4G7OE

Crystal structure of thermus thermophilus transcription initiation complex containing 2 nt of rna
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
94
structure length
94
Chain Sequence
AEPGIDKLFGMVDSKYRLTVVVAKRAQQLLRHGFKNTVLEPEERPKMQTLEGLFDDPNAVTWAMKELLTGRLVFGENLVPEDRLQKEMERLYPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of transcription initiation.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Transcription, transferase/dna
molecule keywords DNA-directed RNA polymerase subunit alpha
total genus 26
structure length 94
sequence length 94
chains with identical sequence O
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2012-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF01192 RNA_pol_Rpb6 RNA polymerase Rpb6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.940.10 Alpha Beta Alpha-Beta Complex Eukaryotic RPB6 RNA polymerase subunit Eukaryotic RPB6 RNA polymerase subunit 4g7oE00
5FLMF 3H0GF 4MEYE 2O5JE 4G7OE 1I3QF 5IP9F 5C4JF 4OIOE 4BBRF 4OINE 1WCMF 2A68E 4JK1E 2B63F 2R92F 3S1QF 2JA6F 3S1RF 4A3DF 3GTKF 5IYDF 2VUMF 3WODE 3GTGF 4MQ9E 4C3JF 2WAQK 5E18E 3GTJF 2WB1I 4A3MF 3RZDF 2Y0SI 4MEXE 3PO2F 4LK0E 3HOYF 4BY1F 3FKIF 4A3FF 4YFXE 2YU9F 3H3VG 2PPBE 1YNNK 2CW0E 3M3YF 3RZOF 5IP7F 1SMYE 2PMZK 4KN7E 5D4CE 4A3JF 1Y1VF 4KMUE 4C2MF 4Y52F 4YFKE 5IPLE 4C3HF 5E17E 5C4XF 1TWFF 5M3MF 1R9TF 2E2HF 4X6AF 2O5IE 5IYCF 4KN4E 3GTQF 4ZH4E 2JA7F 3S14F 2R7ZF 2A6HE 1I6VE 4XLNE 3S2DF 3S1NF 1I50F 3DXJE 3HOZF 3S17F 2A6EE 5C3EF 1QKLA 3M4OF 3GTOF 1TWCF 2NVQF 3S16F 3S2HF 5FJ8F 1HQME 4BY7F 4A93F 4C3IF 4A3EF 4YFNE 4XSXE 4Q4ZE 3HOUF 3S15F 4OIPE 3HOVF 4Y7NF 3GTPF 1ZYRE 1TWHF 2NVYF 5BYHE 2E2JF 2NVTF 5M5WF 5M5XF 2NVXF 1Y1WF 3PO3F 4A3GF 1I6HF 3HOWF 4AYBK 2JA8F 5M5YF 4A3LF 5TMFE 3GTLF 4LLGE 4A3KF 4LJZE 5M3FF 4LK1E 3EQLE 2E2IF 3CQZF 2BE5E 2R93F 4XLPE 5D4EE 3S1MF 5TMCE 1K83F 2JA5F 3I4MF 4YG2E 4XSZE 3K7AF 3HOXF 4A3CF 4G7HE 5D4DE 2A69E 4BBSF 4G7ZE 4OIRE 5C44F 1SFOF 1TWAF 3HKZK 3GTMF 1IW7E 3I4NF 4A3IF 4Q5SE 4A3BF 4GZYE 5IYBF 4OIQE 1YNJK 1TWGF 4BXXF
chains in the Genus database with same CATH superfamily
3S14E 5FLMF 3H0GF 4MEYE 2O5JE 4G7OE 1I3QF 3S2DE 5IP9F 5FJ8E 2NVQE 5C44E 5C4JF 3GTPE 4OIOE 4BBRF 1TWHE 4OINE 5C3EE 1WCMF 1TWCE 2A68E 2NVXE 3M4OE 4JK1E 2PMZH 2B63F 2R92F 3S1QF 2JA6F 3S1RF 3S15E 3S1NE 4A3DF 3GTKF 4BY7E 4Y7NE 4C3IE 5IYDF 2VUMF 3WODE 3PO3E 2NVYE 3GTGF 4MQ9E 4C3JF 3S16E 4AYBH 2E2JE 3S17E 2WAQK 5E18E 3GTLE 3HOVE 4A3ME 3GTJF 2JA6E 4A3DE 2WB1I 4A3MF 2YU9E 1Y1VE 3RZDF 2Y0SI 5M5XE 2NVTE 4BY1E 4C3HE 4A3EE 4MEXE 3PO2F 4LK0E 3HOYF 4BY1F 4A3FE 3PO2E 3GTJE 3FKIF 4A3LE 4A3FF 4YFXE 2YU9F 5IP7E 3H3VG 2PPBE 1YNNK 2CW0E 3M3YF 1Y1WE 3RZOF 5IP7F 1SMYE 2PMZK 4KN7E 1R9TE 4A3BF 4X6AE 4C2ME 5D4CE 4Y52E 4A3JF 1Y1VF 4KMUE 4C2MF 3RZDE 3HOYE 4Y52F 4YFKE 4A3JE 5IPLE 1TWFE 4C3HF 5E17E 5C4XF 2KRXA 3M3YE 1TWFF 3RZOE 5C4XE 5IYBE 5M3MF 1R9TF 2E2HF 3HOZE 4X6AF 2O5IE 5IYCF 4A93E 4KN4E 3GTQF 4QIWH 2R7ZE 4ZH4E 2JA7F 3S14F 2R7ZF 2A6HE 1I6VE 4XLNE 1I3QE 3HOXE 1I50F 3S2DF 3S1NF 3DXJE 4A3CE 5M3ME 3HOZF 3H0GE 3S17F 1I50E 5FLME 4A3IE 2A6EE 5C3EF 4BBRE 1QKLA 3M4OF 3GTOF 1TWCF 2NVQF 3S16F 3S2HF 5IP9E 5FJ8F 2JA7E 1EIKA 1HQME 5C4JE 4BXXF 4BY7F 5IYCE 4A93F 2VUME 5IYDE 4C3IF 4A3EF 2Y0SH 4YFNE 4XSXE 4Q4ZE 3S1RE 3H3VF 3HOUF 4OIPE 3S15F 4BXXE 1I6HE 3HOVF 4Y7NF 3GTPF 1ZYRE 1TWHF 2NVYF 3GTGE 5BYHE 2E2JF 3GTKE 2E2IE 2NVTF 5M5WF 5M5XF 2NVXF 2JA8E 1Y1WF 3PO3F 2B63E 3S1QE 2R92E 4A3GF 1I6HF 2WAQH 3HOWF 4AYBK 2JA8F 5M5YF 3FKIE 4A3LF 5TMFE 3GTLF 4LLGE 1TWAE 4A3KF 4LJZE 5M5YE 5M3FF 4LK1E 4C3JE 3EQLE 2E2IF 3CQZF 2BE5E 2R93F 4XLPE 2WB1H 5D4EE 3S1MF 4A3GE 5TMCE 1K83F 1DZFA 2JA5F 3I4MF 5M5WE 4YG2E 4A3BE 4XSZE 1K83E 3K7AF 3HOXF 4A3CF 4G7HE 5D4DE 2A69E 3HOWE 4BBSF 4G7ZE 4OIRE 3K7AE 5C44F 4BBSE 1SFOF 1TWAF 3HKZK 4A3KE 3GTMF 1IW7E 3GTQE 5M3FE 3I4NE 1SFOE 4A3IF 4Q5SE 3GTME 2JA5E 3I4NF 2E2HE 3I4ME 3CQZE 5IYBF 4QIWK 3GTOE 1TWGE 4OIQE 4GZYE 2R93E 3S1ME 3S2HE 1WCME 3HOUE 1YNJK 1TWGF 3HKZH
chains in the Genus database with same CATH topology
5FLMF 3H0GF 4MEYE 2O5JE 4G7OE 1I3QF 5IP9F 5C4JF 4OIOE 4BBRF 4OINE 1WCMF 2A68E 4JK1E 2B63F 2R92F 3S1QF 2JA6F 3S1RF 4A3DF 3GTKF 5IYDF 2VUMF 3WODE 3GTGF 4MQ9E 4C3JF 2WAQK 5E18E 3GTJF 2WB1I 4A3MF 3RZDF 2Y0SI 4MEXE 3PO2F 4LK0E 3HOYF 4BY1F 3FKIF 4A3FF 4YFXE 2YU9F 3H3VG 2PPBE 1YNNK 2CW0E 3M3YF 3RZOF 5IP7F 1SMYE 2PMZK 4KN7E 5D4CE 4A3JF 1Y1VF 4KMUE 4C2MF 4Y52F 4YFKE 5IPLE 4C3HF 5E17E 5C4XF 2KRXA 1TWFF 5M3MF 1R9TF 2E2HF 4X6AF 2O5IE 5IYCF 4KN4E 3GTQF 4ZH4E 2JA7F 3S14F 2R7ZF 2A6HE 1I6VE 4XLNE 3S2DF 3S1NF 1I50F 3DXJE 3HOZF 3S17F 2A6EE 5C3EF 1QKLA 3M4OF 3GTOF 1TWCF 2NVQF 3S16F 3S2HF 5FJ8F 1HQME 4BY7F 4A93F 4C3IF 4A3EF 4YFNE 4XSXE 4Q4ZE 3HOUF 3S15F 4OIPE 3HOVF 4Y7NF 3GTPF 1ZYRE 1TWHF 2NVYF 5BYHE 2E2JF 2NVTF 5M5WF 5M5XF 2NVXF 1Y1WF 3PO3F 4A3GF 1I6HF 3HOWF 4AYBK 2JA8F 5M5YF 4A3LF 5TMFE 3GTLF 4LLGE 4A3KF 4LJZE 5M3FF 4LK1E 3EQLE 2E2IF 3CQZF 2BE5E 2R93F 4XLPE 5D4EE 3S1MF 5TMCE 1K83F 2JA5F 3I4MF 4YG2E 4XSZE 3K7AF 3HOXF 4A3CF 4G7HE 5D4DE 2A69E 4BBSF 4G7ZE 4OIRE 5C44F 1SFOF 1TWAF 3HKZK 3GTMF 1IW7E 3I4NF 4A3IF 4Q5SE 4A3BF 4GZYE 5IYBF 4QIWK 4OIQE 1YNJK 1TWGF 4BXXF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FLM F;  3H0G F;  4MEY E;  2O5J E;  4G7O E;  1I3Q F;  5IP9 F;  5C4J F;  4OIO E;  4BBR F;  4OIN E;  1WCM F;  2A68 E;  4JK1 E;  2B63 F;  2R92 F;  3S1Q F;  2JA6 F;  3S1R F;  4A3D F;  3GTK F;  5IYD F;  2VUM F;  3WOD E;  3GTG F;  4MQ9 E;  4C3J F;  2WAQ K;  5E18 E;  3GTJ F;  2WB1 I;  4A3M F;  3RZD F;  2Y0S I;  4MEX E;  3PO2 F;  4LK0 E;  3HOY F;  4BY1 F;  3FKI F;  4A3F F;  4YFX E;  2YU9 F;  3H3V G;  2PPB E;  1YNN K;  2CW0 E;  3M3Y F;  3RZO F;  5IP7 F;  1SMY E;  2PMZ K;  4KN7 E;  5D4C E;  4A3J F;  1Y1V F;  4KMU E;  4C2M F;  4Y52 F;  4YFK E;  5IPL E;  4C3H F;  5E17 E;  5C4X F;  1TWF F;  5M3M F;  1R9T F;  2E2H F;  4X6A F;  2O5I E;  5IYC F;  4KN4 E;  3GTQ F;  4ZH4 E;  2JA7 F;  3S14 F;  2R7Z F;  2A6H E;  1I6V E;  4XLN E;  3S2D F;  3S1N F;  1I50 F;  3DXJ E;  3HOZ F;  3S17 F;  2A6E E;  5C3E F;  1QKL A;  3M4O F;  3GTO F;  1TWC F;  2NVQ F;  3S16 F;  3S2H F;  5FJ8 F;  1HQM E;  4BY7 F;  4A93 F;  4C3I F;  4A3E F;  4YFN E;  4XSX E;  4Q4Z E;  3HOU F;  3S15 F;  4OIP E;  3HOV F;  4Y7N F;  3GTP F;  1ZYR E;  1TWH F;  2NVY F;  5BYH E;  2E2J F;  2NVT F;  5M5W F;  5M5X F;  2NVX F;  1Y1W F;  3PO3 F;  4A3G F;  1I6H F;  3HOW F;  4AYB K;  2JA8 F;  5M5Y F;  4A3L F;  5TMF E;  3GTL F;  4LLG E;  4A3K F;  4LJZ E;  5M3F F;  4LK1 E;  3EQL E;  2E2I F;  3CQZ F;  2BE5 E;  2R93 F;  4XLP E;  5D4E E;  3S1M F;  5TMC E;  1K83 F;  2JA5 F;  3I4M F;  4YG2 E;  4XSZ E;  3K7A F;  3HOX F;  4A3C F;  4G7H E;  5D4D E;  2A69 E;  4BBS F;  4G7Z E;  4OIR E;  5C44 F;  1SFO F;  1TWA F;  3HKZ K;  3GTM F;  1IW7 E;  3I4N F;  4A3I F;  4Q5S E;  4A3B F;  4GZY E;  5IYB F;  4OIQ E;  1YNJ K;  1TWG F;  4BXX F; 
#chains in the Genus database with same CATH topology
 3S14 E;  5FLM F;  3H0G F;  4MEY E;  2O5J E;  4G7O E;  1I3Q F;  3S2D E;  5IP9 F;  5FJ8 E;  2NVQ E;  5C44 E;  5C4J F;  3GTP E;  4OIO E;  4BBR F;  1TWH E;  4OIN E;  5C3E E;  1WCM F;  1TWC E;  2A68 E;  2NVX E;  3M4O E;  4JK1 E;  2PMZ H;  2B63 F;  2R92 F;  3S1Q F;  2JA6 F;  3S1R F;  3S15 E;  3S1N E;  4A3D F;  3GTK F;  4BY7 E;  4Y7N E;  4C3I E;  5IYD F;  2VUM F;  3WOD E;  3PO3 E;  2NVY E;  3GTG F;  4MQ9 E;  4C3J F;  3S16 E;  4AYB H;  2E2J E;  3S17 E;  2WAQ K;  5E18 E;  3GTL E;  3HOV E;  4A3M E;  3GTJ F;  2JA6 E;  4A3D E;  2WB1 I;  4A3M F;  2YU9 E;  1Y1V E;  3RZD F;  2Y0S I;  5M5X E;  2NVT E;  4BY1 E;  4C3H E;  4A3E E;  4MEX E;  3PO2 F;  4LK0 E;  3HOY F;  4BY1 F;  4A3F E;  3PO2 E;  3GTJ E;  3FKI F;  4A3L E;  4A3F F;  4YFX E;  2YU9 F;  5IP7 E;  3H3V G;  2PPB E;  1YNN K;  2CW0 E;  3M3Y F;  1Y1W E;  3RZO F;  5IP7 F;  1SMY E;  2PMZ K;  4KN7 E;  1R9T E;  4A3B F;  4X6A E;  4C2M E;  5D4C E;  4Y52 E;  4A3J F;  1Y1V F;  4KMU E;  4C2M F;  3RZD E;  3HOY E;  4Y52 F;  4YFK E;  4A3J E;  5IPL E;  1TWF E;  4C3H F;  5E17 E;  5C4X F;  2KRX A;  3M3Y E;  1TWF F;  3RZO E;  5C4X E;  5IYB E;  5M3M F;  1R9T F;  2E2H F;  3HOZ E;  4X6A F;  2O5I E;  5IYC F;  4A93 E;  4KN4 E;  3GTQ F;  4QIW H;  2R7Z E;  4ZH4 E;  2JA7 F;  3S14 F;  2R7Z F;  2A6H E;  1I6V E;  4XLN E;  1I3Q E;  3HOX E;  1I50 F;  3S2D F;  3S1N F;  3DXJ E;  4A3C E;  5M3M E;  3HOZ F;  3H0G E;  3S17 F;  1I50 E;  5FLM E;  4A3I E;  2A6E E;  5C3E F;  4BBR E;  1QKL A;  3M4O F;  3GTO F;  1TWC F;  2NVQ F;  3S16 F;  3S2H F;  5IP9 E;  5FJ8 F;  2JA7 E;  1EIK A;  1HQM E;  5C4J E;  4BXX F;  4BY7 F;  5IYC E;  4A93 F;  2VUM E;  5IYD E;  4C3I F;  4A3E F;  2Y0S H;  4YFN E;  4XSX E;  4Q4Z E;  3S1R E;  3H3V F;  3HOU F;  4OIP E;  3S15 F;  4BXX E;  1I6H E;  3HOV F;  4Y7N F;  3GTP F;  1ZYR E;  1TWH F;  2NVY F;  3GTG E;  5BYH E;  2E2J F;  3GTK E;  2E2I E;  2NVT F;  5M5W F;  5M5X F;  2NVX F;  2JA8 E;  1Y1W F;  3PO3 F;  2B63 E;  3S1Q E;  2R92 E;  4A3G F;  1I6H F;  2WAQ H;  3HOW F;  4AYB K;  2JA8 F;  5M5Y F;  3FKI E;  4A3L F;  5TMF E;  3GTL F;  4LLG E;  1TWA E;  4A3K F;  4LJZ E;  5M5Y E;  5M3F F;  4LK1 E;  4C3J E;  3EQL E;  2E2I F;  3CQZ F;  2BE5 E;  2R93 F;  4XLP E;  2WB1 H;  5D4E E;  3S1M F;  4A3G E;  5TMC E;  1K83 F;  1DZF A;  2JA5 F;  3I4M F;  5M5W E;  4YG2 E;  4A3B E;  4XSZ E;  1K83 E;  3K7A F;  3HOX F;  4A3C F;  4G7H E;  5D4D E;  2A69 E;  3HOW E;  4BBS F;  4G7Z E;  4OIR E;  3K7A E;  5C44 F;  4BBS E;  1SFO F;  1TWA F;  3HKZ K;  4A3K E;  3GTM F;  1IW7 E;  3GTQ E;  5M3F E;  3I4N E;  1SFO E;  4A3I F;  4Q5S E;  3GTM E;  2JA5 E;  3I4N F;  2E2H E;  3I4M E;  3CQZ E;  5IYB F;  4QIW K;  3GTO E;  1TWG E;  4OIQ E;  4GZY E;  2R93 E;  3S1M E;  3S2H E;  1WCM E;  3HOU E;  1YNJ K;  1TWG F;  3HKZ H; 
#chains in the Genus database with same CATH homology
 5FLM F;  3H0G F;  4MEY E;  2O5J E;  4G7O E;  1I3Q F;  5IP9 F;  5C4J F;  4OIO E;  4BBR F;  4OIN E;  1WCM F;  2A68 E;  4JK1 E;  2B63 F;  2R92 F;  3S1Q F;  2JA6 F;  3S1R F;  4A3D F;  3GTK F;  5IYD F;  2VUM F;  3WOD E;  3GTG F;  4MQ9 E;  4C3J F;  2WAQ K;  5E18 E;  3GTJ F;  2WB1 I;  4A3M F;  3RZD F;  2Y0S I;  4MEX E;  3PO2 F;  4LK0 E;  3HOY F;  4BY1 F;  3FKI F;  4A3F F;  4YFX E;  2YU9 F;  3H3V G;  2PPB E;  1YNN K;  2CW0 E;  3M3Y F;  3RZO F;  5IP7 F;  1SMY E;  2PMZ K;  4KN7 E;  5D4C E;  4A3J F;  1Y1V F;  4KMU E;  4C2M F;  4Y52 F;  4YFK E;  5IPL E;  4C3H F;  5E17 E;  5C4X F;  2KRX A;  1TWF F;  5M3M F;  1R9T F;  2E2H F;  4X6A F;  2O5I E;  5IYC F;  4KN4 E;  3GTQ F;  4ZH4 E;  2JA7 F;  3S14 F;  2R7Z F;  2A6H E;  1I6V E;  4XLN E;  3S2D F;  3S1N F;  1I50 F;  3DXJ E;  3HOZ F;  3S17 F;  2A6E E;  5C3E F;  1QKL A;  3M4O F;  3GTO F;  1TWC F;  2NVQ F;  3S16 F;  3S2H F;  5FJ8 F;  1HQM E;  4BY7 F;  4A93 F;  4C3I F;  4A3E F;  4YFN E;  4XSX E;  4Q4Z E;  3HOU F;  3S15 F;  4OIP E;  3HOV F;  4Y7N F;  3GTP F;  1ZYR E;  1TWH F;  2NVY F;  5BYH E;  2E2J F;  2NVT F;  5M5W F;  5M5X F;  2NVX F;  1Y1W F;  3PO3 F;  4A3G F;  1I6H F;  3HOW F;  4AYB K;  2JA8 F;  5M5Y F;  4A3L F;  5TMF E;  3GTL F;  4LLG E;  4A3K F;  4LJZ E;  5M3F F;  4LK1 E;  3EQL E;  2E2I F;  3CQZ F;  2BE5 E;  2R93 F;  4XLP E;  5D4E E;  3S1M F;  5TMC E;  1K83 F;  2JA5 F;  3I4M F;  4YG2 E;  4XSZ E;  3K7A F;  3HOX F;  4A3C F;  4G7H E;  5D4D E;  2A69 E;  4BBS F;  4G7Z E;  4OIR E;  5C44 F;  1SFO F;  1TWA F;  3HKZ K;  3GTM F;  1IW7 E;  3I4N F;  4A3I F;  4Q5S E;  4A3B F;  4GZY E;  5IYB F;  4QIW K;  4OIQ E;  1YNJ K;  1TWG F;  4BXX F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...