4GPOA

Oligomeic turkey beta1-adrenergic g protein-coupled receptor
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
291
structure length
279
Chain Sequence
LSQQWEAGMSLLMALVVLLIVAGNVLVIAAIGSTQRLQTLTNLFITSLACADLVVGLLVVPFGATLVVRGTWLWGSFLCELWTSLDVLCVTASIETLCVIAIDRYLAITSPFRYQSLMTRARAKVIICTVWAISALVSFLPIMMHWWRDEDPQALKCYQDPGCCDFVTNRAYAIASSIISFYIPLLIMIFVALRVYREAKEQVMLMREHKALKTLGIIMGVFTLCWLPFFLVNIVNVFNRDLVPDWLFVAFNWLGYANSAMNPIIYCRSPDFRKAFKRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of oligomeric beta-1-adrenergic G protein-coupled receptors in ligand-free basal state.
pubmed doi rcsb
molecule keywords Beta-1 adrenergic receptor
molecule tags Receptor
source organism Meleagris gallopavo
total genus 97
structure length 279
sequence length 291
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00001 7tm_1 7 transmembrane receptor (rhodopsin family)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1070.10 Mainly Alpha Up-down Bundle Rhopdopsin 7-helix transmembrane proteins Rhopdopsin 7-helix transmembrane proteins 4gpoA00
4GRVA 1GZMA 3QAKA 2Y04A 1DZEA 1QM8A 4EJ4A 1F4ZA 5H2PA 4KLYA 5H2OA 3QJQB 4XTOA 3AM6A 4IAQA 3EH5B 3PBLA 3C9LA 5LWEA 4JR8A 5DHGA 1UCQA 3UTWA 2YDVA 3ODUA 3RFMA 1BRDA 2Z55A 5AZDA 5B2NA 3ABWA 5F8UA 4GYCA 1FBKA 3VHZA 4A4MA 4K5YA 5B6YA 5ETZA 4L6RA 3PQRA 3UTYA 1KMEA 5DYSA 4UG2A 1F88A 3NSBA 4OV0A 3PDSA 3BVDB 3NY9A 5KKHA 4G7QB 1XMEB 3OE6A 3REYA 4MBSA 3V2WA 3NS0A 4JKVA 2QPDB 1AT9A 5AX1A 2Y03A 4XXJA 1H68A 5A45A 2G87A 1S8JA 2AT9A 1CWQA 3QJTB 1KGBA 1U19A 4G7RB 1JV7A 3VG9A 4DAJA 4BEZA 1P8IA 4GP4B 3WQJA 3COCA 4XT1A 4FA7B 5H2MA 4JQ6A 3V2YA 1IXFA 3PWHA 4DKLA 2LNLA 4L35A 1UAZA 3SN6R 5JJEA 4G72B 1QHJA 4UHRA 5C1MA 4X1HA 5TGZA 1LN6A 5BR2A 1EHKB 2J4YA 3HANA 1M0MA 2R4RA 4N4YB 5G2DA 4HYJA 4TL3A 3VGAA 4N6HA 2Y01A 4N4WA 5G2CA 3EMLA 3QAPA 1E12A 5DHHA 4G7SB 2YCWA 4IARA 4X32A 3MBVA 5EN0A 2KSAA 5ITEA 2KSYA 5B6XA 4GBRA 2I21A 5H2KA 4GP8B 4BV0A 3QJSB 2Y00A 1R84A 4NC3A 1QKPA 3OE9A 3A7KA 5JJJA 3P0GA 1S52A 2WJLA 4QI1A 5AHYA 1BM1A 5JJNA 1JV6A 2ZZLA 3OE0A 2VT4A 5H2IA 5A44A 3CAPA 4LDEA 3HAPA 5G36A 5H2JA 2NTUA 4J4QA 3S3CB 1IW9A 4HWLA 4PXKA 1TN0A 4MQSA 3HASA 3QBKA 4Y9HA 2BRDA 1S51A 1FBBA 3QBIA 4GP5B 2I1XA 3CODA 4XTLA 3AYMA 4DJHA 1P8UA 3RZEA 2Z73A 2EI4A 4AMIA 2YDOA 2I35A 3S8FB 1GU8A 3NY8A 5G54A 2I20A 1QKOA 2WJKA 4QIDA 1KG9A 5AX0A 5B35A 1HZXA 5G28A 1AP9A 4MD1A 2KSBA 1S8LA 2ZIYA 2YCZA 3UG9A 4AMJA 2L6XA 1S54A 1BRXA 1IW6A 2R4SA 2HPYA 4PXFA 3UTVA 4QRYA 5B34A 5ITCA 3OE8A 1S53A 4LDLA 2X72A 1TN5A 5H2NA 3QDCA 3T45A 1PXRA 3KJ6A 4MD2A 4X31A 1L9HA 5AWZA 4IB4A 1F50A 4LDOA 1O0AA 1M0LA 1M0KA 1PY6A 3D4SA 3OAXA 1GUEA 2ZFEA 3UTXA 2JAFA 4G70B 3S3DB 5G53A 4KNFA 4BEYA 3AYNA 1BRRA 2JAGA 4XT3A 1P8HA 3X3CA 1X0SA 1H2SA 2KS9A 1JFPA 4HYXA 2M3GA 1C8SA 5H2HA 5B6WA 3C9MA 2PEDA 4EIYA 5G2AA 3S8GB 3DDLA 1C3WA 5B6VA 2Y02A 3VW7A 5A8EA 4XTNA 2F93A 1XIOA 4WAVA 3S3BB 3UZAA 2QPEB 5B0WA 3QBLA 4FBZA 3ZEVA 3ZPQA 1KG8A 2NTWA 3QBGA 3QJVB 4EA3A 1PXSA 3HAOA 1R2NA 2RH1A 3EH3B 4BVNA 3EH4B 3HARA 1Q5IA 2F95A 1JGJA 5FJGA 5BR5A 1MGYA 1L0MA 2YCYA 3DQBA 3VI0A 1VGOA 1VJMA 1C8RA 4GPOA 4FAAB 4G71B 4BWBA 3UONA 4BUOA 1X0I1 5AHZA 3VVKA 1Q5JA 4FPDA 3QJUB 3X3BA 2YCXA 5J7AA 3NYAA 5B6ZA 3UZCA 3ZPRA 1E0PA 4WW3A 3PXOA 4MQTA 5H2LA 1X0K1 3QJRB 1XJIA 3HAQA
chains in the Genus database with same CATH superfamily
4GRVA 1GZMA 3QAKA 2Y04A 1DZEA 1QM8A 4EJ4A 1F4ZA 5H2PA 4KLYA 5H2OA 3QJQB 4XTOA 3AM6A 4IAQA 3EH5B 3PBLA 3C9LA 5LWEA 4JR8A 5DHGA 1UCQA 3UTWA 2YDVA 3ODUA 3RFMA 1BRDA 2Z55A 5AZDA 5B2NA 3ABWA 5F8UA 4GYCA 1FBKA 3VHZA 4A4MA 4K5YA 5B6YA 5ETZA 4L6RA 3PQRA 3UTYA 1KMEA 5DYSA 4UG2A 1F88A 3NSBA 4OV0A 3PDSA 3BVDB 3NY9A 5KKHA 4G7QB 1XMEB 3OE6A 3REYA 4MBSA 3V2WA 3NS0A 4JKVA 2QPDB 1AT9A 5AX1A 2Y03A 4XXJA 1H68A 5A45A 2G87A 1S8JA 2AT9A 1CWQA 3QJTB 1KGBA 1U19A 4G7RB 1JV7A 3VG9A 4DAJA 4BEZA 1P8IA 4GP4B 3WQJA 3COCA 4XT1A 4FA7B 5H2MA 4JQ6A 3V2YA 1IXFA 3PWHA 4DKLA 2LNLA 4L35A 1UAZA 3SN6R 5JJEA 4G72B 1QHJA 4UHRA 5C1MA 4X1HA 5TGZA 1LN6A 5BR2A 1EHKB 2J4YA 3HANA 1M0MA 2R4RA 4N4YB 5G2DA 4HYJA 4TL3A 3VGAA 4N6HA 2Y01A 4N4WA 5G2CA 3EMLA 3QAPA 1E12A 5DHHA 4G7SB 2YCWA 4IARA 4X32A 3MBVA 5EN0A 2KSAA 5ITEA 2KSYA 5B6XA 4GBRA 2I21A 5H2KA 4GP8B 4BV0A 3QJSB 2Y00A 1R84A 4NC3A 1QKPA 3OE9A 3A7KA 5JJJA 3P0GA 1S52A 2WJLA 4QI1A 5AHYA 1BM1A 5JJNA 1JV6A 2ZZLA 3OE0A 2VT4A 5H2IA 5A44A 3CAPA 4LDEA 3HAPA 5G36A 5H2JA 2NTUA 4J4QA 3S3CB 1IW9A 4HWLA 4PXKA 1TN0A 4MQSA 3HASA 3QBKA 4Y9HA 2BRDA 1S51A 1FBBA 3QBIA 4GP5B 2I1XA 3CODA 4XTLA 3AYMA 4DJHA 1P8UA 3RZEA 2Z73A 2EI4A 4AMIA 2YDOA 2I35A 3S8FB 1GU8A 3NY8A 5G54A 2I20A 1QKOA 2WJKA 4QIDA 1KG9A 5AX0A 5B35A 1HZXA 5G28A 1AP9A 4MD1A 2KSBA 1S8LA 2ZIYA 4DS7E 2YCZA 3UG9A 4AMJA 2L6XA 1S54A 1BRXA 1IW6A 2R4SA 2HPYA 4PXFA 3UTVA 4QRYA 5B34A 5ITCA 3OE8A 1S53A 4LDLA 2X72A 1TN5A 5H2NA 3QDCA 3T45A 1PXRA 3KJ6A 4MD2A 4X31A 1L9HA 5AWZA 4IB4A 1F50A 4LDOA 1O0AA 1M0LA 1M0KA 1PY6A 3D4SA 3OAXA 1GUEA 2ZFEA 3UTXA 2JAFA 4G70B 3S3DB 5G53A 4KNFA 4BEYA 3AYNA 1BRRA 2JAGA 4XT3A 1P8HA 3X3CA 1X0SA 1H2SA 2KS9A 1JFPA 4HYXA 2M3GA 1C8SA 5H2HA 5B6WA 3C9MA 2PEDA 4EIYA 5G2AA 3S8GB 3DDLA 1C3WA 5B6VA 2Y02A 3VW7A 5A8EA 4XTNA 2F93A 1XIOA 4WAVA 3S3BB 3UZAA 2QPEB 5B0WA 3QBLA 4FBZA 3ZEVA 3ZPQA 1KG8A 2NTWA 3QBGA 3QJVB 4EA3A 1PXSA 3HAOA 1R2NA 2RH1A 3EH3B 4BVNA 3EH4B 3HARA 1Q5IA 2F95A 1JGJA 5FJGA 5BR5A 1MGYA 1L0MA 2YCYA 3DQBA 3VI0A 1VGOA 1VJMA 1C8RA 4GPOA 4FAAB 4G71B 4BWBA 3UONA 4BUOA 1X0I1 5AHZA 3VVKA 1Q5JA 4FPDA 3QJUB 3X3BA 2YCXA 5J7AA 3NYAA 5B6ZA 3UZCA 3ZPRA 1E0PA 4WW3A 3PXOA 4MQTA 5H2LA 1X0K1 3QJRB 1XJIA 3HAQA
chains in the Genus database with same CATH topology
4GRVA 1GZMA 3QAKA 2Y04A 1DZEA 1QM8A 4EJ4A 1F4ZA 5H2PA 4KLYA 5H2OA 3QJQB 4XTOA 3AM6A 4IAQA 3EH5B 3PBLA 3C9LA 5LWEA 4JR8A 5DHGA 1UCQA 3UTWA 2YDVA 3ODUA 3RFMA 1BRDA 2Z55A 5AZDA 5B2NA 3ABWA 5F8UA 4GYCA 1FBKA 3VHZA 4A4MA 4K5YA 5B6YA 5ETZA 4L6RA 3PQRA 3UTYA 1KMEA 5DYSA 4UG2A 1F88A 3NSBA 4OV0A 3PDSA 3BVDB 3NY9A 5KKHA 4G7QB 1XMEB 3OE6A 3REYA 4MBSA 3V2WA 3NS0A 4JKVA 2QPDB 1AT9A 5AX1A 2Y03A 4XXJA 1H68A 5A45A 2G87A 1S8JA 2AT9A 1CWQA 3QJTB 1KGBA 1U19A 4G7RB 1JV7A 3VG9A 4DAJA 4BEZA 1P8IA 4GP4B 3WQJA 3COCA 4XT1A 4FA7B 5H2MA 4JQ6A 3V2YA 1IXFA 3PWHA 4DKLA 2LNLA 4L35A 1UAZA 3SN6R 5JJEA 4G72B 1QHJA 4UHRA 5C1MA 4X1HA 5TGZA 1LN6A 5BR2A 1EHKB 2J4YA 3HANA 1M0MA 2R4RA 4N4YB 5G2DA 4HYJA 4TL3A 3VGAA 4N6HA 2Y01A 4N4WA 5G2CA 3EMLA 3QAPA 1E12A 5DHHA 4G7SB 2YCWA 4IARA 4X32A 3MBVA 5EN0A 2KSAA 5ITEA 2KSYA 5B6XA 4GBRA 2I21A 5H2KA 4GP8B 4BV0A 3QJSB 2Y00A 1R84A 4NC3A 1QKPA 3OE9A 3A7KA 5JJJA 3P0GA 1S52A 2WJLA 4QI1A 5AHYA 1BM1A 5JJNA 1JV6A 2ZZLA 3OE0A 2VT4A 5H2IA 5A44A 3CAPA 4LDEA 3HAPA 5G36A 5H2JA 2NTUA 4J4QA 3S3CB 1IW9A 4HWLA 4PXKA 1TN0A 4MQSA 3HASA 3QBKA 4Y9HA 2BRDA 1S51A 1FBBA 3QBIA 4GP5B 2I1XA 3CODA 4XTLA 3AYMA 4DJHA 1P8UA 3RZEA 2Z73A 2EI4A 4AMIA 2YDOA 2I35A 3S8FB 1GU8A 3NY8A 5G54A 2I20A 1QKOA 2WJKA 4QIDA 1KG9A 5AX0A 5B35A 1HZXA 5G28A 1AP9A 4MD1A 2KSBA 1S8LA 2ZIYA 4DS7E 2YCZA 3UG9A 4AMJA 2L6XA 1S54A 1BRXA 1IW6A 2R4SA 2HPYA 4PXFA 3UTVA 4QRYA 5B34A 5ITCA 3OE8A 1S53A 4LDLA 2X72A 1TN5A 5H2NA 3QDCA 3T45A 1PXRA 3KJ6A 4MD2A 4X31A 1L9HA 5AWZA 4IB4A 1F50A 4LDOA 1O0AA 1M0LA 1M0KA 1PY6A 3D4SA 3OAXA 1GUEA 2ZFEA 3UTXA 2JAFA 4G70B 3S3DB 5G53A 4KNFA 4BEYA 3AYNA 1BRRA 2JAGA 4XT3A 1P8HA 3X3CA 1X0SA 1H2SA 2KS9A 1JFPA 4HYXA 2M3GA 1C8SA 5H2HA 5B6WA 3C9MA 2PEDA 4EIYA 5G2AA 3S8GB 3DDLA 1C3WA 5B6VA 2Y02A 3VW7A 5A8EA 4XTNA 2F93A 1XIOA 4WAVA 3S3BB 3UZAA 2QPEB 5B0WA 3QBLA 4FBZA 3ZEVA 3ZPQA 1KG8A 2NTWA 3QBGA 3QJVB 4EA3A 1PXSA 3HAOA 1R2NA 2RH1A 3EH3B 4BVNA 3EH4B 3HARA 1Q5IA 2F95A 1JGJA 5FJGA 5BR5A 1MGYA 1L0MA 2YCYA 3DQBA 3VI0A 1VGOA 1VJMA 1C8RA 4GPOA 4FAAB 4G71B 4BWBA 3UONA 4BUOA 1X0I1 5AHZA 3VVKA 1Q5JA 4FPDA 3QJUB 3X3BA 2YCXA 5J7AA 3NYAA 5B6ZA 3UZCA 3ZPRA 1E0PA 4WW3A 3PXOA 4MQTA 5H2LA 1X0K1 3QJRB 1XJIA 3HAQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GRV A;  1GZM A;  3QAK A;  2Y04 A;  1DZE A;  1QM8 A;  4EJ4 A;  1F4Z A;  5H2P A;  4KLY A;  5H2O A;  3QJQ B;  4XTO A;  3AM6 A;  4IAQ A;  3EH5 B;  3PBL A;  3C9L A;  5LWE A;  4JR8 A;  5DHG A;  1UCQ A;  3UTW A;  2YDV A;  3ODU A;  3RFM A;  1BRD A;  2Z55 A;  5AZD A;  5B2N A;  3ABW A;  5F8U A;  4GYC A;  1FBK A;  3VHZ A;  4A4M A;  4K5Y A;  5B6Y A;  5ETZ A;  4L6R A;  3PQR A;  3UTY A;  1KME A;  5DYS A;  4UG2 A;  1F88 A;  3NSB A;  4OV0 A;  3PDS A;  3BVD B;  3NY9 A;  5KKH A;  4G7Q B;  1XME B;  3OE6 A;  3REY A;  4MBS A;  3V2W A;  3NS0 A;  4JKV A;  2QPD B;  1AT9 A;  5AX1 A;  2Y03 A;  4XXJ A;  1H68 A;  5A45 A;  2G87 A;  1S8J A;  2AT9 A;  1CWQ A;  3QJT B;  1KGB A;  1U19 A;  4G7R B;  1JV7 A;  3VG9 A;  4DAJ A;  4BEZ A;  1P8I A;  4GP4 B;  3WQJ A;  3COC A;  4XT1 A;  4FA7 B;  5H2M A;  4JQ6 A;  3V2Y A;  1IXF A;  3PWH A;  4DKL A;  2LNL A;  4L35 A;  1UAZ A;  3SN6 R;  5JJE A;  4G72 B;  1QHJ A;  4UHR A;  5C1M A;  4X1H A;  5TGZ A;  1LN6 A;  5BR2 A;  1EHK B;  2J4Y A;  3HAN A;  1M0M A;  2R4R A;  4N4Y B;  5G2D A;  4HYJ A;  4TL3 A;  3VGA A;  4N6H A;  2Y01 A;  4N4W A;  5G2C A;  3EML A;  3QAP A;  1E12 A;  5DHH A;  4G7S B;  2YCW A;  4IAR A;  4X32 A;  3MBV A;  5EN0 A;  2KSA A;  5ITE A;  2KSY A;  5B6X A;  4GBR A;  2I21 A;  5H2K A;  4GP8 B;  4BV0 A;  3QJS B;  2Y00 A;  1R84 A;  4NC3 A;  1QKP A;  3OE9 A;  3A7K A;  5JJJ A;  3P0G A;  1S52 A;  2WJL A;  4QI1 A;  5AHY A;  1BM1 A;  5JJN A;  1JV6 A;  2ZZL A;  3OE0 A;  2VT4 A;  5H2I A;  5A44 A;  3CAP A;  4LDE A;  3HAP A;  5G36 A;  5H2J A;  2NTU A;  4J4Q A;  3S3C B;  1IW9 A;  4HWL A;  4PXK A;  1TN0 A;  4MQS A;  3HAS A;  3QBK A;  4Y9H A;  2BRD A;  1S51 A;  1FBB A;  3QBI A;  4GP5 B;  2I1X A;  3COD A;  4XTL A;  3AYM A;  4DJH A;  1P8U A;  3RZE A;  2Z73 A;  2EI4 A;  4AMI A;  2YDO A;  2I35 A;  3S8F B;  1GU8 A;  3NY8 A;  5G54 A;  2I20 A;  1QKO A;  2WJK A;  4QID A;  1KG9 A;  5AX0 A;  5B35 A;  1HZX A;  5G28 A;  1AP9 A;  4MD1 A;  2KSB A;  1S8L A;  2ZIY A;  2YCZ A;  3UG9 A;  4AMJ A;  2L6X A;  1S54 A;  1BRX A;  1IW6 A;  2R4S A;  2HPY A;  4PXF A;  3UTV A;  4QRY A;  5B34 A;  5ITC A;  3OE8 A;  1S53 A;  4LDL A;  2X72 A;  1TN5 A;  5H2N A;  3QDC A;  3T45 A;  1PXR A;  3KJ6 A;  4MD2 A;  4X31 A;  1L9H A;  5AWZ A;  4IB4 A;  1F50 A;  4LDO A;  1O0A A;  1M0L A;  1M0K A;  1PY6 A;  3D4S A;  3OAX A;  1GUE A;  2ZFE A;  3UTX A;  2JAF A;  4G70 B;  3S3D B;  5G53 A;  4KNF A;  4BEY A;  3AYN A;  1BRR A;  2JAG A;  4XT3 A;  1P8H A;  3X3C A;  1X0S A;  1H2S A;  2KS9 A;  1JFP A;  4HYX A;  2M3G A;  1C8S A;  5H2H A;  5B6W A;  3C9M A;  2PED A;  4EIY A;  5G2A A;  3S8G B;  3DDL A;  1C3W A;  5B6V A;  2Y02 A;  3VW7 A;  5A8E A;  4XTN A;  2F93 A;  1XIO A;  4WAV A;  3S3B B;  3UZA A;  2QPE B;  5B0W A;  3QBL A;  4FBZ A;  3ZEV A;  3ZPQ A;  1KG8 A;  2NTW A;  3QBG A;  3QJV B;  4EA3 A;  1PXS A;  3HAO A;  1R2N A;  2RH1 A;  3EH3 B;  4BVN A;  3EH4 B;  3HAR A;  1Q5I A;  2F95 A;  1JGJ A;  5FJG A;  5BR5 A;  1MGY A;  1L0M A;  2YCY A;  3DQB A;  3VI0 A;  1VGO A;  1VJM A;  1C8R A;  4GPO A;  4FAA B;  4G71 B;  4BWB A;  3UON A;  4BUO A;  1X0I 1;  5AHZ A;  3VVK A;  1Q5J A;  4FPD A;  3QJU B;  3X3B A;  2YCX A;  5J7A A;  3NYA A;  5B6Z A;  3UZC A;  3ZPR A;  1E0P A;  4WW3 A;  3PXO A;  4MQT A;  5H2L A;  1X0K 1;  3QJR B;  1XJI A;  3HAQ A; 
#chains in the Genus database with same CATH topology
 4GRV A;  1GZM A;  3QAK A;  2Y04 A;  1DZE A;  1QM8 A;  4EJ4 A;  1F4Z A;  5H2P A;  4KLY A;  5H2O A;  3QJQ B;  4XTO A;  3AM6 A;  4IAQ A;  3EH5 B;  3PBL A;  3C9L A;  5LWE A;  4JR8 A;  5DHG A;  1UCQ A;  3UTW A;  2YDV A;  3ODU A;  3RFM A;  1BRD A;  2Z55 A;  5AZD A;  5B2N A;  3ABW A;  5F8U A;  4GYC A;  1FBK A;  3VHZ A;  4A4M A;  4K5Y A;  5B6Y A;  5ETZ A;  4L6R A;  3PQR A;  3UTY A;  1KME A;  5DYS A;  4UG2 A;  1F88 A;  3NSB A;  4OV0 A;  3PDS A;  3BVD B;  3NY9 A;  5KKH A;  4G7Q B;  1XME B;  3OE6 A;  3REY A;  4MBS A;  3V2W A;  3NS0 A;  4JKV A;  2QPD B;  1AT9 A;  5AX1 A;  2Y03 A;  4XXJ A;  1H68 A;  5A45 A;  2G87 A;  1S8J A;  2AT9 A;  1CWQ A;  3QJT B;  1KGB A;  1U19 A;  4G7R B;  1JV7 A;  3VG9 A;  4DAJ A;  4BEZ A;  1P8I A;  4GP4 B;  3WQJ A;  3COC A;  4XT1 A;  4FA7 B;  5H2M A;  4JQ6 A;  3V2Y A;  1IXF A;  3PWH A;  4DKL A;  2LNL A;  4L35 A;  1UAZ A;  3SN6 R;  5JJE A;  4G72 B;  1QHJ A;  4UHR A;  5C1M A;  4X1H A;  5TGZ A;  1LN6 A;  5BR2 A;  1EHK B;  2J4Y A;  3HAN A;  1M0M A;  2R4R A;  4N4Y B;  5G2D A;  4HYJ A;  4TL3 A;  3VGA A;  4N6H A;  2Y01 A;  4N4W A;  5G2C A;  3EML A;  3QAP A;  1E12 A;  5DHH A;  4G7S B;  2YCW A;  4IAR A;  4X32 A;  3MBV A;  5EN0 A;  2KSA A;  5ITE A;  2KSY A;  5B6X A;  4GBR A;  2I21 A;  5H2K A;  4GP8 B;  4BV0 A;  3QJS B;  2Y00 A;  1R84 A;  4NC3 A;  1QKP A;  3OE9 A;  3A7K A;  5JJJ A;  3P0G A;  1S52 A;  2WJL A;  4QI1 A;  5AHY A;  1BM1 A;  5JJN A;  1JV6 A;  2ZZL A;  3OE0 A;  2VT4 A;  5H2I A;  5A44 A;  3CAP A;  4LDE A;  3HAP A;  5G36 A;  5H2J A;  2NTU A;  4J4Q A;  3S3C B;  1IW9 A;  4HWL A;  4PXK A;  1TN0 A;  4MQS A;  3HAS A;  3QBK A;  4Y9H A;  2BRD A;  1S51 A;  1FBB A;  3QBI A;  4GP5 B;  2I1X A;  3COD A;  4XTL A;  3AYM A;  4DJH A;  1P8U A;  3RZE A;  2Z73 A;  2EI4 A;  4AMI A;  2YDO A;  2I35 A;  3S8F B;  1GU8 A;  3NY8 A;  5G54 A;  2I20 A;  1QKO A;  2WJK A;  4QID A;  1KG9 A;  5AX0 A;  5B35 A;  1HZX A;  5G28 A;  1AP9 A;  4MD1 A;  2KSB A;  1S8L A;  2ZIY A;  4DS7 E;  2YCZ A;  3UG9 A;  4AMJ A;  2L6X A;  1S54 A;  1BRX A;  1IW6 A;  2R4S A;  2HPY A;  4PXF A;  3UTV A;  4QRY A;  5B34 A;  5ITC A;  3OE8 A;  1S53 A;  4LDL A;  2X72 A;  1TN5 A;  5H2N A;  3QDC A;  3T45 A;  1PXR A;  3KJ6 A;  4MD2 A;  4X31 A;  1L9H A;  5AWZ A;  4IB4 A;  1F50 A;  4LDO A;  1O0A A;  1M0L A;  1M0K A;  1PY6 A;  3D4S A;  3OAX A;  1GUE A;  2ZFE A;  3UTX A;  2JAF A;  4G70 B;  3S3D B;  5G53 A;  4KNF A;  4BEY A;  3AYN A;  1BRR A;  2JAG A;  4XT3 A;  1P8H A;  3X3C A;  1X0S A;  1H2S A;  2KS9 A;  1JFP A;  4HYX A;  2M3G A;  1C8S A;  5H2H A;  5B6W A;  3C9M A;  2PED A;  4EIY A;  5G2A A;  3S8G B;  3DDL A;  1C3W A;  5B6V A;  2Y02 A;  3VW7 A;  5A8E A;  4XTN A;  2F93 A;  1XIO A;  4WAV A;  3S3B B;  3UZA A;  2QPE B;  5B0W A;  3QBL A;  4FBZ A;  3ZEV A;  3ZPQ A;  1KG8 A;  2NTW A;  3QBG A;  3QJV B;  4EA3 A;  1PXS A;  3HAO A;  1R2N A;  2RH1 A;  3EH3 B;  4BVN A;  3EH4 B;  3HAR A;  1Q5I A;  2F95 A;  1JGJ A;  5FJG A;  5BR5 A;  1MGY A;  1L0M A;  2YCY A;  3DQB A;  3VI0 A;  1VGO A;  1VJM A;  1C8R A;  4GPO A;  4FAA B;  4G71 B;  4BWB A;  3UON A;  4BUO A;  1X0I 1;  5AHZ A;  3VVK A;  1Q5J A;  4FPD A;  3QJU B;  3X3B A;  2YCX A;  5J7A A;  3NYA A;  5B6Z A;  3UZC A;  3ZPR A;  1E0P A;  4WW3 A;  3PXO A;  4MQT A;  5H2L A;  1X0K 1;  3QJR B;  1XJI A;  3HAQ A; 
#chains in the Genus database with same CATH homology
 4GRV A;  1GZM A;  3QAK A;  2Y04 A;  1DZE A;  1QM8 A;  4EJ4 A;  1F4Z A;  5H2P A;  4KLY A;  5H2O A;  3QJQ B;  4XTO A;  3AM6 A;  4IAQ A;  3EH5 B;  3PBL A;  3C9L A;  5LWE A;  4JR8 A;  5DHG A;  1UCQ A;  3UTW A;  2YDV A;  3ODU A;  3RFM A;  1BRD A;  2Z55 A;  5AZD A;  5B2N A;  3ABW A;  5F8U A;  4GYC A;  1FBK A;  3VHZ A;  4A4M A;  4K5Y A;  5B6Y A;  5ETZ A;  4L6R A;  3PQR A;  3UTY A;  1KME A;  5DYS A;  4UG2 A;  1F88 A;  3NSB A;  4OV0 A;  3PDS A;  3BVD B;  3NY9 A;  5KKH A;  4G7Q B;  1XME B;  3OE6 A;  3REY A;  4MBS A;  3V2W A;  3NS0 A;  4JKV A;  2QPD B;  1AT9 A;  5AX1 A;  2Y03 A;  4XXJ A;  1H68 A;  5A45 A;  2G87 A;  1S8J A;  2AT9 A;  1CWQ A;  3QJT B;  1KGB A;  1U19 A;  4G7R B;  1JV7 A;  3VG9 A;  4DAJ A;  4BEZ A;  1P8I A;  4GP4 B;  3WQJ A;  3COC A;  4XT1 A;  4FA7 B;  5H2M A;  4JQ6 A;  3V2Y A;  1IXF A;  3PWH A;  4DKL A;  2LNL A;  4L35 A;  1UAZ A;  3SN6 R;  5JJE A;  4G72 B;  1QHJ A;  4UHR A;  5C1M A;  4X1H A;  5TGZ A;  1LN6 A;  5BR2 A;  1EHK B;  2J4Y A;  3HAN A;  1M0M A;  2R4R A;  4N4Y B;  5G2D A;  4HYJ A;  4TL3 A;  3VGA A;  4N6H A;  2Y01 A;  4N4W A;  5G2C A;  3EML A;  3QAP A;  1E12 A;  5DHH A;  4G7S B;  2YCW A;  4IAR A;  4X32 A;  3MBV A;  5EN0 A;  2KSA A;  5ITE A;  2KSY A;  5B6X A;  4GBR A;  2I21 A;  5H2K A;  4GP8 B;  4BV0 A;  3QJS B;  2Y00 A;  1R84 A;  4NC3 A;  1QKP A;  3OE9 A;  3A7K A;  5JJJ A;  3P0G A;  1S52 A;  2WJL A;  4QI1 A;  5AHY A;  1BM1 A;  5JJN A;  1JV6 A;  2ZZL A;  3OE0 A;  2VT4 A;  5H2I A;  5A44 A;  3CAP A;  4LDE A;  3HAP A;  5G36 A;  5H2J A;  2NTU A;  4J4Q A;  3S3C B;  1IW9 A;  4HWL A;  4PXK A;  1TN0 A;  4MQS A;  3HAS A;  3QBK A;  4Y9H A;  2BRD A;  1S51 A;  1FBB A;  3QBI A;  4GP5 B;  2I1X A;  3COD A;  4XTL A;  3AYM A;  4DJH A;  1P8U A;  3RZE A;  2Z73 A;  2EI4 A;  4AMI A;  2YDO A;  2I35 A;  3S8F B;  1GU8 A;  3NY8 A;  5G54 A;  2I20 A;  1QKO A;  2WJK A;  4QID A;  1KG9 A;  5AX0 A;  5B35 A;  1HZX A;  5G28 A;  1AP9 A;  4MD1 A;  2KSB A;  1S8L A;  2ZIY A;  4DS7 E;  2YCZ A;  3UG9 A;  4AMJ A;  2L6X A;  1S54 A;  1BRX A;  1IW6 A;  2R4S A;  2HPY A;  4PXF A;  3UTV A;  4QRY A;  5B34 A;  5ITC A;  3OE8 A;  1S53 A;  4LDL A;  2X72 A;  1TN5 A;  5H2N A;  3QDC A;  3T45 A;  1PXR A;  3KJ6 A;  4MD2 A;  4X31 A;  1L9H A;  5AWZ A;  4IB4 A;  1F50 A;  4LDO A;  1O0A A;  1M0L A;  1M0K A;  1PY6 A;  3D4S A;  3OAX A;  1GUE A;  2ZFE A;  3UTX A;  2JAF A;  4G70 B;  3S3D B;  5G53 A;  4KNF A;  4BEY A;  3AYN A;  1BRR A;  2JAG A;  4XT3 A;  1P8H A;  3X3C A;  1X0S A;  1H2S A;  2KS9 A;  1JFP A;  4HYX A;  2M3G A;  1C8S A;  5H2H A;  5B6W A;  3C9M A;  2PED A;  4EIY A;  5G2A A;  3S8G B;  3DDL A;  1C3W A;  5B6V A;  2Y02 A;  3VW7 A;  5A8E A;  4XTN A;  2F93 A;  1XIO A;  4WAV A;  3S3B B;  3UZA A;  2QPE B;  5B0W A;  3QBL A;  4FBZ A;  3ZEV A;  3ZPQ A;  1KG8 A;  2NTW A;  3QBG A;  3QJV B;  4EA3 A;  1PXS A;  3HAO A;  1R2N A;  2RH1 A;  3EH3 B;  4BVN A;  3EH4 B;  3HAR A;  1Q5I A;  2F95 A;  1JGJ A;  5FJG A;  5BR5 A;  1MGY A;  1L0M A;  2YCY A;  3DQB A;  3VI0 A;  1VGO A;  1VJM A;  1C8R A;  4GPO A;  4FAA B;  4G71 B;  4BWB A;  3UON A;  4BUO A;  1X0I 1;  5AHZ A;  3VVK A;  1Q5J A;  4FPD A;  3QJU B;  3X3B A;  2YCX A;  5J7A A;  3NYA A;  5B6Z A;  3UZC A;  3ZPR A;  1E0P A;  4WW3 A;  3PXO A;  4MQT A;  5H2L A;  1X0K 1;  3QJR B;  1XJI A;  3HAQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...