4FO7A

Pseudomonas aeruginosa metap, in mn form
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
258
structure length
258
Chain Sequence
TVTIKTPDDIEKMRIAGRLAAEVLEMIGEHIKPGVTTEELDRICHDYIVNEQKAIPAPLNYKGFPKSICTSINHVVCHGIPNEKPLKEGDILNVDITVIKDGYHGDTSKMFLVGKTPEWADRLCQITQECMYKGISVVRPGAHLGDIGEIIQKHAEKNGFSVVREYCGHGIGKVFHEEPQVLHYGRAGTGIELKEGMIFTIEPMINQGRPETRLLGDGWTAITKDRKLSAQWEHTVLVTADGYEILTLRNDETFPRTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Methionine excision captured by the structures of a methionine aminopeptidase
rcsb
source organism Pseudomonas aeruginosa
molecule tags Hydrolase
molecule keywords Methionine aminopeptidase
total genus 74
structure length 258
sequence length 258
chains with identical sequence B, C, D
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2012-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 4fo7A00
1CHMA 1XGMA 2BHBA 3FMQA 4U1BA 2GG7A 3CB5A 1R5HA 2GG5A 2V3YA 4U6CA 4EGEA 2EA2A 4S2RP 4U76A 4R60A 4IKUA 4FLKA 1XGSA 2GZ5A 2NQ7A 2BWTA 3PKCA 4IKRA 4A6WA 1W7VA 1WN1A 2P9AA 2BHCA 2BN7A 1C22A 3IG4A 1R5GA 2GGBA 2BWWA 2IW2A 3RVAA 2Q92A 1YW8A 2GG9A 2Q93A 1Y1NA 2GGCA 3PKEA 4FO7A 2Q96A 3BITA 3D27A 2BH3A 2GU5A 4PV4A 5JI6A 2GG2A 1KQ9A 4U6JA 4U75A 2GG3A 1WL6A 2ZSGA 4JUQA 2BWSA 4ZWUA 4A6VA 4RGZ1 3PKAA 1A16A 2EVCA 3RORA 4B28A 2OAZA 1WL9A 4IPAA 4FUKA 1KQ0A 4U73A 5CNXA 2GG0A 2DFIA 4FLLA 4MATA 4FKCA 3TB5A 5CE6A 1B6AA 1C24A 4FO8A 5JFRA 3IU8A 1QZYA 4KM3A 4S00A 1W2MA 1QXZA 4RZZA 5E5BA 3MX6A 3PKBA 1C21A 2MATA 3IU7A 4IDYA 1PV9A 3FM3A 1XGNA 1QXYA 2NQ6A 3MATA 1C23A 5FCHA 2P99A 4ZNGA 4FLIA 1MATA 1YVMA 5JHUA 3L7GA 2B3LA 1C27A 3BIQA 2Q95A 4U71A 1WY2A 1JAWA 4IKSA 1YW7A 2GU6A 2EVOA 1QXWA 4IKTA 4S2TP 5CDVA 3BIPA 4S01A 3IU9A 2BWVA 1YJ3A 1B59A 2BHDA 2V3XA 3TAVA 3Q6DA 4HXXA 2BHAA 4PNCA 1WLRA 2BWXA 2EA4A 4IU6A 2BWYA 3MR1A 2GTXA 2B3HA 2V3ZA 1M35A 1BOAA 4U6EA 2EVMA 1XGOA 1YW9A 2BB7A 4ZWOA 1KP0A 3CTZA 1WBQA 2Q94A 2P98A 3PKDA 2Q8KA 2V6CA 3L24A 5D6EA 4Z7MA 2BWUA 1N51A 5CIKA 5FCFA 4U6WA 1R58A 1XNZA 2G6PA 3FMRA 2HOWA 2GU7A 4U70A 4IF7A 2ADUA 5D6FA 4ZWPA 1O0XA 5CLSA 5CDEA 3CB6A 2GA2A 4U6ZA 4FLJA 1WKMA 2B3KA 4IECA 4QR8A 3S6BA 4U69A 1BN5A 2GG8A 4RZYA 5CDLA 2GU4A 4OOKA 2OKNA
chains in the Genus database with same CATH superfamily
1CHMA 1XGMA 2BHBA 3FMQA 4U1BA 2GG7A 3CB5A 1R5HA 2GG5A 2V3YA 4U6CA 4EGEA 2EA2A 4S2RP 4U76A 4R60A 4IKUA 4FLKA 1XGSA 2GZ5A 2NQ7A 2BWTA 3PKCA 4IKRA 4A6WA 1W7VA 1WN1A 2P9AA 2BHCA 2BN7A 1C22A 3IG4A 1R5GA 2GGBA 2BWWA 2IW2A 3RVAA 2Q92A 1YW8A 2GG9A 2Q93A 1Y1NA 2GGCA 3PKEA 4FO7A 2Q96A 3BITA 3D27A 2BH3A 2GU5A 4PV4A 5JI6A 2GG2A 1KQ9A 4U6JA 4U75A 2GG3A 1WL6A 2ZSGA 4JUQA 2BWSA 4ZWUA 4A6VA 4RGZ1 3PKAA 1A16A 2EVCA 3RORA 4B28A 2OAZA 1WL9A 4IPAA 4FUKA 1KQ0A 4U73A 5CNXA 2GG0A 2DFIA 4FLLA 4MATA 4FKCA 3TB5A 5CE6A 1B6AA 1C24A 4FO8A 5JFRA 3IU8A 1QZYA 4KM3A 4S00A 1W2MA 1QXZA 4RZZA 5E5BA 3MX6A 3PKBA 1C21A 2MATA 3IU7A 4IDYA 1PV9A 3FM3A 1XGNA 1QXYA 2NQ6A 3MATA 1C23A 5FCHA 2P99A 4ZNGA 4FLIA 1MATA 1YVMA 5JHUA 3L7GA 2B3LA 1C27A 3BIQA 2Q95A 4U71A 1WY2A 1JAWA 4IKSA 1YW7A 2GU6A 2EVOA 1QXWA 4IKTA 4S2TP 5CDVA 3BIPA 4S01A 3IU9A 2BWVA 1YJ3A 1B59A 2BHDA 2V3XA 3TAVA 3Q6DA 4HXXA 2BHAA 4PNCA 1WLRA 2BWXA 2EA4A 4IU6A 2BWYA 3MR1A 2GTXA 2B3HA 2V3ZA 1M35A 1BOAA 4U6EA 2EVMA 1XGOA 1YW9A 2BB7A 4ZWOA 1KP0A 3CTZA 1WBQA 2Q94A 2P98A 3PKDA 2Q8KA 2V6CA 3L24A 5D6EA 4Z7MA 2BWUA 1N51A 5CIKA 5FCFA 4U6WA 1R58A 1XNZA 2G6PA 3FMRA 2HOWA 2GU7A 4U70A 4IF7A 2ADUA 5D6FA 4ZWPA 1O0XA 5CLSA 5CDEA 3CB6A 2GA2A 4U6ZA 4FLJA 1WKMA 2B3KA 4IECA 4QR8A 3S6BA 4U69A 1BN5A 2GG8A 4RZYA 5CDLA 2GU4A 4OOKA 2OKNA
chains in the Genus database with same CATH topology
1CHMA 1XGMA 2BHBA 3FMQA 4U1BA 2GG7A 3CB5A 1R5HA 2GG5A 2V3YA 4U6CA 4EGEA 2EA2A 4S2RP 4U76A 4R60A 4IKUA 4FLKA 1XGSA 2GZ5A 2NQ7A 2BWTA 3PKCA 4IKRA 4A6WA 1W7VA 1WN1A 2P9AA 2BHCA 2BN7A 1C22A 3IG4A 1R5GA 2GGBA 2BWWA 2IW2A 3RVAA 2Q92A 1YW8A 2GG9A 2Q93A 1Y1NA 2GGCA 3PKEA 4FO7A 2Q96A 3BITA 3D27A 2BH3A 2GU5A 4PV4A 5JI6A 2GG2A 1KQ9A 4U6JA 4U75A 2GG3A 1WL6A 2ZSGA 4JUQA 2BWSA 4ZWUA 4A6VA 4RGZ1 3PKAA 1A16A 2EVCA 3RORA 4B28A 2OAZA 1WL9A 4IPAA 4FUKA 1KQ0A 4U73A 5CNXA 2GG0A 2DFIA 4FLLA 4MATA 4FKCA 3TB5A 5CE6A 1B6AA 1C24A 4FO8A 5JFRA 3IU8A 1QZYA 4KM3A 4S00A 1W2MA 1QXZA 4RZZA 5E5BA 3MX6A 3PKBA 1C21A 2MATA 3IU7A 4IDYA 1PV9A 3FM3A 1XGNA 1QXYA 2NQ6A 3MATA 1C23A 5FCHA 2P99A 4ZNGA 4FLIA 1MATA 1YVMA 5JHUA 3L7GA 2B3LA 1C27A 3BIQA 2Q95A 4U71A 1WY2A 1JAWA 4IKSA 1YW7A 2GU6A 2EVOA 1QXWA 4IKTA 4S2TP 5CDVA 3BIPA 4S01A 3IU9A 2BWVA 1YJ3A 1B59A 2BHDA 2V3XA 3TAVA 3Q6DA 4HXXA 2BHAA 4PNCA 1WLRA 2BWXA 2EA4A 4IU6A 2BWYA 3MR1A 2GTXA 2B3HA 2V3ZA 1M35A 1BOAA 4U6EA 2EVMA 1XGOA 1YW9A 2BB7A 4ZWOA 1KP0A 3CTZA 1WBQA 2Q94A 2P98A 3PKDA 2Q8KA 2V6CA 3L24A 5D6EA 4Z7MA 2BWUA 1N51A 5CIKA 5FCFA 4U6WA 1R58A 1XNZA 2G6PA 3FMRA 2HOWA 2GU7A 4U70A 4IF7A 2ADUA 5D6FA 4ZWPA 1O0XA 5CLSA 5CDEA 3CB6A 2GA2A 4U6ZA 4FLJA 1WKMA 2B3KA 4IECA 4QR8A 3S6BA 4U69A 1BN5A 2GG8A 4RZYA 5CDLA 2GU4A 4OOKA 2OKNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CHM A;  1XGM A;  2BHB A;  3FMQ A;  4U1B A;  2GG7 A;  3CB5 A;  1R5H A;  2GG5 A;  2V3Y A;  4U6C A;  4EGE A;  2EA2 A;  4S2R P;  4U76 A;  4R60 A;  4IKU A;  4FLK A;  1XGS A;  2GZ5 A;  2NQ7 A;  2BWT A;  3PKC A;  4IKR A;  4A6W A;  1W7V A;  1WN1 A;  2P9A A;  2BHC A;  2BN7 A;  1C22 A;  3IG4 A;  1R5G A;  2GGB A;  2BWW A;  2IW2 A;  3RVA A;  2Q92 A;  1YW8 A;  2GG9 A;  2Q93 A;  1Y1N A;  2GGC A;  3PKE A;  4FO7 A;  2Q96 A;  3BIT A;  3D27 A;  2BH3 A;  2GU5 A;  4PV4 A;  5JI6 A;  2GG2 A;  1KQ9 A;  4U6J A;  4U75 A;  2GG3 A;  1WL6 A;  2ZSG A;  4JUQ A;  2BWS A;  4ZWU A;  4A6V A;  4RGZ 1;  3PKA A;  1A16 A;  2EVC A;  3ROR A;  4B28 A;  2OAZ A;  1WL9 A;  4IPA A;  4FUK A;  1KQ0 A;  4U73 A;  5CNX A;  2GG0 A;  2DFI A;  4FLL A;  4MAT A;  4FKC A;  3TB5 A;  5CE6 A;  1B6A A;  1C24 A;  4FO8 A;  5JFR A;  3IU8 A;  1QZY A;  4KM3 A;  4S00 A;  1W2M A;  1QXZ A;  4RZZ A;  5E5B A;  3MX6 A;  3PKB A;  1C21 A;  2MAT A;  3IU7 A;  4IDY A;  1PV9 A;  3FM3 A;  1XGN A;  1QXY A;  2NQ6 A;  3MAT A;  1C23 A;  5FCH A;  2P99 A;  4ZNG A;  4FLI A;  1MAT A;  1YVM A;  5JHU A;  3L7G A;  2B3L A;  1C27 A;  3BIQ A;  2Q95 A;  4U71 A;  1WY2 A;  1JAW A;  4IKS A;  1YW7 A;  2GU6 A;  2EVO A;  1QXW A;  4IKT A;  4S2T P;  5CDV A;  3BIP A;  4S01 A;  3IU9 A;  2BWV A;  1YJ3 A;  1B59 A;  2BHD A;  2V3X A;  3TAV A;  3Q6D A;  4HXX A;  2BHA A;  4PNC A;  1WLR A;  2BWX A;  2EA4 A;  4IU6 A;  2BWY A;  3MR1 A;  2GTX A;  2B3H A;  2V3Z A;  1M35 A;  1BOA A;  4U6E A;  2EVM A;  1XGO A;  1YW9 A;  2BB7 A;  4ZWO A;  1KP0 A;  3CTZ A;  1WBQ A;  2Q94 A;  2P98 A;  3PKD A;  2Q8K A;  2V6C A;  3L24 A;  5D6E A;  4Z7M A;  2BWU A;  1N51 A;  5CIK A;  5FCF A;  4U6W A;  1R58 A;  1XNZ A;  2G6P A;  3FMR A;  2HOW A;  2GU7 A;  4U70 A;  4IF7 A;  2ADU A;  5D6F A;  4ZWP A;  1O0X A;  5CLS A;  5CDE A;  3CB6 A;  2GA2 A;  4U6Z A;  4FLJ A;  1WKM A;  2B3K A;  4IEC A;  4QR8 A;  3S6B A;  4U69 A;  1BN5 A;  2GG8 A;  4RZY A;  5CDL A;  2GU4 A;  4OOK A;  2OKN A; 
#chains in the Genus database with same CATH topology
 1CHM A;  1XGM A;  2BHB A;  3FMQ A;  4U1B A;  2GG7 A;  3CB5 A;  1R5H A;  2GG5 A;  2V3Y A;  4U6C A;  4EGE A;  2EA2 A;  4S2R P;  4U76 A;  4R60 A;  4IKU A;  4FLK A;  1XGS A;  2GZ5 A;  2NQ7 A;  2BWT A;  3PKC A;  4IKR A;  4A6W A;  1W7V A;  1WN1 A;  2P9A A;  2BHC A;  2BN7 A;  1C22 A;  3IG4 A;  1R5G A;  2GGB A;  2BWW A;  2IW2 A;  3RVA A;  2Q92 A;  1YW8 A;  2GG9 A;  2Q93 A;  1Y1N A;  2GGC A;  3PKE A;  4FO7 A;  2Q96 A;  3BIT A;  3D27 A;  2BH3 A;  2GU5 A;  4PV4 A;  5JI6 A;  2GG2 A;  1KQ9 A;  4U6J A;  4U75 A;  2GG3 A;  1WL6 A;  2ZSG A;  4JUQ A;  2BWS A;  4ZWU A;  4A6V A;  4RGZ 1;  3PKA A;  1A16 A;  2EVC A;  3ROR A;  4B28 A;  2OAZ A;  1WL9 A;  4IPA A;  4FUK A;  1KQ0 A;  4U73 A;  5CNX A;  2GG0 A;  2DFI A;  4FLL A;  4MAT A;  4FKC A;  3TB5 A;  5CE6 A;  1B6A A;  1C24 A;  4FO8 A;  5JFR A;  3IU8 A;  1QZY A;  4KM3 A;  4S00 A;  1W2M A;  1QXZ A;  4RZZ A;  5E5B A;  3MX6 A;  3PKB A;  1C21 A;  2MAT A;  3IU7 A;  4IDY A;  1PV9 A;  3FM3 A;  1XGN A;  1QXY A;  2NQ6 A;  3MAT A;  1C23 A;  5FCH A;  2P99 A;  4ZNG A;  4FLI A;  1MAT A;  1YVM A;  5JHU A;  3L7G A;  2B3L A;  1C27 A;  3BIQ A;  2Q95 A;  4U71 A;  1WY2 A;  1JAW A;  4IKS A;  1YW7 A;  2GU6 A;  2EVO A;  1QXW A;  4IKT A;  4S2T P;  5CDV A;  3BIP A;  4S01 A;  3IU9 A;  2BWV A;  1YJ3 A;  1B59 A;  2BHD A;  2V3X A;  3TAV A;  3Q6D A;  4HXX A;  2BHA A;  4PNC A;  1WLR A;  2BWX A;  2EA4 A;  4IU6 A;  2BWY A;  3MR1 A;  2GTX A;  2B3H A;  2V3Z A;  1M35 A;  1BOA A;  4U6E A;  2EVM A;  1XGO A;  1YW9 A;  2BB7 A;  4ZWO A;  1KP0 A;  3CTZ A;  1WBQ A;  2Q94 A;  2P98 A;  3PKD A;  2Q8K A;  2V6C A;  3L24 A;  5D6E A;  4Z7M A;  2BWU A;  1N51 A;  5CIK A;  5FCF A;  4U6W A;  1R58 A;  1XNZ A;  2G6P A;  3FMR A;  2HOW A;  2GU7 A;  4U70 A;  4IF7 A;  2ADU A;  5D6F A;  4ZWP A;  1O0X A;  5CLS A;  5CDE A;  3CB6 A;  2GA2 A;  4U6Z A;  4FLJ A;  1WKM A;  2B3K A;  4IEC A;  4QR8 A;  3S6B A;  4U69 A;  1BN5 A;  2GG8 A;  4RZY A;  5CDL A;  2GU4 A;  4OOK A;  2OKN A; 
#chains in the Genus database with same CATH homology
 1CHM A;  1XGM A;  2BHB A;  3FMQ A;  4U1B A;  2GG7 A;  3CB5 A;  1R5H A;  2GG5 A;  2V3Y A;  4U6C A;  4EGE A;  2EA2 A;  4S2R P;  4U76 A;  4R60 A;  4IKU A;  4FLK A;  1XGS A;  2GZ5 A;  2NQ7 A;  2BWT A;  3PKC A;  4IKR A;  4A6W A;  1W7V A;  1WN1 A;  2P9A A;  2BHC A;  2BN7 A;  1C22 A;  3IG4 A;  1R5G A;  2GGB A;  2BWW A;  2IW2 A;  3RVA A;  2Q92 A;  1YW8 A;  2GG9 A;  2Q93 A;  1Y1N A;  2GGC A;  3PKE A;  4FO7 A;  2Q96 A;  3BIT A;  3D27 A;  2BH3 A;  2GU5 A;  4PV4 A;  5JI6 A;  2GG2 A;  1KQ9 A;  4U6J A;  4U75 A;  2GG3 A;  1WL6 A;  2ZSG A;  4JUQ A;  2BWS A;  4ZWU A;  4A6V A;  4RGZ 1;  3PKA A;  1A16 A;  2EVC A;  3ROR A;  4B28 A;  2OAZ A;  1WL9 A;  4IPA A;  4FUK A;  1KQ0 A;  4U73 A;  5CNX A;  2GG0 A;  2DFI A;  4FLL A;  4MAT A;  4FKC A;  3TB5 A;  5CE6 A;  1B6A A;  1C24 A;  4FO8 A;  5JFR A;  3IU8 A;  1QZY A;  4KM3 A;  4S00 A;  1W2M A;  1QXZ A;  4RZZ A;  5E5B A;  3MX6 A;  3PKB A;  1C21 A;  2MAT A;  3IU7 A;  4IDY A;  1PV9 A;  3FM3 A;  1XGN A;  1QXY A;  2NQ6 A;  3MAT A;  1C23 A;  5FCH A;  2P99 A;  4ZNG A;  4FLI A;  1MAT A;  1YVM A;  5JHU A;  3L7G A;  2B3L A;  1C27 A;  3BIQ A;  2Q95 A;  4U71 A;  1WY2 A;  1JAW A;  4IKS A;  1YW7 A;  2GU6 A;  2EVO A;  1QXW A;  4IKT A;  4S2T P;  5CDV A;  3BIP A;  4S01 A;  3IU9 A;  2BWV A;  1YJ3 A;  1B59 A;  2BHD A;  2V3X A;  3TAV A;  3Q6D A;  4HXX A;  2BHA A;  4PNC A;  1WLR A;  2BWX A;  2EA4 A;  4IU6 A;  2BWY A;  3MR1 A;  2GTX A;  2B3H A;  2V3Z A;  1M35 A;  1BOA A;  4U6E A;  2EVM A;  1XGO A;  1YW9 A;  2BB7 A;  4ZWO A;  1KP0 A;  3CTZ A;  1WBQ A;  2Q94 A;  2P98 A;  3PKD A;  2Q8K A;  2V6C A;  3L24 A;  5D6E A;  4Z7M A;  2BWU A;  1N51 A;  5CIK A;  5FCF A;  4U6W A;  1R58 A;  1XNZ A;  2G6P A;  3FMR A;  2HOW A;  2GU7 A;  4U70 A;  4IF7 A;  2ADU A;  5D6F A;  4ZWP A;  1O0X A;  5CLS A;  5CDE A;  3CB6 A;  2GA2 A;  4U6Z A;  4FLJ A;  1WKM A;  2B3K A;  4IEC A;  4QR8 A;  3S6B A;  4U69 A;  1BN5 A;  2GG8 A;  4RZY A;  5CDL A;  2GU4 A;  4OOK A;  2OKN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...