4GX7A

Vibrio cholerae cytolysin beta-prism domain with methyl-alpha-mannose bound
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
132
structure length
132
Chain Sequence
MSSPILGYTQGKMNQQRVGQDNRLYVRAGAAIDALGSASDLLVGGNGGSLSSVDLSGVKSITATSGDFQYGGQQLVALTFTYQDGRQQTVGSKAYVTNAHEDRFDLPDAAKITQLKIWADDWLVKGVQFDLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Vibrio cholerae Cytolysin Recognizes the Heptasaccharide Core of Complex N-Glycans with Nanomolar Affinity.
pubmed doi rcsb
molecule keywords Cytolysin and hemolysin HlyA Pore-forming toxin
molecule tags Toxin
source organism Vibrio cholerae
total genus 27
structure length 132
sequence length 132
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2012-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16458 Beta-prism_lec Beta-prism lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.100.10.30 Mainly Beta Aligned Prism Vitelline Membrane Outer Layer Protein I, subunit A Jacalin-like lectin domain 4gx7A00
3WOCA 3LKYA 4MQ0A 3LL0A 3MITA 2GUEA 3LLYA 1XEZA 3P8SA 1J4TA 1J4SA 4PIFA 1M26A 4AK4A 5J51A 5JM1A 3LM1A 1C3KA 2HYRA 1UGYC 1UGWC 1XXRA 1C3NA 4WOGA 1C3MA 1JACA 1PXDA 3VZEA 3AQGA 2BN0A 3MIUA 3O44A 4AKBA 4PIKA 5J50A 1WS5C 4DDNA 3R51A 2BMYA 4R6PA 5J4XA 1XXQA 1VBOA 3VZFA 1KUJA 2GUXA 5BN6E 2GUCA 1J4UA 5AV7A 1X1VA 1VBPA 1KU8A 2NU5A 2GTYA 3LL1A 4R6NA 1UGYA 1TP8A 3R50A 2NUOA 1UGWA 5EXGA 3R52A 3MIVA 1UH0A 4GX7A 3WOBA 4PITA 1WS5A 2JZ4A 2HYQA 1WS4C 1OUWA 4AKDA 4R6RA 3APAA 3LL2A 3VY6A 4R6QA 3VZGA 1UH1A 4PIUA 4AKCA 1TOQA 2BMZA 3LLZA 1WS4A 1ZGRA 5J4TA 2GUDA 1UGXA 3VY7A 1ZGSA 4R6OA 1JOTA
chains in the Genus database with same CATH superfamily
3WOCA 4QX2A 3LKYA 1DLCA 4MQ0A 3LL0A 3MITA 2GUEA 3LLYA 1XEZA 4R6OA 3P8SA 1J4TA 4PIFA 3TOWA 4QX0A 1M26A 4AK4A 5J51A 5JM1A 3LM1A 4QX1A 1C3KA 2HYRA 1UGYC 4MOAA 1UGWC 1XXRA 1C3NA 4WOGA 1C3MA 1JACA 1PXDA 3VZEA 3AQGA 2BN0A 4W8JA 1VMOA 3MIUA 3O44A 4AKBA 4PIKA 5J50A 1WS5C 4DDNA 3R51A 4ARXA 2BMYA 4R6PA 5J4XA 1XXQA 2QP2A 1VBOA 3VZFA 1KUJA 2GUXA 5BN6E 2GUCA 1J4UA 5AV7A 4QX3A 1X1VA 1VBPA 1KU8A 1W99A 2NU5A 2GTYA 3LL1A 4ARYA 4R6NA 1UGYA 1TP8A 3R50A 2NUOA 1UGWA 5EXGA 3R52A 3MIVA 1UH0A 4GX7A 3WOBA 2C9KA 4PITA 1JI6A 1WS5A 2JZ4A 2HYQA 1WS4C 1OUWA 4AKDA 4R6RA 3APAA 3LL2A 3VY6A 4R6QA 3VZGA 1UH1A 4PIUA 4AKCA 1I5PA 1TOQA 2BMZA 3LLZA 1WS4A 1ZGRA 1CIYA 3EB7A 5J4TA 4D8MA 2GUDA 1UGXA 3VY7A 1ZGSA 1J4SA 1JOTA
chains in the Genus database with same CATH topology
3WOCA 3LKYA 4MQ0A 3LL0A 3MITA 2GUEA 3LLYA 1XEZA 3P8SA 1J4TA 1J4SA 4PIFA 1M26A 4AK4A 5J51A 5JM1A 3LM1A 1C3KA 2HYRA 1UGYC 1UGWC 1XXRA 1C3NA 4WOGA 1C3MA 1JACA 1PXDA 3VZEA 3AQGA 2BN0A 3MIUA 3O44A 4AKBA 4PIKA 5J50A 1WS5C 4DDNA 3R51A 2BMYA 4R6PA 5J4XA 1XXQA 1VBOA 3VZFA 1KUJA 2GUXA 5BN6E 2GUCA 1J4UA 5AV7A 1X1VA 1VBPA 1KU8A 2NU5A 2GTYA 3LL1A 4R6NA 1UGYA 1TP8A 3R50A 2NUOA 1UGWA 5EXGA 3R52A 3MIVA 1UH0A 4GX7A 3WOBA 4PITA 1WS5A 2JZ4A 2HYQA 1WS4C 1OUWA 4AKDA 4R6RA 3APAA 3LL2A 3VY6A 4R6QA 3VZGA 1UH1A 4PIUA 4AKCA 1TOQA 2BMZA 3LLZA 1WS4A 1ZGRA 5J4TA 2GUDA 1UGXA 3VY7A 1ZGSA 4R6OA 1JOTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WOC A;  3LKY A;  4MQ0 A;  3LL0 A;  3MIT A;  2GUE A;  3LLY A;  1XEZ A;  3P8S A;  1J4T A;  1J4S A;  4PIF A;  1M26 A;  4AK4 A;  5J51 A;  5JM1 A;  3LM1 A;  1C3K A;  2HYR A;  1UGY C;  1UGW C;  1XXR A;  1C3N A;  4WOG A;  1C3M A;  1JAC A;  1PXD A;  3VZE A;  3AQG A;  2BN0 A;  3MIU A;  3O44 A;  4AKB A;  4PIK A;  5J50 A;  1WS5 C;  4DDN A;  3R51 A;  2BMY A;  4R6P A;  5J4X A;  1XXQ A;  1VBO A;  3VZF A;  1KUJ A;  2GUX A;  5BN6 E;  2GUC A;  1J4U A;  5AV7 A;  1X1V A;  1VBP A;  1KU8 A;  2NU5 A;  2GTY A;  3LL1 A;  4R6N A;  1UGY A;  1TP8 A;  3R50 A;  2NUO A;  1UGW A;  5EXG A;  3R52 A;  3MIV A;  1UH0 A;  4GX7 A;  3WOB A;  4PIT A;  1WS5 A;  2JZ4 A;  2HYQ A;  1WS4 C;  1OUW A;  4AKD A;  4R6R A;  3APA A;  3LL2 A;  3VY6 A;  4R6Q A;  3VZG A;  1UH1 A;  4PIU A;  4AKC A;  1TOQ A;  2BMZ A;  3LLZ A;  1WS4 A;  1ZGR A;  5J4T A;  2GUD A;  1UGX A;  3VY7 A;  1ZGS A;  4R6O A;  1JOT A; 
#chains in the Genus database with same CATH topology
 3WOC A;  4QX2 A;  3LKY A;  1DLC A;  4MQ0 A;  3LL0 A;  3MIT A;  2GUE A;  3LLY A;  1XEZ A;  4R6O A;  3P8S A;  1J4T A;  4PIF A;  3TOW A;  4QX0 A;  1M26 A;  4AK4 A;  5J51 A;  5JM1 A;  3LM1 A;  4QX1 A;  1C3K A;  2HYR A;  1UGY C;  4MOA A;  1UGW C;  1XXR A;  1C3N A;  4WOG A;  1C3M A;  1JAC A;  1PXD A;  3VZE A;  3AQG A;  2BN0 A;  4W8J A;  1VMO A;  3MIU A;  3O44 A;  4AKB A;  4PIK A;  5J50 A;  1WS5 C;  4DDN A;  3R51 A;  4ARX A;  2BMY A;  4R6P A;  5J4X A;  1XXQ A;  2QP2 A;  1VBO A;  3VZF A;  1KUJ A;  2GUX A;  5BN6 E;  2GUC A;  1J4U A;  5AV7 A;  4QX3 A;  1X1V A;  1VBP A;  1KU8 A;  1W99 A;  2NU5 A;  2GTY A;  3LL1 A;  4ARY A;  4R6N A;  1UGY A;  1TP8 A;  3R50 A;  2NUO A;  1UGW A;  5EXG A;  3R52 A;  3MIV A;  1UH0 A;  4GX7 A;  3WOB A;  2C9K A;  4PIT A;  1JI6 A;  1WS5 A;  2JZ4 A;  2HYQ A;  1WS4 C;  1OUW A;  4AKD A;  4R6R A;  3APA A;  3LL2 A;  3VY6 A;  4R6Q A;  3VZG A;  1UH1 A;  4PIU A;  4AKC A;  1I5P A;  1TOQ A;  2BMZ A;  3LLZ A;  1WS4 A;  1ZGR A;  1CIY A;  3EB7 A;  5J4T A;  4D8M A;  2GUD A;  1UGX A;  3VY7 A;  1ZGS A;  1J4S A;  1JOT A; 
#chains in the Genus database with same CATH homology
 3WOC A;  3LKY A;  4MQ0 A;  3LL0 A;  3MIT A;  2GUE A;  3LLY A;  1XEZ A;  3P8S A;  1J4T A;  1J4S A;  4PIF A;  1M26 A;  4AK4 A;  5J51 A;  5JM1 A;  3LM1 A;  1C3K A;  2HYR A;  1UGY C;  1UGW C;  1XXR A;  1C3N A;  4WOG A;  1C3M A;  1JAC A;  1PXD A;  3VZE A;  3AQG A;  2BN0 A;  3MIU A;  3O44 A;  4AKB A;  4PIK A;  5J50 A;  1WS5 C;  4DDN A;  3R51 A;  2BMY A;  4R6P A;  5J4X A;  1XXQ A;  1VBO A;  3VZF A;  1KUJ A;  2GUX A;  5BN6 E;  2GUC A;  1J4U A;  5AV7 A;  1X1V A;  1VBP A;  1KU8 A;  2NU5 A;  2GTY A;  3LL1 A;  4R6N A;  1UGY A;  1TP8 A;  3R50 A;  2NUO A;  1UGW A;  5EXG A;  3R52 A;  3MIV A;  1UH0 A;  4GX7 A;  3WOB A;  4PIT A;  1WS5 A;  2JZ4 A;  2HYQ A;  1WS4 C;  1OUW A;  4AKD A;  4R6R A;  3APA A;  3LL2 A;  3VY6 A;  4R6Q A;  3VZG A;  1UH1 A;  4PIU A;  4AKC A;  1TOQ A;  2BMZ A;  3LLZ A;  1WS4 A;  1ZGR A;  5J4T A;  2GUD A;  1UGX A;  3VY7 A;  1ZGS A;  4R6O A;  1JOT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...