4FLJA

Human metap1 with bengamide analog y08, in mn form
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
304
structure length
304
Chain Sequence
YRYTGKLRPHYPLMPTRPVPSYIQRPDYADHPLGMSESEQALKGTSQIKLLSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCYPSPLNYYNFPKSCCTSVNEVICHGIPDRRPLQEGDIVNVDITLYRNGYHGDLNETFFVGEVDDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQANGFSVVRSYCGHGIHKLFHTAPNVPHYAKNKAVGVMKSGHVFTIEPMICEGGWQDETWPDGWTAVTRDGKRSAQFEHTLLVTDTGCEILTRRLDSARPHFMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of bengamide derivatives as inhibitors of methionine aminopeptidases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Methionine aminopeptidase 1
total genus 99
structure length 304
sequence length 304
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2012-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 4fljA00
1WL9A 4U6WA 3CB5A 2HOWA 3BIQA 4PV4A 4JUQA 4A6VA 2GG7A 1CHMA 4QR8A 3RORA 2Q92A 5FCHA 1XGNA 5JHUA 5CDEA 2P98A 4FUKA 4RGZ1 3MR1A 2EVMA 2BHDA 3PKDA 1WY2A 3BIPA 1O0XA 4Z7MA 2BWXA 2GG5A 2EA4A 1XGOA 1QXYA 4FO7A 1XGMA 4FLJA 4OOKA 1WKMA 5CNXA 2OAZA 2MATA 4U70A 4IKUA 4U69A 4S01A 4ZWPA 2BH3A 5CIKA 2BB7A 2GU6A 2V3ZA 3MATA 2NQ6A 2G6PA 4FLLA 1N51A 1WBQA 4U71A 4EGEA 3L24A 1YW7A 4U6ZA 2GU5A 1C23A 1WL6A 3FMRA 3CTZA 1R58A 2OKNA 1A16A 2Q93A 2GGCA 2GTXA 1YW8A 4U75A 3BITA 3S6BA 2GG9A 1W7VA 2BWSA 2ZSGA 2Q94A 3IU7A 3TB5A 4U1BA 2BN7A 4IDYA 5FCFA 2IW2A 2Q8KA 2GG2A 4IU6A 3MX6A 1XNZA 4B28A 4ZWOA 4S00A 1R5HA 3PKEA 4FO8A 1C27A 1R5GA 3IU8A 3D27A 2BWWA 2BWTA 2GG8A 1Y1NA 2GG3A 4IKRA 1QXWA 1XGSA 5E5BA 2BWUA 2EVOA 2V3YA 4IECA 4U6EA 2BHBA 2B3HA 3IU9A 2NQ7A 4MATA 5D6EA 2P9AA 4S2TP 2GU4A 4RZZA 1PV9A 1WN1A 2GZ5A 5CLSA 3PKBA 2B3LA 4IKTA 1C24A 3PKAA 1M35A 1QZYA 4FLKA 2EVCA 4PNCA 1W2MA 2DFIA 1BN5A 3L7GA 2BHAA 2GGBA 2BWYA 4FKCA 1C22A 2GG0A 5CDVA 4R60A 4IPAA 1MATA 5D6FA 5JFRA 3PKCA 1WLRA 3FM3A 4U6CA 1KQ0A 4U6JA 2ADUA 3Q6DA 1B59A 3CB6A 1YW9A 4FLIA 4ZNGA 4U76A 2BHCA 5JI6A 2B3KA 2P99A 5CE6A 2GU7A 4IKSA 1QXZA 1B6AA 2GA2A 3IG4A 4IF7A 4HXXA 3TAVA 3RVAA 4U73A 4RZYA 5CDLA 4S2RP 2Q96A 4ZWUA 1YJ3A 1KQ9A 1BOAA 1KP0A 2Q95A 1JAWA 4KM3A 2EA2A 2V6CA 3FMQA 1YVMA 2BWVA 2V3XA 1C21A 4A6WA
chains in the Genus database with same CATH superfamily
1WL9A 4U6WA 3CB5A 2HOWA 3BIQA 4PV4A 4JUQA 4A6VA 2GG7A 1CHMA 4QR8A 3RORA 2Q92A 5FCHA 1XGNA 5JHUA 5CDEA 2P98A 4FUKA 4RGZ1 3MR1A 2EVMA 2BHDA 3PKDA 1WY2A 3BIPA 1O0XA 4Z7MA 2BWXA 2GG5A 2EA4A 1XGOA 1QXYA 4FO7A 1XGMA 4FLJA 4OOKA 1WKMA 5CNXA 2OAZA 2MATA 4U70A 4IKUA 4U69A 4S01A 4ZWPA 2BH3A 5CIKA 2BB7A 2GU6A 2V3ZA 3MATA 2NQ6A 2G6PA 4FLLA 1N51A 1WBQA 4U71A 4EGEA 3L24A 1YW7A 4U6ZA 2GU5A 1C23A 1WL6A 3FMRA 3CTZA 1R58A 2OKNA 1A16A 2Q93A 2GGCA 2GTXA 1YW8A 4U75A 3BITA 3S6BA 2GG9A 1W7VA 2BWSA 2ZSGA 2Q94A 3IU7A 3TB5A 4U1BA 2BN7A 4IDYA 5FCFA 2IW2A 2Q8KA 2GG2A 4IU6A 3MX6A 1XNZA 4B28A 4ZWOA 4S00A 1R5HA 3PKEA 4FO8A 1C27A 1R5GA 3IU8A 3D27A 2BWWA 2BWTA 2GG8A 1Y1NA 2GG3A 4IKRA 1QXWA 1XGSA 5E5BA 2BWUA 2EVOA 2V3YA 4IECA 4U6EA 2BHBA 2B3HA 3IU9A 2NQ7A 4MATA 5D6EA 2P9AA 4S2TP 2GU4A 4RZZA 1PV9A 1WN1A 2GZ5A 5CLSA 3PKBA 2B3LA 4IKTA 1C24A 3PKAA 1M35A 1QZYA 4FLKA 2EVCA 4PNCA 1W2MA 2DFIA 1BN5A 3L7GA 2BHAA 2GGBA 2BWYA 4FKCA 1C22A 2GG0A 5CDVA 4R60A 4IPAA 1MATA 5D6FA 5JFRA 3PKCA 1WLRA 3FM3A 4U6CA 1KQ0A 4U6JA 2ADUA 3Q6DA 1B59A 3CB6A 1YW9A 4FLIA 4ZNGA 4U76A 2BHCA 5JI6A 2B3KA 2P99A 5CE6A 2GU7A 4IKSA 1QXZA 1B6AA 2GA2A 3IG4A 4IF7A 4HXXA 3TAVA 3RVAA 4U73A 4RZYA 5CDLA 4S2RP 2Q96A 4ZWUA 1YJ3A 1KQ9A 1BOAA 1KP0A 2Q95A 1JAWA 4KM3A 2EA2A 2V6CA 3FMQA 1YVMA 2BWVA 2V3XA 1C21A 4A6WA
chains in the Genus database with same CATH topology
1WL9A 4U6WA 3CB5A 2HOWA 3BIQA 4PV4A 4JUQA 4A6VA 2GG7A 1CHMA 4QR8A 3RORA 2Q92A 5FCHA 1XGNA 5JHUA 5CDEA 2P98A 4FUKA 4RGZ1 3MR1A 2EVMA 2BHDA 3PKDA 1WY2A 3BIPA 1O0XA 4Z7MA 2BWXA 2GG5A 2EA4A 1XGOA 1QXYA 4FO7A 1XGMA 4FLJA 4OOKA 1WKMA 5CNXA 2OAZA 2MATA 4U70A 4IKUA 4U69A 4S01A 4ZWPA 2BH3A 5CIKA 2BB7A 2GU6A 2V3ZA 3MATA 2NQ6A 2G6PA 4FLLA 1N51A 1WBQA 4U71A 4EGEA 3L24A 1YW7A 4U6ZA 2GU5A 1C23A 1WL6A 3FMRA 3CTZA 1R58A 2OKNA 1A16A 2Q93A 2GGCA 2GTXA 1YW8A 4U75A 3BITA 3S6BA 2GG9A 1W7VA 2BWSA 2ZSGA 2Q94A 3IU7A 3TB5A 4U1BA 2BN7A 4IDYA 5FCFA 2IW2A 2Q8KA 2GG2A 4IU6A 3MX6A 1XNZA 4B28A 4ZWOA 4S00A 1R5HA 3PKEA 4FO8A 1C27A 1R5GA 3IU8A 3D27A 2BWWA 2BWTA 2GG8A 1Y1NA 2GG3A 4IKRA 1QXWA 1XGSA 5E5BA 2BWUA 2EVOA 2V3YA 4IECA 4U6EA 2BHBA 2B3HA 3IU9A 2NQ7A 4MATA 5D6EA 2P9AA 4S2TP 2GU4A 4RZZA 1PV9A 1WN1A 2GZ5A 5CLSA 3PKBA 2B3LA 4IKTA 1C24A 3PKAA 1M35A 1QZYA 4FLKA 2EVCA 4PNCA 1W2MA 2DFIA 1BN5A 3L7GA 2BHAA 2GGBA 2BWYA 4FKCA 1C22A 2GG0A 5CDVA 4R60A 4IPAA 1MATA 5D6FA 5JFRA 3PKCA 1WLRA 3FM3A 4U6CA 1KQ0A 4U6JA 2ADUA 3Q6DA 1B59A 3CB6A 1YW9A 4FLIA 4ZNGA 4U76A 2BHCA 5JI6A 2B3KA 2P99A 5CE6A 2GU7A 4IKSA 1QXZA 1B6AA 2GA2A 3IG4A 4IF7A 4HXXA 3TAVA 3RVAA 4U73A 4RZYA 5CDLA 4S2RP 2Q96A 4ZWUA 1YJ3A 1KQ9A 1BOAA 1KP0A 2Q95A 1JAWA 4KM3A 2EA2A 2V6CA 3FMQA 1YVMA 2BWVA 2V3XA 1C21A 4A6WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WL9 A;  4U6W A;  3CB5 A;  2HOW A;  3BIQ A;  4PV4 A;  4JUQ A;  4A6V A;  2GG7 A;  1CHM A;  4QR8 A;  3ROR A;  2Q92 A;  5FCH A;  1XGN A;  5JHU A;  5CDE A;  2P98 A;  4FUK A;  4RGZ 1;  3MR1 A;  2EVM A;  2BHD A;  3PKD A;  1WY2 A;  3BIP A;  1O0X A;  4Z7M A;  2BWX A;  2GG5 A;  2EA4 A;  1XGO A;  1QXY A;  4FO7 A;  1XGM A;  4FLJ A;  4OOK A;  1WKM A;  5CNX A;  2OAZ A;  2MAT A;  4U70 A;  4IKU A;  4U69 A;  4S01 A;  4ZWP A;  2BH3 A;  5CIK A;  2BB7 A;  2GU6 A;  2V3Z A;  3MAT A;  2NQ6 A;  2G6P A;  4FLL A;  1N51 A;  1WBQ A;  4U71 A;  4EGE A;  3L24 A;  1YW7 A;  4U6Z A;  2GU5 A;  1C23 A;  1WL6 A;  3FMR A;  3CTZ A;  1R58 A;  2OKN A;  1A16 A;  2Q93 A;  2GGC A;  2GTX A;  1YW8 A;  4U75 A;  3BIT A;  3S6B A;  2GG9 A;  1W7V A;  2BWS A;  2ZSG A;  2Q94 A;  3IU7 A;  3TB5 A;  4U1B A;  2BN7 A;  4IDY A;  5FCF A;  2IW2 A;  2Q8K A;  2GG2 A;  4IU6 A;  3MX6 A;  1XNZ A;  4B28 A;  4ZWO A;  4S00 A;  1R5H A;  3PKE A;  4FO8 A;  1C27 A;  1R5G A;  3IU8 A;  3D27 A;  2BWW A;  2BWT A;  2GG8 A;  1Y1N A;  2GG3 A;  4IKR A;  1QXW A;  1XGS A;  5E5B A;  2BWU A;  2EVO A;  2V3Y A;  4IEC A;  4U6E A;  2BHB A;  2B3H A;  3IU9 A;  2NQ7 A;  4MAT A;  5D6E A;  2P9A A;  4S2T P;  2GU4 A;  4RZZ A;  1PV9 A;  1WN1 A;  2GZ5 A;  5CLS A;  3PKB A;  2B3L A;  4IKT A;  1C24 A;  3PKA A;  1M35 A;  1QZY A;  4FLK A;  2EVC A;  4PNC A;  1W2M A;  2DFI A;  1BN5 A;  3L7G A;  2BHA A;  2GGB A;  2BWY A;  4FKC A;  1C22 A;  2GG0 A;  5CDV A;  4R60 A;  4IPA A;  1MAT A;  5D6F A;  5JFR A;  3PKC A;  1WLR A;  3FM3 A;  4U6C A;  1KQ0 A;  4U6J A;  2ADU A;  3Q6D A;  1B59 A;  3CB6 A;  1YW9 A;  4FLI A;  4ZNG A;  4U76 A;  2BHC A;  5JI6 A;  2B3K A;  2P99 A;  5CE6 A;  2GU7 A;  4IKS A;  1QXZ A;  1B6A A;  2GA2 A;  3IG4 A;  4IF7 A;  4HXX A;  3TAV A;  3RVA A;  4U73 A;  4RZY A;  5CDL A;  4S2R P;  2Q96 A;  4ZWU A;  1YJ3 A;  1KQ9 A;  1BOA A;  1KP0 A;  2Q95 A;  1JAW A;  4KM3 A;  2EA2 A;  2V6C A;  3FMQ A;  1YVM A;  2BWV A;  2V3X A;  1C21 A;  4A6W A; 
#chains in the Genus database with same CATH topology
 1WL9 A;  4U6W A;  3CB5 A;  2HOW A;  3BIQ A;  4PV4 A;  4JUQ A;  4A6V A;  2GG7 A;  1CHM A;  4QR8 A;  3ROR A;  2Q92 A;  5FCH A;  1XGN A;  5JHU A;  5CDE A;  2P98 A;  4FUK A;  4RGZ 1;  3MR1 A;  2EVM A;  2BHD A;  3PKD A;  1WY2 A;  3BIP A;  1O0X A;  4Z7M A;  2BWX A;  2GG5 A;  2EA4 A;  1XGO A;  1QXY A;  4FO7 A;  1XGM A;  4FLJ A;  4OOK A;  1WKM A;  5CNX A;  2OAZ A;  2MAT A;  4U70 A;  4IKU A;  4U69 A;  4S01 A;  4ZWP A;  2BH3 A;  5CIK A;  2BB7 A;  2GU6 A;  2V3Z A;  3MAT A;  2NQ6 A;  2G6P A;  4FLL A;  1N51 A;  1WBQ A;  4U71 A;  4EGE A;  3L24 A;  1YW7 A;  4U6Z A;  2GU5 A;  1C23 A;  1WL6 A;  3FMR A;  3CTZ A;  1R58 A;  2OKN A;  1A16 A;  2Q93 A;  2GGC A;  2GTX A;  1YW8 A;  4U75 A;  3BIT A;  3S6B A;  2GG9 A;  1W7V A;  2BWS A;  2ZSG A;  2Q94 A;  3IU7 A;  3TB5 A;  4U1B A;  2BN7 A;  4IDY A;  5FCF A;  2IW2 A;  2Q8K A;  2GG2 A;  4IU6 A;  3MX6 A;  1XNZ A;  4B28 A;  4ZWO A;  4S00 A;  1R5H A;  3PKE A;  4FO8 A;  1C27 A;  1R5G A;  3IU8 A;  3D27 A;  2BWW A;  2BWT A;  2GG8 A;  1Y1N A;  2GG3 A;  4IKR A;  1QXW A;  1XGS A;  5E5B A;  2BWU A;  2EVO A;  2V3Y A;  4IEC A;  4U6E A;  2BHB A;  2B3H A;  3IU9 A;  2NQ7 A;  4MAT A;  5D6E A;  2P9A A;  4S2T P;  2GU4 A;  4RZZ A;  1PV9 A;  1WN1 A;  2GZ5 A;  5CLS A;  3PKB A;  2B3L A;  4IKT A;  1C24 A;  3PKA A;  1M35 A;  1QZY A;  4FLK A;  2EVC A;  4PNC A;  1W2M A;  2DFI A;  1BN5 A;  3L7G A;  2BHA A;  2GGB A;  2BWY A;  4FKC A;  1C22 A;  2GG0 A;  5CDV A;  4R60 A;  4IPA A;  1MAT A;  5D6F A;  5JFR A;  3PKC A;  1WLR A;  3FM3 A;  4U6C A;  1KQ0 A;  4U6J A;  2ADU A;  3Q6D A;  1B59 A;  3CB6 A;  1YW9 A;  4FLI A;  4ZNG A;  4U76 A;  2BHC A;  5JI6 A;  2B3K A;  2P99 A;  5CE6 A;  2GU7 A;  4IKS A;  1QXZ A;  1B6A A;  2GA2 A;  3IG4 A;  4IF7 A;  4HXX A;  3TAV A;  3RVA A;  4U73 A;  4RZY A;  5CDL A;  4S2R P;  2Q96 A;  4ZWU A;  1YJ3 A;  1KQ9 A;  1BOA A;  1KP0 A;  2Q95 A;  1JAW A;  4KM3 A;  2EA2 A;  2V6C A;  3FMQ A;  1YVM A;  2BWV A;  2V3X A;  1C21 A;  4A6W A; 
#chains in the Genus database with same CATH homology
 1WL9 A;  4U6W A;  3CB5 A;  2HOW A;  3BIQ A;  4PV4 A;  4JUQ A;  4A6V A;  2GG7 A;  1CHM A;  4QR8 A;  3ROR A;  2Q92 A;  5FCH A;  1XGN A;  5JHU A;  5CDE A;  2P98 A;  4FUK A;  4RGZ 1;  3MR1 A;  2EVM A;  2BHD A;  3PKD A;  1WY2 A;  3BIP A;  1O0X A;  4Z7M A;  2BWX A;  2GG5 A;  2EA4 A;  1XGO A;  1QXY A;  4FO7 A;  1XGM A;  4FLJ A;  4OOK A;  1WKM A;  5CNX A;  2OAZ A;  2MAT A;  4U70 A;  4IKU A;  4U69 A;  4S01 A;  4ZWP A;  2BH3 A;  5CIK A;  2BB7 A;  2GU6 A;  2V3Z A;  3MAT A;  2NQ6 A;  2G6P A;  4FLL A;  1N51 A;  1WBQ A;  4U71 A;  4EGE A;  3L24 A;  1YW7 A;  4U6Z A;  2GU5 A;  1C23 A;  1WL6 A;  3FMR A;  3CTZ A;  1R58 A;  2OKN A;  1A16 A;  2Q93 A;  2GGC A;  2GTX A;  1YW8 A;  4U75 A;  3BIT A;  3S6B A;  2GG9 A;  1W7V A;  2BWS A;  2ZSG A;  2Q94 A;  3IU7 A;  3TB5 A;  4U1B A;  2BN7 A;  4IDY A;  5FCF A;  2IW2 A;  2Q8K A;  2GG2 A;  4IU6 A;  3MX6 A;  1XNZ A;  4B28 A;  4ZWO A;  4S00 A;  1R5H A;  3PKE A;  4FO8 A;  1C27 A;  1R5G A;  3IU8 A;  3D27 A;  2BWW A;  2BWT A;  2GG8 A;  1Y1N A;  2GG3 A;  4IKR A;  1QXW A;  1XGS A;  5E5B A;  2BWU A;  2EVO A;  2V3Y A;  4IEC A;  4U6E A;  2BHB A;  2B3H A;  3IU9 A;  2NQ7 A;  4MAT A;  5D6E A;  2P9A A;  4S2T P;  2GU4 A;  4RZZ A;  1PV9 A;  1WN1 A;  2GZ5 A;  5CLS A;  3PKB A;  2B3L A;  4IKT A;  1C24 A;  3PKA A;  1M35 A;  1QZY A;  4FLK A;  2EVC A;  4PNC A;  1W2M A;  2DFI A;  1BN5 A;  3L7G A;  2BHA A;  2GGB A;  2BWY A;  4FKC A;  1C22 A;  2GG0 A;  5CDV A;  4R60 A;  4IPA A;  1MAT A;  5D6F A;  5JFR A;  3PKC A;  1WLR A;  3FM3 A;  4U6C A;  1KQ0 A;  4U6J A;  2ADU A;  3Q6D A;  1B59 A;  3CB6 A;  1YW9 A;  4FLI A;  4ZNG A;  4U76 A;  2BHC A;  5JI6 A;  2B3K A;  2P99 A;  5CE6 A;  2GU7 A;  4IKS A;  1QXZ A;  1B6A A;  2GA2 A;  3IG4 A;  4IF7 A;  4HXX A;  3TAV A;  3RVA A;  4U73 A;  4RZY A;  5CDL A;  4S2R P;  2Q96 A;  4ZWU A;  1YJ3 A;  1KQ9 A;  1BOA A;  1KP0 A;  2Q95 A;  1JAW A;  4KM3 A;  2EA2 A;  2V6C A;  3FMQ A;  1YVM A;  2BWV A;  2V3X A;  1C21 A;  4A6W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...