4FUKA

Aminopeptidase from trypanosoma brucei
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
336
structure length
329
Chain Sequence
AMKTFDFTGPLRPGKITPRRAVPSHILRPDYADRAGGVSASEEKDRGSKVKVYNIQFLHDDSKAEIQRIKTVCQLSREVLDIATAAAKPGITTDELDRIVHEATVERNMYPSPLNYYGFPKSVCTSVNEVICHGIPDSRELEEGDILNIDVSSYLNGFHGDLNETVFIGRPDDDSVRLVHAAYECLCAGIGVVKPEALYKQVGDAIEACASQYQCSVVRTYTGHGVGHLFHTSPTVCHYANLGMMRPGHVFTIEPMINLGTWQDVTWPDKWTSTTKDGRRSAQFEHTMVVTNGGVEIFTDWVDGVPTYQKQLKEWGIMLPQRKESATAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Aminpeptidase from Trypanosoma brucei (CASP Target)
rcsb
source organism Trypanosoma brucei brucei
molecule tags Hydrolase
molecule keywords Methionine aminopeptidase
total genus 105
structure length 329
sequence length 336
chains with identical sequence B
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2012-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 4fukA01
3IU7A 1A16A 4ZWPA 1CHMA 2BWYA 1PV9A 4PNCA 4U6JA 2V3ZA 5CDEA 1B6AA 3BIQA 2BWWA 4MATA 3L7GA 4KM3A 2BWXA 1WBQA 2GGCA 3PKBA 3TB5A 2GG5A 2GG0A 2Q94A 4PV4A 1YVMA 1R5HA 1YW8A 4FO7A 4S2TP 1MATA 1C27A 3MR1A 4FLLA 2NQ7A 4IU6A 1QXYA 2EVCA 3FMQA 2BWUA 2BHCA 2Q92A 2GU4A 5CDLA 4JUQA 4FLKA 2EA4A 2ADUA 2HOWA 5FCFA 5CNXA 2GGBA 1C24A 1C22A 3L24A 4ZNGA 1W7VA 1WKMA 4IKRA 2GU7A 1R5GA 4HXXA 2BWVA 4S2RP 2P9AA 4U76A 1WL9A 4FUKA 2BWTA 2EVOA 4IKUA 4RZYA 2Q96A 1XGSA 1B59A 1WY2A 3FM3A 5E5BA 4FO8A 1YW7A 3PKEA 4IKTA 3RVAA 5FCHA 2GU6A 2G6PA 5D6EA 2DFIA 1Y1NA 1KP0A 1JAWA 4OOKA 2BWSA 3IU9A 2GG7A 2BN7A 4U71A 4IPAA 5CIKA 5JI6A 4FLIA 2EA2A 4ZWUA 4B28A 4U6CA 2GA2A 1M35A 4IECA 2V3XA 1KQ9A 4QR8A 4IF7A 2EVMA 2GG3A 2GG2A 2GU5A 3CB5A 4U6EA 4R60A 1QXWA 1WL6A 4A6WA 2GZ5A 4S00A 1QZYA 3D27A 4U6WA 2GG9A 2B3HA 2Q8KA 3MX6A 2V6CA 4IDYA 3FMRA 3MATA 2GG8A 1YW9A 4FLJA 4S01A 2BHAA 2V3YA 1XNZA 4U1BA 3RORA 4A6VA 5D6FA 2Q93A 1C21A 4Z7MA 2ZSGA 1XGMA 2B3LA 4U73A 4U75A 1KQ0A 4FKCA 3S6BA 3PKCA 3Q6DA 4U70A 4U69A 4ZWOA 4IKSA 1BOAA 1R58A 2OKNA 3PKAA 1W2MA 2BB7A 5JHUA 3IG4A 4U6ZA 3BITA 4EGEA 2Q95A 1XGNA 2B3KA 3BIPA 2IW2A 5CDVA 3CTZA 1O0XA 1QXZA 1XGOA 2BHDA 3IU8A 1WLRA 5CLSA 1WN1A 2BHBA 4RGZ1 2OAZA 3CB6A 5CE6A 2MATA 1BN5A 2BH3A 4RZZA 2NQ6A 5JFRA 2P98A 1N51A 3PKDA 3TAVA 2P99A 1YJ3A 1C23A 2GTXA
chains in the Genus database with same CATH superfamily
3IU7A 1A16A 4ZWPA 1CHMA 2BWYA 1PV9A 4PNCA 4U6JA 2V3ZA 5CDEA 1B6AA 3BIQA 2BWWA 4MATA 3L7GA 4KM3A 2BWXA 1WBQA 2GGCA 3PKBA 3TB5A 2GG5A 2GG0A 2Q94A 4PV4A 1YVMA 1R5HA 1YW8A 4FO7A 4S2TP 1MATA 1C27A 3MR1A 4FLLA 2NQ7A 4IU6A 1QXYA 2EVCA 3FMQA 2BWUA 2BHCA 2Q92A 2GU4A 5CDLA 4JUQA 4FLKA 2EA4A 2ADUA 2HOWA 5FCFA 5CNXA 2GGBA 1C24A 1C22A 3L24A 4ZNGA 1W7VA 1WKMA 4IKRA 2GU7A 1R5GA 4HXXA 2BWVA 4S2RP 2P9AA 4U76A 1WL9A 4FUKA 2BWTA 2EVOA 4IKUA 4RZYA 2Q96A 1XGSA 1B59A 1WY2A 3FM3A 5E5BA 4FO8A 1YW7A 3PKEA 4IKTA 3RVAA 5FCHA 2GU6A 2G6PA 5D6EA 2DFIA 1Y1NA 1KP0A 1JAWA 4OOKA 2BWSA 3IU9A 2GG7A 2BN7A 4U71A 4IPAA 5CIKA 5JI6A 4FLIA 2EA2A 4ZWUA 4B28A 4U6CA 2GA2A 1M35A 4IECA 2V3XA 1KQ9A 4QR8A 4IF7A 2EVMA 2GG3A 2GG2A 2GU5A 3CB5A 4U6EA 4R60A 1QXWA 1WL6A 4A6WA 2GZ5A 4S00A 1QZYA 3D27A 4U6WA 2GG9A 2B3HA 2Q8KA 3MX6A 2V6CA 4IDYA 3FMRA 3MATA 2GG8A 1YW9A 4FLJA 4S01A 2BHAA 2V3YA 1XNZA 4U1BA 3RORA 4A6VA 5D6FA 2Q93A 1C21A 4Z7MA 2ZSGA 1XGMA 2B3LA 4U73A 4U75A 1KQ0A 4FKCA 3S6BA 3PKCA 3Q6DA 4U70A 4U69A 4ZWOA 4IKSA 1BOAA 1R58A 2OKNA 3PKAA 1W2MA 2BB7A 5JHUA 3IG4A 4U6ZA 3BITA 4EGEA 2Q95A 1XGNA 2B3KA 3BIPA 2IW2A 5CDVA 3CTZA 1O0XA 1QXZA 1XGOA 2BHDA 3IU8A 1WLRA 5CLSA 1WN1A 2BHBA 4RGZ1 2OAZA 3CB6A 5CE6A 2MATA 1BN5A 2BH3A 4RZZA 2NQ6A 5JFRA 2P98A 1N51A 3PKDA 3TAVA 2P99A 1YJ3A 1C23A 2GTXA
chains in the Genus database with same CATH topology
3IU7A 1A16A 4ZWPA 1CHMA 2BWYA 1PV9A 4PNCA 4U6JA 2V3ZA 5CDEA 1B6AA 3BIQA 2BWWA 4MATA 3L7GA 4KM3A 2BWXA 1WBQA 2GGCA 3PKBA 3TB5A 2GG5A 2GG0A 2Q94A 4PV4A 1YVMA 1R5HA 1YW8A 4FO7A 4S2TP 1MATA 1C27A 3MR1A 4FLLA 2NQ7A 4IU6A 1QXYA 2EVCA 3FMQA 2BWUA 2BHCA 2Q92A 2GU4A 5CDLA 4JUQA 4FLKA 2EA4A 2ADUA 2HOWA 5FCFA 5CNXA 2GGBA 1C24A 1C22A 3L24A 4ZNGA 1W7VA 1WKMA 4IKRA 2GU7A 1R5GA 4HXXA 2BWVA 4S2RP 2P9AA 4U76A 1WL9A 4FUKA 2BWTA 2EVOA 4IKUA 4RZYA 2Q96A 1XGSA 1B59A 1WY2A 3FM3A 5E5BA 4FO8A 1YW7A 3PKEA 4IKTA 3RVAA 5FCHA 2GU6A 2G6PA 5D6EA 2DFIA 1Y1NA 1KP0A 1JAWA 4OOKA 2BWSA 3IU9A 2GG7A 2BN7A 4U71A 4IPAA 5CIKA 5JI6A 4FLIA 2EA2A 4ZWUA 4B28A 4U6CA 2GA2A 1M35A 4IECA 2V3XA 1KQ9A 4QR8A 4IF7A 2EVMA 2GG3A 2GG2A 2GU5A 3CB5A 4U6EA 4R60A 1QXWA 1WL6A 4A6WA 2GZ5A 4S00A 1QZYA 3D27A 4U6WA 2GG9A 2B3HA 2Q8KA 3MX6A 2V6CA 4IDYA 3FMRA 3MATA 2GG8A 1YW9A 4FLJA 4S01A 2BHAA 2V3YA 1XNZA 4U1BA 3RORA 4A6VA 5D6FA 2Q93A 1C21A 4Z7MA 2ZSGA 1XGMA 2B3LA 4U73A 4U75A 1KQ0A 4FKCA 3S6BA 3PKCA 3Q6DA 4U70A 4U69A 4ZWOA 4IKSA 1BOAA 1R58A 2OKNA 3PKAA 1W2MA 2BB7A 5JHUA 3IG4A 4U6ZA 3BITA 4EGEA 2Q95A 1XGNA 2B3KA 3BIPA 2IW2A 5CDVA 3CTZA 1O0XA 1QXZA 1XGOA 2BHDA 3IU8A 1WLRA 5CLSA 1WN1A 2BHBA 4RGZ1 2OAZA 3CB6A 5CE6A 2MATA 1BN5A 2BH3A 4RZZA 2NQ6A 5JFRA 2P98A 1N51A 3PKDA 3TAVA 2P99A 1YJ3A 1C23A 2GTXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IU7 A;  1A16 A;  4ZWP A;  1CHM A;  2BWY A;  1PV9 A;  4PNC A;  4U6J A;  2V3Z A;  5CDE A;  1B6A A;  3BIQ A;  2BWW A;  4MAT A;  3L7G A;  4KM3 A;  2BWX A;  1WBQ A;  2GGC A;  3PKB A;  3TB5 A;  2GG5 A;  2GG0 A;  2Q94 A;  4PV4 A;  1YVM A;  1R5H A;  1YW8 A;  4FO7 A;  4S2T P;  1MAT A;  1C27 A;  3MR1 A;  4FLL A;  2NQ7 A;  4IU6 A;  1QXY A;  2EVC A;  3FMQ A;  2BWU A;  2BHC A;  2Q92 A;  2GU4 A;  5CDL A;  4JUQ A;  4FLK A;  2EA4 A;  2ADU A;  2HOW A;  5FCF A;  5CNX A;  2GGB A;  1C24 A;  1C22 A;  3L24 A;  4ZNG A;  1W7V A;  1WKM A;  4IKR A;  2GU7 A;  1R5G A;  4HXX A;  2BWV A;  4S2R P;  2P9A A;  4U76 A;  1WL9 A;  4FUK A;  2BWT A;  2EVO A;  4IKU A;  4RZY A;  2Q96 A;  1XGS A;  1B59 A;  1WY2 A;  3FM3 A;  5E5B A;  4FO8 A;  1YW7 A;  3PKE A;  4IKT A;  3RVA A;  5FCH A;  2GU6 A;  2G6P A;  5D6E A;  2DFI A;  1Y1N A;  1KP0 A;  1JAW A;  4OOK A;  2BWS A;  3IU9 A;  2GG7 A;  2BN7 A;  4U71 A;  4IPA A;  5CIK A;  5JI6 A;  4FLI A;  2EA2 A;  4ZWU A;  4B28 A;  4U6C A;  2GA2 A;  1M35 A;  4IEC A;  2V3X A;  1KQ9 A;  4QR8 A;  4IF7 A;  2EVM A;  2GG3 A;  2GG2 A;  2GU5 A;  3CB5 A;  4U6E A;  4R60 A;  1QXW A;  1WL6 A;  4A6W A;  2GZ5 A;  4S00 A;  1QZY A;  3D27 A;  4U6W A;  2GG9 A;  2B3H A;  2Q8K A;  3MX6 A;  2V6C A;  4IDY A;  3FMR A;  3MAT A;  2GG8 A;  1YW9 A;  4FLJ A;  4S01 A;  2BHA A;  2V3Y A;  1XNZ A;  4U1B A;  3ROR A;  4A6V A;  5D6F A;  2Q93 A;  1C21 A;  4Z7M A;  2ZSG A;  1XGM A;  2B3L A;  4U73 A;  4U75 A;  1KQ0 A;  4FKC A;  3S6B A;  3PKC A;  3Q6D A;  4U70 A;  4U69 A;  4ZWO A;  4IKS A;  1BOA A;  1R58 A;  2OKN A;  3PKA A;  1W2M A;  2BB7 A;  5JHU A;  3IG4 A;  4U6Z A;  3BIT A;  4EGE A;  2Q95 A;  1XGN A;  2B3K A;  3BIP A;  2IW2 A;  5CDV A;  3CTZ A;  1O0X A;  1QXZ A;  1XGO A;  2BHD A;  3IU8 A;  1WLR A;  5CLS A;  1WN1 A;  2BHB A;  4RGZ 1;  2OAZ A;  3CB6 A;  5CE6 A;  2MAT A;  1BN5 A;  2BH3 A;  4RZZ A;  2NQ6 A;  5JFR A;  2P98 A;  1N51 A;  3PKD A;  3TAV A;  2P99 A;  1YJ3 A;  1C23 A;  2GTX A; 
#chains in the Genus database with same CATH topology
 3IU7 A;  1A16 A;  4ZWP A;  1CHM A;  2BWY A;  1PV9 A;  4PNC A;  4U6J A;  2V3Z A;  5CDE A;  1B6A A;  3BIQ A;  2BWW A;  4MAT A;  3L7G A;  4KM3 A;  2BWX A;  1WBQ A;  2GGC A;  3PKB A;  3TB5 A;  2GG5 A;  2GG0 A;  2Q94 A;  4PV4 A;  1YVM A;  1R5H A;  1YW8 A;  4FO7 A;  4S2T P;  1MAT A;  1C27 A;  3MR1 A;  4FLL A;  2NQ7 A;  4IU6 A;  1QXY A;  2EVC A;  3FMQ A;  2BWU A;  2BHC A;  2Q92 A;  2GU4 A;  5CDL A;  4JUQ A;  4FLK A;  2EA4 A;  2ADU A;  2HOW A;  5FCF A;  5CNX A;  2GGB A;  1C24 A;  1C22 A;  3L24 A;  4ZNG A;  1W7V A;  1WKM A;  4IKR A;  2GU7 A;  1R5G A;  4HXX A;  2BWV A;  4S2R P;  2P9A A;  4U76 A;  1WL9 A;  4FUK A;  2BWT A;  2EVO A;  4IKU A;  4RZY A;  2Q96 A;  1XGS A;  1B59 A;  1WY2 A;  3FM3 A;  5E5B A;  4FO8 A;  1YW7 A;  3PKE A;  4IKT A;  3RVA A;  5FCH A;  2GU6 A;  2G6P A;  5D6E A;  2DFI A;  1Y1N A;  1KP0 A;  1JAW A;  4OOK A;  2BWS A;  3IU9 A;  2GG7 A;  2BN7 A;  4U71 A;  4IPA A;  5CIK A;  5JI6 A;  4FLI A;  2EA2 A;  4ZWU A;  4B28 A;  4U6C A;  2GA2 A;  1M35 A;  4IEC A;  2V3X A;  1KQ9 A;  4QR8 A;  4IF7 A;  2EVM A;  2GG3 A;  2GG2 A;  2GU5 A;  3CB5 A;  4U6E A;  4R60 A;  1QXW A;  1WL6 A;  4A6W A;  2GZ5 A;  4S00 A;  1QZY A;  3D27 A;  4U6W A;  2GG9 A;  2B3H A;  2Q8K A;  3MX6 A;  2V6C A;  4IDY A;  3FMR A;  3MAT A;  2GG8 A;  1YW9 A;  4FLJ A;  4S01 A;  2BHA A;  2V3Y A;  1XNZ A;  4U1B A;  3ROR A;  4A6V A;  5D6F A;  2Q93 A;  1C21 A;  4Z7M A;  2ZSG A;  1XGM A;  2B3L A;  4U73 A;  4U75 A;  1KQ0 A;  4FKC A;  3S6B A;  3PKC A;  3Q6D A;  4U70 A;  4U69 A;  4ZWO A;  4IKS A;  1BOA A;  1R58 A;  2OKN A;  3PKA A;  1W2M A;  2BB7 A;  5JHU A;  3IG4 A;  4U6Z A;  3BIT A;  4EGE A;  2Q95 A;  1XGN A;  2B3K A;  3BIP A;  2IW2 A;  5CDV A;  3CTZ A;  1O0X A;  1QXZ A;  1XGO A;  2BHD A;  3IU8 A;  1WLR A;  5CLS A;  1WN1 A;  2BHB A;  4RGZ 1;  2OAZ A;  3CB6 A;  5CE6 A;  2MAT A;  1BN5 A;  2BH3 A;  4RZZ A;  2NQ6 A;  5JFR A;  2P98 A;  1N51 A;  3PKD A;  3TAV A;  2P99 A;  1YJ3 A;  1C23 A;  2GTX A; 
#chains in the Genus database with same CATH homology
 3IU7 A;  1A16 A;  4ZWP A;  1CHM A;  2BWY A;  1PV9 A;  4PNC A;  4U6J A;  2V3Z A;  5CDE A;  1B6A A;  3BIQ A;  2BWW A;  4MAT A;  3L7G A;  4KM3 A;  2BWX A;  1WBQ A;  2GGC A;  3PKB A;  3TB5 A;  2GG5 A;  2GG0 A;  2Q94 A;  4PV4 A;  1YVM A;  1R5H A;  1YW8 A;  4FO7 A;  4S2T P;  1MAT A;  1C27 A;  3MR1 A;  4FLL A;  2NQ7 A;  4IU6 A;  1QXY A;  2EVC A;  3FMQ A;  2BWU A;  2BHC A;  2Q92 A;  2GU4 A;  5CDL A;  4JUQ A;  4FLK A;  2EA4 A;  2ADU A;  2HOW A;  5FCF A;  5CNX A;  2GGB A;  1C24 A;  1C22 A;  3L24 A;  4ZNG A;  1W7V A;  1WKM A;  4IKR A;  2GU7 A;  1R5G A;  4HXX A;  2BWV A;  4S2R P;  2P9A A;  4U76 A;  1WL9 A;  4FUK A;  2BWT A;  2EVO A;  4IKU A;  4RZY A;  2Q96 A;  1XGS A;  1B59 A;  1WY2 A;  3FM3 A;  5E5B A;  4FO8 A;  1YW7 A;  3PKE A;  4IKT A;  3RVA A;  5FCH A;  2GU6 A;  2G6P A;  5D6E A;  2DFI A;  1Y1N A;  1KP0 A;  1JAW A;  4OOK A;  2BWS A;  3IU9 A;  2GG7 A;  2BN7 A;  4U71 A;  4IPA A;  5CIK A;  5JI6 A;  4FLI A;  2EA2 A;  4ZWU A;  4B28 A;  4U6C A;  2GA2 A;  1M35 A;  4IEC A;  2V3X A;  1KQ9 A;  4QR8 A;  4IF7 A;  2EVM A;  2GG3 A;  2GG2 A;  2GU5 A;  3CB5 A;  4U6E A;  4R60 A;  1QXW A;  1WL6 A;  4A6W A;  2GZ5 A;  4S00 A;  1QZY A;  3D27 A;  4U6W A;  2GG9 A;  2B3H A;  2Q8K A;  3MX6 A;  2V6C A;  4IDY A;  3FMR A;  3MAT A;  2GG8 A;  1YW9 A;  4FLJ A;  4S01 A;  2BHA A;  2V3Y A;  1XNZ A;  4U1B A;  3ROR A;  4A6V A;  5D6F A;  2Q93 A;  1C21 A;  4Z7M A;  2ZSG A;  1XGM A;  2B3L A;  4U73 A;  4U75 A;  1KQ0 A;  4FKC A;  3S6B A;  3PKC A;  3Q6D A;  4U70 A;  4U69 A;  4ZWO A;  4IKS A;  1BOA A;  1R58 A;  2OKN A;  3PKA A;  1W2M A;  2BB7 A;  5JHU A;  3IG4 A;  4U6Z A;  3BIT A;  4EGE A;  2Q95 A;  1XGN A;  2B3K A;  3BIP A;  2IW2 A;  5CDV A;  3CTZ A;  1O0X A;  1QXZ A;  1XGO A;  2BHD A;  3IU8 A;  1WLR A;  5CLS A;  1WN1 A;  2BHB A;  4RGZ 1;  2OAZ A;  3CB6 A;  5CE6 A;  2MAT A;  1BN5 A;  2BH3 A;  4RZZ A;  2NQ6 A;  5JFR A;  2P98 A;  1N51 A;  3PKD A;  3TAV A;  2P99 A;  1YJ3 A;  1C23 A;  2GTX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...