A;  5CLS A;  2Q96 A;  4IKR A;  5CNX A;  4A6W A;  4Z7M A;  1WKM A;  4U6W A;  4S2T P;  5CDE A;  1WBQ A;  3PKA A;  4U6C A;  1C27 A;  4U70 A;  5CDV A;  1C24 A;  2GG8 A;  4IEC A;  2BN7 A;  4RGZ 1;  4RZZ A;  3FMR A;  4IDY A;  1CHM A;  5JFR A;  2EVM A;  5CIK A;  1KQ9 A;  2DFI A;  1XNZ A;  2GG3 A;  4QR8 A;  1WLR A;  4IF7 A;  1BN5 A;  5CDL A;  1BOA A;  4B28 A;  4ZWP A;  2BWY A;  4FUK A;  4IKT A;  3L24 A;  3FMQ A;  3MR1 A;  3MAT A;  5CE6 A;  2GG0 A;  1YW9 A;  4FLI A;  4U6E A;  1WN1 A;  4HXX A;  1N51 A;  2EA4 A;  4U69 A;  1R5G A;  4RZY A;  4ZNG A;  1WY2 A;  2G6P A;  2BWX A;  4MAT A;  3S6B A;  4FLL A;  2V6C A;  4R60 A;  3BIT A;  1QXW A;  3PKD A;  4PV4 A;  4PNC A;  1PV9 A;  2IW2 A;  1W7V A;  2BWS A;  3IU9 A;  4U1B A;  2OAZ A;  2GG2 A;  3RVA A;  1C23 A;  2BB7 A;  4ZWU A;  1XGS A;  2Q94 A;  2EVO A;  2B3K A;  3IU7 A;  2GU7 A;  4FKC A;  4IU6 A;  2V3X A;  4U73 A;  3PKC A;  5FCH A;  2GU6 A;  3Q6D A;  4U75 A;  1Y1N A;  2BHB A;  4S00 A;  5E5B A;  3PKB A;  3FM3 A;  2GG5 A;  1C22 A;  1B6A A;  2Q8K A;  2BHD A;  5JI6 A;  2EVC A;  1XGO A;  2GA2 A;  2Q92 A;  2BWU A;  2BWT A;  3IG4 A;  5FCF A;  2Q95 A;  1WL9 A;  2EA2 A;  1R5H A;  4KM3 A;  2OKN A;  2P9A A;  2B3H A;  4U76 A;  3TB5 A;  2BWW A;  2GGC A;  2GGB A;  2P99 A;  1XGN A;  3MX6 A;  4U6J A;  2GTX A;  2P98 A;  1QZY A;  2NQ6 A;  1A16 A;  3TAV A;  4FLK A;  5JHU A;  1KQ0 A;  1QXY A;  1R58 A;  1JAW A;  1YJ3 A;  2GU5 A;  1O0X A;  2V3Z A;  4JUQ A;  4OOK A;  4IKS A;  4EGE A;  3D27 A; 
#chains in the Genus database with same CATH homology
 1M35 A;  1YW7 A;  4U6Z A;  4S2R P;  4FLJ A;  3IU8 A;  1WL6 A;  2B3L A;  3BIQ A;  2BHA A;  4FO8 A;  2GU4 A;  3L7G A;  1MAT A;  5D6F A;  5D6E A;  2ZSG A;  1YVM A;  3CTZ A;  3PKE A;  4IPA A;  2V3Y A;  1C21 A;  4A6V A;  3BIP A;  4FO7 A;  1KP0 A;  4S01 A;  1XGM A;  2MAT A;  1B59 A;  2GZ5 A;  1W2M A;  4U71 A;  1YW8 A;  2BH3 A;  2GG7 A;  2HOW A;  3CB6 A;  2GG9 A;  4ZWO A;  2BWV A;  3CB5 A;  2ADU A;  1QXZ A;  2BHC A;  4IKU A;  2Q93 A;  3ROR A;  2NQ7 A;  5CLS A;  2Q96 A;  4IKR A;  5CNX A;  4A6W A;  4Z7M A;  1WKM A;  4U6W A;  4S2T P;  5CDE A;  1WBQ A;  3PKA A;  4U6C A;  1C27 A;  4U70 A;  5CDV A;  1C24 A;  2GG8 A;  4IEC A;  2BN7 A;  4RGZ 1;  4RZZ A;  3FMR A;  4IDY A;  1CHM A;  5JFR A;  2EVM A;  5CIK A;  1KQ9 A;  2DFI A;  1XNZ A;  2GG3 A;  4QR8 A;  1WLR A;  4IF7 A;  1BN5 A;  5CDL A;  1BOA A;  4B28 A;  4ZWP A;  2BWY A;  4FUK A;  4IKT A;  3L24 A;  3FMQ A;  3MR1 A;  3MAT A;  5CE6 A;  2GG0 A;  1YW9 A;  4FLI A;  4U6E A;  1WN1 A;  4HXX A;  1N51 A;  2EA4 A;  4U69 A;  1R5G A;  4RZY A;  4ZNG A;  1WY2 A;  2G6P A;  2BWX A;  4MAT A;  3S6B A;  4FLL A;  2V6C A;  4R60 A;  3BIT A;  1QXW A;  3PKD A;  4PV4 A;  4PNC A;  1PV9 A;  2IW2 A;  1W7V A;  2BWS A;  3IU9 A;  4U1B A;  2OAZ A;  2GG2 A;  3RVA A;  1C23 A;  2BB7 A;  4ZWU A;  1XGS A;  2Q94 A;  2EVO A;  2B3K A;  3IU7 A;  2GU7 A;  4FKC A;  4IU6 A;  2V3X A;  4U73 A;  3PKC A;  5FCH A;  2GU6 A;  3Q6D A;  4U75 A;  1Y1N A;  2BHB A;  4S00 A;  5E5B A;  3PKB A;  3FM3 A;  2GG5 A;  1C22 A;  1B6A A;  2Q8K A;  2BHD A;  5JI6 A;  2EVC A;  1XGO A;  2GA2 A;  2Q92 A;  2BWU A;  2BWT A;  3IG4 A;  5FCF A;  2Q95 A;  1WL9 A;  2EA2 A;  1R5H A;  4KM3 A;  2OKN A;  2P9A A;  2B3H A;  4U76 A;  3TB5 A;  2BWW A;  2GGC A;  2GGB A;  2P99 A;  1XGN A;  3MX6 A;  4U6J A;  2GTX A;  2P98 A;  1QZY A;  2NQ6 A;  1A16 A;  3TAV A;  4FLK A;  5JHU A;  1KQ0 A;  1QXY A;  1R58 A;  1JAW A;  1YJ3 A;  2GU5 A;  1O0X A;  2V3Z A;  4JUQ A;  4OOK A;  4IKS A;  4EGE A;  3D27 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...