4H2RA

Structure of mhpco y270f mutant, 5-hydroxynicotinic acid complex
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
369
structure length
369
Chain Sequence
b'TRRAEVAGGGFAGLTAAIALKQNGWDVRLHEKSSELRAFGAGIYLWHNGLRVLEGLGALDDVLQGSHTPPTYETWMHNKSVSKETFNGLPWRIMTRSHLHDALVNRARALGVDISVNSEAVAADPVGRLTLQTGEVLEADLIVGADGVGSKVRDSIGFKQDRWVSKDGLIRLIVPRMKKELGHGEWDNTIDMWNFWPRVQRILYSPCNENELYLGLMAPAADPRGSSVPIDLEVWVEMFPFLEPCLIEAAKLKTARYDKFETTKLDSWTRGKVALVGDAAHAMCPALAQGAGCAMVNAFSLSQDLEEGSSVEDALVAWETRIRPITDRCQALSGDYAANRSLSKGNMFTPAALEAARYDPLRRVYSWPQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-methyl-3-hydroxypyridine-5-carboxylic acid oxygenase
publication title Crystal structure of 2-Methyl-3-hydroxypyridine-5-carboxylic acid oxygenase
rcsb
source organism Rhizobium loti
molecule tags Oxidoreductase
total genus 125
structure length 369
sequence length 369
chains with identical sequence B
ec nomenclature ec 1.14.12.4: Transferred entry: 1.14.13.242.
pdb deposition date 2012-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01494 FAD_binding_3 FAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.9.50 Alpha Beta 2-Layer Sandwich D-Amino Acid Oxidase; Chain A, domain 2 D-Amino Acid Oxidase; Chain A, domain 2 4h2rA02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4h2rA01
5KVIA 4GF7A 3UTGA 2H89A 1CL0A 4FDCB 2QA2A 4ZCCA 4K5SA 1YQ4A 2YAUA 4OVIA 5IPYA 1ZX9A 2GEWA 3KU9A 4RSLA 3DK4A 1Y56A 5KRQA 3NRNA 1FL2A 2NVKX 2YR5A 1ZOYA 3P1WA 3V3OA 1PN0A 3BHKA 5TR3A 4KX6A 1CC2A 2JB2A 2OLNA 4J2WA 1BWCA 1GNDA 1JRZA 4H4ZA 2BCGG 3UKHA 1HYUA 3M12A 1QJDA 1CBOA 2Q6UA 2A87A 4PAAA 1JNRA 1E1NA 1EL5A 4LIIA 1ZY8A 4J34A 3NHOX 2R0GA 3DJEA 2Y6RA 1GRBA 3AE8A 3NH3X 1LVLA 1RYIA 3NKSA 3V76A 2GR1A 3CTYA 1D7YA 2YM2A 3I6DA 4U8LA 5JCIA 5CQFA 2HQMA 3LJPA 1DOCA 2Q0KA 2B9YA 2WETA 3C4AA 1EL8A 5FS8A 3UOXA 3NLCA 3R9UA 2GVCA 4TM3A 1YY5A 2YLSA 4A6NB 4M52A 5FS6A 1D7LA 2YVJA 4Z2TA 5JCLA 3UCLA 2C66A 4UDQA 4XWRA 3NTDA 1M64A 3AD7B 5KOXA 1FOHA 4Z2UA 1DXLA 4X9MA 1BKWA 1PBDA 2XLSA 1P2EA 3AXBA 4H4VA 5U1OA 3L1RA 3LADA 4K2XA 4BJZA 2WOWA 2BC1A 4YT0A 1H82A 2Q7VA 1MO9A 3NIXA 1D4CA 4H4SA 3VR9A 2X3NA 1B5QA 1OJ9A 2GR3A 5M0ZA 2R46A 3DMEA 1GRHA 3CPHG 3BNMA 3ADAB 2C3CA 2C75A 4CCQA 2WDRA 3AEFA 2WQYA 5IQ1A 3VRAA 1LQTA 1VQWA 3AE4A 3UTHA 2ZZCA 2A89A 4IVOB 4K8DA 4A65A 2GQFA 3H8IA 4NTDA 4BK2A 2XVFA 3P4PA 2XFQA 1GTEA 3K7TA 2GF3A 4Z44A 1TDEA 2BCPA 2FBWA 2O9ZA 2BA9A 3NK2X 4UDRA 2E4GA 3AEGA 2QA1A 2WP6A 1E1LA 1TDOA 3FG2P 3UTFA 1K0LA 3VRBA 3DJGX 1Y56B 5BUKA 2YLXA 2YVGA 3EANA 3AEEA 3BHFA 3GYIA 3LB8A 4H4YA 4XXGA 4YTMA 5ER0A 3K7MX 4CNKA 4EQRA 1REOA 3SQPA 2YLWA 2B9XA 4CBQA 2WP5A 3UKKA 4J31A 1DODA 5EB5A 1GETA 2EQ8A 1ELIA 2B9WA 3F8RA 1H81A 2FJAA 2YM1A 1Z6LA 4X9NA 3GD3A 3AWIA 4EQXA 1P2HA 3RP6A 1VDCA 1GALA 2XVHA 2A8XA 4EMIA 1KDGA 3QJ4A 4NEVA 1RP0A 5J60A 3DGHA 1DNCA 4N9XA 3BNUA 1CF3A 1OJTA 2C64A 4AT0A 2WOVA 4AT2A 4CNJA 3SFEA 2YVFA 2C3DA 4H4WA 3KA7A 2ZZBA 3G5QA 2YG6A 4J36A 4Z24A 1L0VA 4LU6A 2XFPA 3FIMB 4U8OA 1XANA 2BK5A 3EAOA 1K0JA 1GXFA 1E6EA 4UDPA 3UKQA 4FX9A 4OPIA 3H8LA 3ICRA 3KKJA 4O5UA 3T37A 2X8GA 4PABA 1N4UA 3ALMA 4C74A 1DJQA 4USRA 3BI2A 2AQJA 4B1BA 1JEHA 2WOIA 2XVJA 4JNQA 3ALJA 3D1CA 3UOYA 4YSXA 4XWZA 1LTXR 3CGCA 4TLZA 1B4VA 5J7XA 3CIRA 4EIPA 2WBAA 4NTEA 3IF9A 3B3RA 3P4RA 2RGOA 1DOEA 1N4VA 1N4WA 3UKPA 1ZOVA 1UKVG 2BS2A 4ADWA 4EM3A 3BI4A 1PBBA 4OPLA 2QCUA 4YKFA 1TDNA 1IUTA 2BABA 1NDAA 3I3LA 1GEUA 1L9DA 1GRAA 2JB3A 4B63A 2V3BA 4I58A 4AP1A 2YG3A 1O94A 4IA5A 4ICYA 3E1TA 3NN0X 5M10A 1GRTA 2XLUA 3GYJA 2R9ZA 2V61A 1LJ1A 1LPFA 1PXAA 3KVEA 3OZ2A 3RP8A 1F8RA 2WPFA 4H4QA 1TDKA 5HYMA 3CPJG 1CC4A 3F8PA 2RGJA 1IUWA 2RGHA 1H7WA 2XLRA 1JU2A 3CNSA 4APNA 1PS9A 3GWFA 4AOSA 3ATRA 1H6VA 1DJNA 4ECHA 2YLRA 4A99A 3KLJA 1CJ3A 1XDIA 4U8IA 2WU2A 4B67A 4BK1A 4K7ZA 3Q9TA 2BXSA 4I59A 4UP3A 2EQ9A 3AE9A 2E1MA 5C2TA 3ZDNA 2GR0A 2ZZ0A 1COYA 1OJCA 2ARDA 3AD9B 1TYPA 1TDFA 3CN8A 1CC6A 2R0CA 3QSMA 2DKHA 2WDQA 2YG4A 1EL7A 2YG7A 2CVJA 1KFYA 4CCRA 2XDOA 2CULA 4H2QA 2TPRA 1NENA 3K30A 3AE7A 4CY6A 2GQWA 4CY8A 3PS9A 4B69A 2XLTA 1B37A 2BK4A 2IIDA 3NYFA 1K0IA 3AE3A 3PVCA 5KWFA 2YQUA 2GV8A 1VG9A 1MXTA 3DK8A 1YQZA 3REDA 4C5OA 1NAAA 3COXA 3UKLA 1OJDA 3IWAA 4YSYA 3ATQA 1TRBA 4IA6A 4B64A 2BK3A 2EQ6A 4YTPA 2BXRA 4J56A 5IQ4A 4EMJA 1KNRA 3GMCA 3QSSA 2XFNA 3FBSA 4GUVA 4BV6A 2X8HA 2X8CA 2WPCA 3ITJA 3CGDA 4OPUA 1H84A 4O5QA 2GAHB 4JY3A 1JRXA 3P9UA 4BK3A 4GR1A 4KPRA 1F6MA 2YG5A 1NG3A 1GTHA 2VRLA 4K5RA 2X99A 1KSSA 5HHFA 1FECA 3ICSA 3DA1A 3NGCX 1EL9A 4TLXA 4BJYA 1LQUA 2GB0A 2Z5XA 3AYLA 4NTCA 2XCGA 3DGZA 3PO7A 4GDPA 1ZK7A 2AR8A 3ISHA 2R0PA 5CKUA 2YR4A 2VQBA 2JBVA 2VZ2A 3AYIA 4NEWA 1L9EA 3H4KA 5U25A 2VOUA 1JOAA 4U8PA 4H4PA 2V3AA 3LZXA 1GREA 3QVRA 5EOWA 5KVHA 2C76A 2C65A 1DOBA 1PBFA 3F8DA 2FJDA 3NN6X 2R45A 1N1PA 2PHHA 4TM0A 4J57A 2BACA 2JAEA 1E1MA 1D5TA 1K4QA 1S3EA 2GH5A 2TMDA 3DH9A 3DJDA 4USQA 4X4JA 4E0VA 1M6IA 3GD4A 3GDNA 4A9WA 3CNPA 4ZCDA 2UZZA 3AE2A 2VVLG 2OLOA 5GSNA 4J33A 3ICTA 3UOVA 3GRTA 1CJ4A 5JCNA 3D8XA 3KPFA 5EB4A 1BF3A 4WCTA 3CPIG 1FEAA 2JKCA 1Q1WA 3AD8B 3GWDA 4C77A 1V59A 2B7SA 2VQ7A 3K7QX 4GDEA 4H4TA 3S5WA 4NZHA 3SM8A 3G5RA 3CNDA 3VRDB 2XVIA 1PDHA 4RG4A 4U2LA 4Y4LA 2YWLA 1GESA 3NK1X 3C4NA 3ALLA 3RHAA 1YQ3A 2DKIA 3Q6JA 1PBEA 2Z5YA 3HZLA 4DSGA 3CNTA 4AOXA 1BGNA 4K22A 1KF6A 4EM4A 2GR2A 4D03A 3QFAA 3UOZA 1JRYA 4U8KA 1S2QA 4EQWA 1GPEA 4YXDA 3IHGA 2B7RA 3B6DA 1E39A 1RSGA 1YKJA 4DGKA 4YKGA 2QAEA 1GV4A 4OPDA 5HXIA 1KNPA 4Z2RA 4Z25A 1AOGA 3VQRA 4MJWA 5FS9A 1S2YA 3KD9A 1O5WA 4TM4A 4GRTA 1NHSA 1GRGA 3RNMA 3AEAA 4B68A 3AE6A 5EBKA 2CFYA 1FEBA 1F8WA 4YSZA 3AE1A 1D4DA 4WX1A 3GRSA 3GSIA 4JNAA 2V6OA 3NTAA 3EPTA 3II4A 1GERA 3UKAA 4JDRA 4AP3A 1NHQA 2R4EA 3AYJA 1ZDLA 3AB1A 4B66A 1NPXA 3EF6A 4A7AA 4H4UA 1LV0A 3NYEA 1SEZA 4DNAA 1Y0PA 4H4XA 1IJHA 1F3PA 3NK0X 1H83A 4GCMA 3RP7A 4EQSA 2WEUA 3C96A 2V5ZA 3UP5A 2IVEA 3SGLA 1NHPA 3QFBA 1FCDA 2APGA 2OA1A 2BC0A 2NPXA 1E7PA 2XFUA 4FK1C 5LV9A 2VVLA 1H86A 5GRTA 2VVMA 2RABA 2JB1A 3AEBA 4D04A 2WU5A 5U63A 2GMJA 2E5VA 3NT6A 2OALA 4IV9A 2C72A 4U2TA 2EQ7A 2XFOA 3VR8A 1H7XA 3CGEA 4C3XA 4DSHA 3IC9A 1L9CA 3L8KA 4Z26A 3IHMA 1ZKQA 1VG0A 3QVPA 1MOKA 4Y4MA 2JK6A 2ZBWA 2YR6A 4H4RA 1NG4A 1TYTA 1Q1RA 4U8JA 4OCGA 5FMHA 3UTEA 5BRTA 5KOWA 2C7GA 1F8SA 1XHCA 1IUXA 3SFDA 1OJAA 2VRMA 1W4XA 1GT8A 2W0HA 1X31B 3O0HA 3FPZA 2GRTA 4FK1A 1CHUA 1NHRA 4BURA 4YWOA 5DBJA 2H88A 2XVEA 3V3NA 3ZYXA 2F5ZA 2YLZA 4Y4NA 1QLBA 1PHHA 1ZMDA 2XYOA 1ONFA 1D4EA 3NNEA 3URHA 2WESA 3UP4A 2C70A 3BI5A 2C67A 2GAGB 2WDVA 4H2NA 1PJ6A 4IVMB 3QSEA 1ZP0A 1PXBA 3OC4A 1BGJA 4JY2A 1ZMCA 2WPEA 1PBCA 2Y6QA 2B76A 2BYBA 2YLTA 2I0ZA 4TM1A 2IVDA 2Q0LA 3NYCA 1IUSA 1Q9IA 2XLPA 2CDUA 5JCKA 2ACZA 3AEDA 4RG3A 4A79A 3P4SA 2FJBA 1S3BA 5KXJA 2J3NA 2OAMA 3P4QA 3S61A 3DK9A 2PYXA 3NG7X 4H50A 4ZN0A 1JNZA 3UKFA 2X50A 4OPTA 3FMWA 2C73A 2FJEA 2R4JA 4YTNA 4H7UA 3JSKA 5BVAA 1BZLA 2V60A 2WHDA 3LXDA 4JQ9A 1XPQA 4B65A 2BS4A 4Z43A 1PJ5A 4U8NA 1PXCA 4A6NA 3GDPA 1QO8A 1CJCA 1KSUA 4A5LA 4OPGA 4U2SA 1IUVA 1GSNA 1NEKA 3G5SA 4CRTA 1IUUA 4HA6A 3AE5A 5C3JA 3DJJA 4OPCA 4HB9A 3GMBA 1EBDA 5BULA 1GRFA 1GOSA 5FS7A 1VRQB 3CNJA 4P9SA 3M0OA 3LZWA 4EIQA 5JCMA 4U8MA 4JN9A 4C3YA 2BS3A 5L46A 3CGBA 3ABVA 5HY5A 4H2PA 4H2RA 1CJ2A 1E1KA 2GMHA 1B8SA 2WS3A 3AECA 4REKA 3WE0A 2WP9A 4LA1A 4EMWA 1O95A 4YSHA 3LOVA 3M13A 1PJ7A 2AAQA
chains in the Genus database with same CATH superfamily
5KVIA 4GF7A 3UTGA 2H89A 1CL0A 4FDCB 2QA2A 4ZCCA 4K5SA 1YQ4A 2YAUA 4OVIA 5IPYA 1ZX9A 2GEWA 3KU9A 4RSLA 3DK4A 1Y56A 5KRQA 4G73A 3NRNA 1FL2A 2NVKX 2YR5A 1ZOYA 3P1WA 3V3OA 1PN0A 3BHKA 5TR3A 4KX6A 1CC2A 2JB2A 2OLNA 4J2WA 1BWCA 1GNDA 1JRZA 4H4ZA 2BCGG 3UKHA 1HYUA 3M12A 1QJDA 1CBOA 2Q6UA 2A87A 4PAAA 1JNRA 1E1NA 1EL5A 4LIIA 1ZY8A 4J34A 3NHOX 2R0GA 3DJEA 2Y6RA 1GRBA 3AE8A 3KPKA 3NH3X 1RYIA 1LVLA 3NKSA 3V76A 2GR1A 3CTYA 1D7YA 2YM2A 3I6DA 4U8LA 5JCIA 5CQFA 3SXIA 2HQMA 3LJPA 1DOCA 2Q0KA 3C4AA 2B9YA 2WETA 1EL8A 5FS8A 3UOXA 3NLCA 3R9UA 2GVCA 4TM3A 1YY5A 2YLSA 4A6NB 4M52A 5FS6A 1D7LA 2YVJA 4Z2TA 5JCLA 4NNJA 3UCLA 2C66A 3W4IA 4UDQA 4XWRA 3NTDA 1M64A 3AD7B 5KOXA 1FOHA 4Z2UA 4X9MA 1DXLA 1BKWA 1PBDA 2XLSA 1P2EA 3AXBA 4H4VA 5U1OA 3L1RA 3LADA 4K2XA 4BJZA 2WOWA 2BC1A 4YT0A 1H82A 2Q7VA 1MO9A 3NIXA 1D4CA 2BRAA 4H4SA 3VR9A 2X3NA 1B5QA 1OJ9A 2GR3A 5M0ZA 2R46A 3DMEA 1GRHA 3CPHG 3BNMA 3ADAB 2C3CA 2C75A 4CCQA 2WDRA 3AEFA 2WQYA 5IQ1A 3VRAA 1LQTA 1VQWA 3AE4A 3UTHA 2ZZCA 2A89A 4IVOB 4K8DA 4A65A 2GQFA 3H8IA 4NTDA 4BK2A 2XVFA 3P4PA 2XFQA 3T2KA 1GTEA 3K7TA 2GF3A 4Z44A 1TDEA 2BCPA 2FBWA 2O9ZA 2BA9A 3NK2X 4UDRA 2E4GA 3AEGA 2QA1A 2WP6A 1E1LA 1TDOA 3FG2P 3UTFA 1K0LA 3VRBA 3DJGX 1Y56B 5BUKA 2YLXA 2YVGA 3EANA 3AEEA 3BHFA 3GYIA 3LB8A 4H4YA 4XXGA 4YTMA 5ER0A 3K7MX 4CNKA 4EQRA 1REOA 3SQPA 2YLWA 2B9XA 4CBQA 2WP5A 3UKKA 4J31A 1DODA 5EB5A 1GETA 2EQ8A 1ELIA 2B9WA 3F8RA 1H81A 2FJAA 2YM1A 1Z6LA 4X9NA 3GD3A 5KNLA 3AWIA 4EQXA 1P2HA 3RP6A 1VDCA 1GALA 2XVHA 2A8XA 4EMIA 1KDGA 3QJ4A 4NEVA 1RP0A 5J60A 3DGHA 1DNCA 4N9XA 3BNUA 1CF3A 1OJTA 4NWZA 2C64A 4AT0A 2WOVA 4AT2A 4CNJA 4GAPA 3SFEA 2YVFA 2C3DA 4H4WA 2E49A 3KA7A 2ZZBA 3G5QA 2YG6A 4J36A 4Z24A 1L0VA 4LU6A 3SZFA 2XFPA 3FIMB 4QFDA 1XANA 2BK5A 3EAOA 4U8OA 3SYIA 1K0JA 1GXFA 1E6EA 5KMRA 4UDPA 3UKQA 4FX9A 4OPIA 3H8LA 3ICRA 3KKJA 4O5UA 3T37A 2X8GA 4PABA 1N4UA 3ALMA 4C74A 1DJQA 4USRA 3BI2A 2AQJA 4B1BA 1VE9A 1JEHA 2WOIA 2XVJA 4JNQA 3ALJA 3D1CA 3UOYA 4YSXA 4XWZA 1LTXR 3CGCA 4TLZA 4QFCA 1B4VA 5J7XA 3CIRA 4EIPA 2WBAA 4NTEA 3IF9A 3B3RA 5KMSA 3P4RA 2RGOA 1DOEA 1N4VA 1N4WA 3UKPA 1ZOVA 1UKVG 2BS2A 4ADWA 4EM3A 3BI4A 1PBBA 4OPLA 2QCUA 4YKFA 1TDNA 1IUTA 2BABA 1NDAA 3I3LA 1GEUA 1L9DA 1GRAA 2JB3A 4B63A 2V3BA 4I58A 4AP1A 2YG3A 1O94A 4IA5A 4ICYA 3E1TA 3NN0X 5M10A 1GRTA 2XLUA 3GYJA 2R9ZA 2V61A 1LJ1A 1LPFA 1PXAA 3KVEA 3OZ2A 3RP8A 1F8RA 2WPFA 4H4QA 1TDKA 5HYMA 3CPJG 1CC4A 3F8PA 2RGJA 1IUWA 2RGHA 1H7WA 2XLRA 1JU2A 3CNSA 4APNA 1PS9A 3GWFA 4AOSA 3ATRA 1H6VA 1DJNA 4ECHA 2YLRA 4A99A 3KLJA 1CJ3A 1XDIA 1DDOA 4U8IA 2WU2A 4BK1A 4B67A 4K7ZA 3Q9TA 2BXSA 4I59A 4UP3A 2EQ9A 3AE9A 1C0PA 2E1MA 5C2TA 3ZDNA 2GR0A 2ZZ0A 4YJHA 3AD9B 1COYA 1OJCA 2ARDA 1TYPA 1TDFA 3CN8A 3W4KA 1CC6A 2R0CA 3QSMA 2DKHA 2WDQA 2YG4A 1EL7A 2YG7A 2CVJA 1KFYA 4CCRA 2XDOA 2CULA 3W4JA 4H2QA 2C4CA 2TPRA 1NENA 3K30A 3AE7A 4CY6A 2GQWA 4II2A 4CY8A 3PS9A 4B69A 2XLTA 1B37A 3NYFA 2BK4A 2IIDA 1K0IA 3PVCA 3AE3A 3SX6A 2YQUA 3SZCA 2GV8A 1VG9A 1MXTA 3DK8A 1YQZA 4G6HA 3REDA 4C5OA 1NAAA 3COXA 3UKLA 1OJDA 3IWAA 4YSYA 3ATQA 1TRBA 4IA6A 4B64A 2BK3A 2EQ6A 4YTPA 2BXRA 2BRYA 4J56A 5IQ4A 4EMJA 4YJGA 3GMCA 1KNRA 3G3EA 3QSSA 2XFNA 3FBSA 4GUVA 4BV6A 2DU8A 2X8HA 2X8CA 2WPCA 3ITJA 3CGDA 4OPUA 3CUKA 1H84A 4O5QA 2GAHB 4JY3A 1JRXA 4BK3A 3P9UA 4GR1A 4KPRA 1F6MA 2YG5A 1NG3A 1GTHA 2VRLA 4K5RA 2X99A 1KSSA 5HHFA 1FECA 3ICSA 3DA1A 3NGCX 1EL9A 4TLXA 4BJYA 1LQUA 2GB0A 2Z5XA 3AYLA 4NTCA 3ZNQA 2XCGA 3WGTA 3DGZA 3PO7A 4GDPA 1C0KA 1ZK7A 2AR8A 3ISHA 2R0PA 5CKUA 2YR4A 2VQBA 2JBVA 2VZ2A 2E82A 3AYIA 1L9EA 3H4KA 4NEWA 5U25A 2VOUA 1JOAA 3T2ZA 4U8PA 4H4PA 2V3AA 3LZXA 1GREA 3QVRA 5EOWA 5KVHA 2C76A 2C65A 1DOBA 1PBFA 3F8DA 2FJDA 3NN6X 2R45A 1N1PA 2PHHA 4TM0A 4J57A 2BACA 3DJDA 1E1MA 1D5TA 1K4QA 1S3EA 2GH5A 2JAEA 2TMDA 3DH9A 4USQA 4X4JA 4E0VA 1M6IA 3GD4A 3GDNA 4A9WA 3CNPA 4ZCDA 2UZZA 3AE2A 2VVLG 2OLOA 5GSNA 4J33A 3ICTA 4YJHB 3UOVA 3GRTA 1CJ4A 5JCNA 3D8XA 3KPFA 5EB4A 1BF3A 4WCTA 3ZNNA 3CPIG 1FEAA 3AD8B 1Q1WA 2JKCA 3GWDA 4C77A 1V59A 2B7SA 2VQ7A 3K7QX 4GDEA 4H4TA 3S5WA 4NZHA 3SM8A 3G5RA 3CNDA 3VRDB 2XVIA 1PDHA 4RG4A 4U2LA 4Y4LA 2YWLA 1GESA 3NK1X 3T2YA 3C4NA 3ALLA 3RHAA 3SZ0A 1YQ3A 2DKIA 3Q6JA 1PBEA 2Z5YA 3HZLA 4DSGA 3CNTA 4AOXA 1BGNA 4K22A 1KF6A 4EM4A 2GR2A 4D03A 3QFAA 3UOZA 1JRYA 4U8KA 1S2QA 4EQWA 3ZNPA 1GPEA 3IHGA 2B7RA 4YXDA 3B6DA 1E39A 1YKJA 1RSGA 4DGKA 4YKGA 3T0KA 2QAEA 1GV4A 4OPDA 1C0IA 5HXIA 1KNPA 4YJGB 4Z2RA 4Z25A 4YJFA 1AOGA 3VQRA 4MJWA 4GAVA 5FS9A 1S2YA 3KD9A 1O5WA 4TM4A 4GRTA 1NHSA 1GRGA 3RNMA 3AEAA 4G6GA 4B68A 3AE6A 5EBKA 2CFYA 1FEBA 1F8WA 4YSZA 3AE1A 1D4DA 4WX1A 3GSIA 3GRSA 4JNAA 2V6OA 3NTAA 3EPTA 3II4A 1GERA 5KMQA 3UKAA 4JDRA 4AP3A 1NHQA 2R4EA 3ZNOA 3AYJA 1AN9A 1ZDLA 3AB1A 4B66A 1NPXA 3EF6A 4A7AA 4H4UA 3NYEA 1LV0A 1SEZA 4DNAA 1Y0PA 4H4XA 1IJHA 1F3PA 3NK0X 1H83A 3RP7A 4GCMA 4EQSA 3C96A 2WEUA 2V5ZA 3UP5A 2IVEA 3SGLA 4II3A 1NHPA 3QFBA 1FCDA 2APGA 2OA1A 2BC0A 3HYWA 3SZWA 2NPXA 1E7PA 2XFUA 4FK1C 5LV9A 2VVLA 1H86A 5GRTA 2VVMA 2RABA 2JB1A 3AEBA 4D04A 2WU5A 5U63A 2GMJA 2E5VA 3NT6A 2OALA 4IV9A 2C72A 4U2TA 2EQ7A 2XFOA 3VR8A 1H7XA 3CGEA 4C3XA 4DSHA 3IC9A 1L9CA 3L8KA 4Z26A 3IHMA 1ZKQA 1VG0A 3QVPA 1MOKA 4Y4MA 2JK6A 3SY4A 2ZBWA 2YR6A 4G74A 4H4RA 1NG4A 1TYTA 1Q1RA 4U8JA 4OCGA 5FMHA 3UTEA 5BRTA 5KOWA 2C7GA 1F8SA 1XHCA 1IUXA 3SFDA 1OJAA 2VRMA 1W4XA 1GT8A 2W0HA 1X31B 3O0HA 3FPZA 2GRTA 4FK1A 1CHUA 1NHRA 4BURA 4YWOA 5DBJA 2H88A 5KWFA 2XVEA 3V3NA 3ZYXA 2F5ZA 2YLZA 4Y4NA 1QLBA 1PHHA 1ZMDA 2XYOA 1ONFA 1D4EA 3NNEA 3URHA 2WESA 3UP4A 2C70A 3BI5A 2C67A 2GAGB 2WDVA 4H2NA 1PJ6A 4IVMB 3QSEA 1ZP0A 1PXBA 3OC4A 1C0LA 1BGJA 4JY2A 4YJFB 1ZMCA 2WPEA 3GYXA 1PBCA 2Y6QA 2B76A 3CMMA 1KIFA 3HYXA 1EVIA 2BYBA 2E4AA 2I0ZA 2YLTA 4TM1A 2Q0LA 2IVDA 3NYCA 1IUSA 1Q9IA 2XLPA 2CDUA 5JCKA 2ACZA 3AEDA 4RG3A 4A79A 3P4SA 2FJBA 1S3BA 4YJDA 5KXJA 2J3NA 2OAMA 3P4QA 3S61A 3DK9A 2PYXA 3NG7X 3T14A 4H50A 4ZN0A 1JNZA 3UKFA 2X50A 4OPTA 3FMWA 2C73A 2FJEA 5KMPA 2R4JA 4YTNA 4H7UA 3T31A 3JSKA 5BVAA 1BZLA 2V60A 2WHDA 3LXDA 4JQ9A 1XPQA 4B65A 2BS4A 4Z43A 1PJ5A 4U8NA 1DAOA 1PXCA 4A6NA 3GDPA 1QO8A 1CJCA 1KSUA 4A5LA 4OPGA 4U2SA 1IUVA 1GSNA 1NEKA 3G5SA 4CRTA 1IUUA 4HA6A 3AE5A 5C3JA 3DJJA 4OPCA 4HB9A 3GMBA 1EBDA 5BULA 4G9KA 1GRFA 1GOSA 5FS7A 1VRQB 4P9SA 3CNJA 3M0OA 3LZWA 4EIQA 5JCMA 2E48A 4U8MA 4JN9A 4C3YA 2BS3A 5L46A 3CGBA 3ABVA 5HY5A 4H2PA 4H2RA 1CJ2A 2GMHA 1E1KA 1B8SA 2WS3A 3AECA 3HYVA 4YSHA 2WP9A 4LA1A 4REKA 1O95A 3WE0A 4EMWA 3LOVA 3M13A 1PJ7A 2AAQA
chains in the Genus database with same CATH topology
5KVIA 4GF7A 3UTGA 2H89A 1CL0A 4FDCB 2QA2A 4ZCCA 4K5SA 1YQ4A 2YAUA 4OVIA 5IPYA 1ZX9A 2GEWA 3KU9A 4RSLA 3DK4A 1Y56A 5KRQA 4G73A 3NRNA 1FL2A 2NVKX 2YR5A 1ZOYA 3P1WA 3V3OA 1PN0A 3BHKA 5TR3A 4KX6A 1CC2A 2JB2A 2OLNA 4J2WA 1BWCA 1GNDA 1JRZA 4H4ZA 2BCGG 3UKHA 1HYUA 3M12A 1QJDA 1CBOA 2Q6UA 2A87A 4PAAA 1JNRA 1E1NA 1EL5A 4LIIA 1ZY8A 4J34A 3NHOX 2R0GA 3DJEA 2Y6RA 1GRBA 3AE8A 3KPKA 3NH3X 1LVLA 1RYIA 3NKSA 3V76A 2GR1A 3CTYA 1D7YA 2YM2A 3I6DA 4U8LA 5JCIA 5CQFA 3SXIA 2HQMA 3LJPA 1DOCA 2Q0KA 3C4AA 2B9YA 2WETA 1EL8A 5FS8A 3UOXA 3NLCA 3R9UA 2GVCA 4TM3A 1YY5A 2YLSA 4A6NB 4M52A 5FS6A 1D7LA 2YVJA 4Z2TA 5JCLA 4NNJA 3UCLA 2C66A 4UDQA 4XWRA 3NTDA 1M64A 3AD7B 5KOXA 1FOHA 4Z2UA 1DXLA 4X9MA 1BKWA 1PBDA 2XLSA 1P2EA 3AXBA 4H4VA 5U1OA 3L1RA 3LADA 4K2XA 4BJZA 2WOWA 2BC1A 4YT0A 1H82A 2Q7VA 1MO9A 3NIXA 1D4CA 2BRAA 4H4SA 3VR9A 2X3NA 1B5QA 1OJ9A 2GR3A 5M0ZA 2R46A 3DMEA 1GRHA 3CPHG 3BNMA 3ADAB 2C3CA 2C75A 4CCQA 2WDRA 3AEFA 2WQYA 5IQ1A 3VRAA 1LQTA 1VQWA 3AE4A 3UTHA 2ZZCA 2A89A 4IVOB 4K8DA 4A65A 2GQFA 3H8IA 4NTDA 4BK2A 2XVFA 3P4PA 2XFQA 3T2KA 1GTEA 3K7TA 2GF3A 4Z44A 1TDEA 2BCPA 2FBWA 2O9ZA 2BA9A 3NK2X 4UDRA 2E4GA 3AEGA 2QA1A 2WP6A 1E1LA 1TDOA 3FG2P 3UTFA 1K0LA 3VRBA 3DJGX 1Y56B 5BUKA 2YLXA 2YVGA 3EANA 3AEEA 3BHFA 3GYIA 3LB8A 4H4YA 4XXGA 4YTMA 5ER0A 3K7MX 4CNKA 4EQRA 1REOA 3SQPA 2YLWA 2B9XA 4CBQA 2WP5A 3UKKA 4J31A 1DODA 5EB5A 1GETA 2EQ8A 1ELIA 2B9WA 3F8RA 1H81A 2FJAA 2YM1A 1Z6LA 4X9NA 3GD3A 5KNLA 3AWIA 4EQXA 1P2HA 3RP6A 1VDCA 1GALA 2XVHA 2A8XA 4EMIA 1KDGA 3QJ4A 4NEVA 1RP0A 5J60A 3DGHA 1DNCA 4N9XA 3BNUA 1CF3A 1OJTA 4NWZA 2C64A 4AT0A 2WOVA 4AT2A 4CNJA 4GAPA 3SFEA 2YVFA 2C3DA 4H4WA 3KA7A 2ZZBA 3G5QA 2YG6A 4J36A 4Z24A 1L0VA 4LU6A 3SZFA 2XFPA 3FIMB 4U8OA 1XANA 2BK5A 3EAOA 3SYIA 1K0JA 1GXFA 1E6EA 5KMRA 4UDPA 3UKQA 4FX9A 4OPIA 3H8LA 3ICRA 3KKJA 4O5UA 3T37A 2X8GA 4PABA 1N4UA 3ALMA 4C74A 1DJQA 4USRA 3BI2A 2AQJA 4B1BA 1JEHA 2WOIA 2XVJA 4JNQA 3ALJA 3D1CA 3UOYA 4YSXA 4XWZA 1LTXR 3CGCA 4TLZA 1B4VA 5J7XA 3CIRA 4EIPA 2WBAA 4NTEA 3IF9A 3B3RA 5KMSA 3P4RA 2RGOA 1DOEA 1N4VA 1N4WA 3UKPA 1ZOVA 1UKVG 2BS2A 4ADWA 4EM3A 3BI4A 1PBBA 4OPLA 2QCUA 4YKFA 1TDNA 1IUTA 2BABA 1NDAA 3I3LA 1GEUA 1L9DA 1GRAA 2JB3A 4B63A 2V3BA 4I58A 4AP1A 2YG3A 1O94A 4IA5A 4ICYA 3E1TA 3NN0X 5M10A 1GRTA 2XLUA 3GYJA 2R9ZA 2V61A 1LJ1A 1LPFA 1PXAA 3KVEA 3RP8A 3OZ2A 1F8RA 2WPFA 4H4QA 1TDKA 5HYMA 3CPJG 1CC4A 3F8PA 2RGJA 1IUWA 2RGHA 1H7WA 2XLRA 1JU2A 3CNSA 4APNA 1PS9A 3GWFA 4AOSA 3ATRA 1H6VA 1DJNA 4ECHA 2YLRA 4A99A 3KLJA 1CJ3A 1XDIA 4U8IA 2WU2A 4BK1A 4B67A 4K7ZA 3Q9TA 2BXSA 4I59A 4UP3A 2EQ9A 3AE9A 2E1MA 5C2TA 3ZDNA 2GR0A 2ZZ0A 1COYA 1OJCA 2ARDA 3AD9B 1TYPA 1TDFA 3CN8A 1CC6A 2R0CA 3QSMA 2DKHA 2WDQA 2YG4A 1EL7A 2YG7A 2CVJA 1KFYA 4CCRA 2XDOA 2CULA 4H2QA 2C4CA 2TPRA 1NENA 3K30A 3AE7A 4CY6A 2GQWA 4II2A 4CY8A 3PS9A 4B69A 2XLTA 1B37A 2BK4A 2IIDA 3NYFA 1K0IA 3AE3A 3PVCA 3SX6A 2YQUA 3SZCA 2GV8A 1VG9A 1MXTA 3DK8A 1YQZA 4G6HA 3REDA 4C5OA 1NAAA 3COXA 3UKLA 1OJDA 3IWAA 4YSYA 3ATQA 1TRBA 4IA6A 4B64A 2BK3A 2EQ6A 4YTPA 2BXRA 2BRYA 4J56A 5IQ4A 4EMJA 1KNRA 3GMCA 3QSSA 2XFNA 3FBSA 4GUVA 4BV6A 2X8HA 2X8CA 2WPCA 3ITJA 3CGDA 4OPUA 1H84A 4O5QA 2GAHB 4JY3A 1JRXA 4BK3A 3P9UA 4GR1A 4KPRA 1F6MA 2YG5A 1NG3A 1GTHA 2VRLA 4K5RA 2X99A 1KSSA 5HHFA 1FECA 3ICSA 3DA1A 3NGCX 1EL9A 4TLXA 4BJYA 1LQUA 2GB0A 2Z5XA 3AYLA 4NTCA 2XCGA 3DGZA 3PO7A 4GDPA 1ZK7A 2AR8A 3ISHA 2R0PA 5CKUA 2YR4A 2VQBA 2JBVA 2VZ2A 3AYIA 4NEWA 1L9EA 3H4KA 5U25A 2VOUA 1JOAA 3T2ZA 4U8PA 4H4PA 2V3AA 3LZXA 1GREA 3QVRA 5EOWA 5KVHA 2C76A 2C65A 1DOBA 1PBFA 3F8DA 2FJDA 3NN6X 2R45A 1N1PA 2PHHA 4TM0A 4J57A 2BACA 2JAEA 1E1MA 1D5TA 1K4QA 1S3EA 2GH5A 2TMDA 3DH9A 3DJDA 4USQA 4X4JA 4E0VA 1M6IA 3GD4A 3GDNA 4A9WA 3CNPA 4ZCDA 2UZZA 3AE2A 2VVLG 2OLOA 5GSNA 4J33A 3ICTA 3UOVA 3GRTA 1CJ4A 5JCNA 3D8XA 3KPFA 5EB4A 1BF3A 4WCTA 3CPIG 1FEAA 2JKCA 1Q1WA 3AD8B 3GWDA 4C77A 1V59A 2B7SA 2VQ7A 3K7QX 4GDEA 4H4TA 3S5WA 4NZHA 3SM8A 3G5RA 3CNDA 3VRDB 2XVIA 1PDHA 4RG4A 4U2LA 4Y4LA 2YWLA 1GESA 3NK1X 3T2YA 3C4NA 3ALLA 3RHAA 3SZ0A 1YQ3A 2DKIA 3Q6JA 1PBEA 2Z5YA 3HZLA 4DSGA 3CNTA 4AOXA 1BGNA 4K22A 1KF6A 4EM4A 2GR2A 4D03A 3QFAA 3UOZA 1JRYA 4U8KA 1S2QA 4EQWA 1GPEA 4YXDA 3IHGA 2B7RA 3B6DA 1E39A 1RSGA 1YKJA 4DGKA 4YKGA 3T0KA 2QAEA 1GV4A 4OPDA 5HXIA 1KNPA 4Z2RA 4Z25A 1AOGA 3VQRA 4MJWA 4GAVA 5FS9A 1S2YA 3KD9A 1O5WA 4TM4A 4GRTA 1NHSA 1GRGA 3RNMA 3AEAA 4G6GA 4B68A 3AE6A 5EBKA 2CFYA 1FEBA 1F8WA 4YSZA 3AE1A 1D4DA 4WX1A 3GRSA 3GSIA 4JNAA 2V6OA 3NTAA 3EPTA 3II4A 1GERA 5KMQA 3UKAA 4JDRA 4AP3A 1NHQA 2R4EA 3AYJA 1ZDLA 3AB1A 4B66A 1NPXA 3EF6A 4A7AA 4H4UA 1LV0A 3NYEA 1SEZA 4DNAA 1Y0PA 4H4XA 1IJHA 1F3PA 3NK0X 1H83A 3RP7A 4GCMA 4EQSA 3C96A 2WEUA 2V5ZA 3UP5A 2IVEA 3SGLA 4II3A 1NHPA 3QFBA 1FCDA 2APGA 2OA1A 2BC0A 3HYWA 3SZWA 2NPXA 1E7PA 2XFUA 4FK1C 5LV9A 2VVLA 1H86A 5GRTA 2VVMA 2RABA 2JB1A 3AEBA 4D04A 2WU5A 5U63A 2GMJA 2E5VA 3NT6A 2OALA 4IV9A 2C72A 4U2TA 2EQ7A 2XFOA 3VR8A 1H7XA 3CGEA 4C3XA 4DSHA 3IC9A 1L9CA 3L8KA 4Z26A 3IHMA 1ZKQA 1VG0A 3QVPA 1MOKA 4Y4MA 2JK6A 3SY4A 2ZBWA 2YR6A 4G74A 4H4RA 1NG4A 1TYTA 1Q1RA 4U8JA 4OCGA 5FMHA 3UTEA 5BRTA 5KOWA 2C7GA 1F8SA 1XHCA 1IUXA 3SFDA 1OJAA 2VRMA 1W4XA 1GT8A 2W0HA 1X31B 3O0HA 3FPZA 2GRTA 4FK1A 1CHUA 1NHRA 4BURA 4YWOA 5DBJA 2H88A 5KWFA 2XVEA 3V3NA 3ZYXA 2F5ZA 2YLZA 4Y4NA 1QLBA 1PHHA 1ZMDA 2XYOA 1ONFA 1D4EA 3NNEA 3URHA 2WESA 3UP4A 2C70A 3BI5A 2C67A 2GAGB 2WDVA 4H2NA 1PJ6A 4IVMB 3QSEA 1ZP0A 1PXBA 3OC4A 1BGJA 4JY2A 1ZMCA 2WPEA 3GYXA 1PBCA 2Y6QA 2B76A 3CMMA 3HYXA 2BYBA 2YLTA 2I0ZA 4TM1A 2IVDA 2Q0LA 3NYCA 1IUSA 1Q9IA 2XLPA 2CDUA 5JCKA 2ACZA 3AEDA 4RG3A 4A79A 3P4SA 2FJBA 1S3BA 5KXJA 2J3NA 2OAMA 3P4QA 3S61A 3DK9A 2PYXA 3NG7X 3T14A 4H50A 4ZN0A 1JNZA 3UKFA 2X50A 4OPTA 3FMWA 2C73A 2FJEA 5KMPA 2R4JA 4YTNA 4H7UA 3T31A 3JSKA 5BVAA 1BZLA 2V60A 2WHDA 3LXDA 4JQ9A 1XPQA 4B65A 2BS4A 4Z43A 1PJ5A 4U8NA 1PXCA 4A6NA 3GDPA 1QO8A 1CJCA 1KSUA 4A5LA 4OPGA 4U2SA 1IUVA 1GSNA 1NEKA 3G5SA 4CRTA 1IUUA 4HA6A 3AE5A 5C3JA 3DJJA 4OPCA 4HB9A 3GMBA 1EBDA 5BULA 4G9KA 1GRFA 1GOSA 5FS7A 1VRQB 3CNJA 4P9SA 3M0OA 3LZWA 4EIQA 5JCMA 4U8MA 4JN9A 4C3YA 2BS3A 5L46A 3CGBA 3ABVA 5HY5A 4H2PA 4H2RA 2GMHA 1CJ2A 1E1KA 1B8SA 2WS3A 3AECA 3HYVA 4REKA 2WP9A 4LA1A 3WE0A 1O95A 4EMWA 4YSHA 3LOVA 3M13A 1PJ7A 2AAQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KVI A;  4GF7 A;  3UTG A;  2H89 A;  1CL0 A;  4FDC B;  2QA2 A;  4ZCC A;  4K5S A;  1YQ4 A;  2YAU A;  4OVI A;  5IPY A;  1ZX9 A;  2GEW A;  3KU9 A;  4RSL A;  3DK4 A;  1Y56 A;  5KRQ A;  3NRN A;  1FL2 A;  2NVK X;  2YR5 A;  1ZOY A;  3P1W A;  3V3O A;  1PN0 A;  3BHK A;  5TR3 A;  4KX6 A;  1CC2 A;  2JB2 A;  2OLN A;  4J2W A;  1BWC A;  1GND A;  1JRZ A;  4H4Z A;  2BCG G;  3UKH A;  1HYU A;  3M12 A;  1QJD A;  1CBO A;  2Q6U A;  2A87 A;  4PAA A;  1JNR A;  1E1N A;  1EL5 A;  4LII A;  1ZY8 A;  4J34 A;  3NHO X;  2R0G A;  3DJE A;  2Y6R A;  1GRB A;  3AE8 A;  3NH3 X;  1LVL A;  1RYI A;  3NKS A;  3V76 A;  2GR1 A;  3CTY A;  1D7Y A;  2YM2 A;  3I6D A;  4U8L A;  5JCI A;  5CQF A;  2HQM A;  3LJP A;  1DOC A;  2Q0K A;  2B9Y A;  2WET A;  3C4A A;  1EL8 A;  5FS8 A;  3UOX A;  3NLC A;  3R9U A;  2GVC A;  4TM3 A;  1YY5 A;  2YLS A;  4A6N B;  4M52 A;  5FS6 A;  1D7L A;  2YVJ A;  4Z2T A;  5JCL A;  3UCL A;  2C66 A;  4UDQ A;  4XWR A;  3NTD A;  1M64 A;  3AD7 B;  5KOX A;  1FOH A;  4Z2U A;  1DXL A;  4X9M A;  1BKW A;  1PBD A;  2XLS A;  1P2E A;  3AXB A;  4H4V A;  5U1O A;  3L1R A;  3LAD A;  4K2X A;  4BJZ A;  2WOW A;  2BC1 A;  4YT0 A;  1H82 A;  2Q7V A;  1MO9 A;  3NIX A;  1D4C A;  4H4S A;  3VR9 A;  2X3N A;  1B5Q A;  1OJ9 A;  2GR3 A;  5M0Z A;  2R46 A;  3DME A;  1GRH A;  3CPH G;  3BNM A;  3ADA B;  2C3C A;  2C75 A;  4CCQ A;  2WDR A;  3AEF A;  2WQY A;  5IQ1 A;  3VRA A;  1LQT A;  1VQW A;  3AE4 A;  3UTH A;  2ZZC A;  2A89 A;  4IVO B;  4K8D A;  4A65 A;  2GQF A;  3H8I A;  4NTD A;  4BK2 A;  2XVF A;  3P4P A;  2XFQ A;  1GTE A;  3K7T A;  2GF3 A;  4Z44 A;  1TDE A;  2BCP A;  2FBW A;  2O9Z A;  2BA9 A;  3NK2 X;  4UDR A;  2E4G A;  3AEG A;  2QA1 A;  2WP6 A;  1E1L A;  1TDO A;  3FG2 P;  3UTF A;  1K0L A;  3VRB A;  3DJG X;  1Y56 B;  5BUK A;  2YLX A;  2YVG A;  3EAN A;  3AEE A;  3BHF A;  3GYI A;  3LB8 A;  4H4Y A;  4XXG A;  4YTM A;  5ER0 A;  3K7M X;  4CNK A;  4EQR A;  1REO A;  3SQP A;  2YLW A;  2B9X A;  4CBQ A;  2WP5 A;  3UKK A;  4J31 A;  1DOD A;  5EB5 A;  1GET A;  2EQ8 A;  1ELI A;  2B9W A;  3F8R A;  1H81 A;  2FJA A;  2YM1 A;  1Z6L A;  4X9N A;  3GD3 A;  3AWI A;  4EQX A;  1P2H A;  3RP6 A;  1VDC A;  1GAL A;  2XVH A;  2A8X A;  4EMI A;  1KDG A;  3QJ4 A;  4NEV A;  1RP0 A;  5J60 A;  3DGH A;  1DNC A;  4N9X A;  3BNU A;  1CF3 A;  1OJT A;  2C64 A;  4AT0 A;  2WOV A;  4AT2 A;  4CNJ A;  3SFE A;  2YVF A;  2C3D A;  4H4W A;  3KA7 A;  2ZZB A;  3G5Q A;  2YG6 A;  4J36 A;  4Z24 A;  1L0V A;  4LU6 A;  2XFP A;  3FIM B;  4U8O A;  1XAN A;  2BK5 A;  3EAO A;  1K0J A;  1GXF A;  1E6E A;  4UDP A;  3UKQ A;  4FX9 A;  4OPI A;  3H8L A;  3ICR A;  3KKJ A;  4O5U A;  3T37 A;  2X8G A;  4PAB A;  1N4U A;  3ALM A;  4C74 A;  1DJQ A;  4USR A;  3BI2 A;  2AQJ A;  4B1B A;  1JEH A;  2WOI A;  2XVJ A;  4JNQ A;  3ALJ A;  3D1C A;  3UOY A;  4YSX A;  4XWZ A;  1LTX R;  3CGC A;  4TLZ A;  1B4V A;  5J7X A;  3CIR A;  4EIP A;  2WBA A;  4NTE A;  3IF9 A;  3B3R A;  3P4R A;  2RGO A;  1DOE A;  1N4V A;  1N4W A;  3UKP A;  1ZOV A;  1UKV G;  2BS2 A;  4ADW A;  4EM3 A;  3BI4 A;  1PBB A;  4OPL A;  2QCU A;  4YKF A;  1TDN A;  1IUT A;  2BAB A;  1NDA A;  3I3L A;  1GEU A;  1L9D A;  1GRA A;  2JB3 A;  4B63 A;  2V3B A;  4I58 A;  4AP1 A;  2YG3 A;  1O94 A;  4IA5 A;  4ICY A;  3E1T A;  3NN0 X;  5M10 A;  1GRT A;  2XLU A;  3GYJ A;  2R9Z A;  2V61 A;  1LJ1 A;  1LPF A;  1PXA A;  3KVE A;  3OZ2 A;  3RP8 A;  1F8R A;  2WPF A;  4H4Q A;  1TDK A;  5HYM A;  3CPJ G;  1CC4 A;  3F8P A;  2RGJ A;  1IUW A;  2RGH A;  1H7W A;  2XLR A;  1JU2 A;  3CNS A;  4APN A;  1PS9 A;  3GWF A;  4AOS A;  3ATR A;  1H6V A;  1DJN A;  4ECH A;  2YLR A;  4A99 A;  3KLJ A;  1CJ3 A;  1XDI A;  4U8I A;  2WU2 A;  4B67 A;  4BK1 A;  4K7Z A;  3Q9T A;  2BXS A;  4I59 A;  4UP3 A;  2EQ9 A;  3AE9 A;  2E1M A;  5C2T A;  3ZDN A;  2GR0 A;  2ZZ0 A;  1COY A;  1OJC A;  2ARD A;  3AD9 B;  1TYP A;  1TDF A;  3CN8 A;  1CC6 A;  2R0C A;  3QSM A;  2DKH A;  2WDQ A;  2YG4 A;  1EL7 A;  2YG7 A;  2CVJ A;  1KFY A;  4CCR A;  2XDO A;  2CUL A;  4H2Q A;  2TPR A;  1NEN A;  3K30 A;  3AE7 A;  4CY6 A;  2GQW A;  4CY8 A;  3PS9 A;  4B69 A;  2XLT A;  1B37 A;  2BK4 A;  2IID A;  3NYF A;  1K0I A;  3AE3 A;  3PVC A;  5KWF A;  2YQU A;  2GV8 A;  1VG9 A;  1MXT A;  3DK8 A;  1YQZ A;  3RED A;  4C5O A;  1NAA A;  3COX A;  3UKL A;  1OJD A;  3IWA A;  4YSY A;  3ATQ A;  1TRB A;  4IA6 A;  4B64 A;  2BK3 A;  2EQ6 A;  4YTP A;  2BXR A;  4J56 A;  5IQ4 A;  4EMJ A;  1KNR A;  3GMC A;  3QSS A;  2XFN A;  3FBS A;  4GUV A;  4BV6 A;  2X8H A;  2X8C A;  2WPC A;  3ITJ A;  3CGD A;  4OPU A;  1H84 A;  4O5Q A;  2GAH B;  4JY3 A;  1JRX A;  3P9U A;  4BK3 A;  4GR1 A;  4KPR A;  1F6M A;  2YG5 A;  1NG3 A;  1GTH A;  2VRL A;  4K5R A;  2X99 A;  1KSS A;  5HHF A;  1FEC A;  3ICS A;  3DA1 A;  3NGC X;  1EL9 A;  4TLX A;  4BJY A;  1LQU A;  2GB0 A;  2Z5X A;  3AYL A;  4NTC A;  2XCG A;  3DGZ A;  3PO7 A;  4GDP A;  1ZK7 A;  2AR8 A;  3ISH A;  2R0P A;  5CKU A;  2YR4 A;  2VQB A;  2JBV A;  2VZ2 A;  3AYI A;  4NEW A;  1L9E A;  3H4K A;  5U25 A;  2VOU A;  1JOA A;  4U8P A;  4H4P A;  2V3A A;  3LZX A;  1GRE A;  3QVR A;  5EOW A;  5KVH A;  2C76 A;  2C65 A;  1DOB A;  1PBF A;  3F8D A;  2FJD A;  3NN6 X;  2R45 A;  1N1P A;  2PHH A;  4TM0 A;  4J57 A;  2BAC A;  2JAE A;  1E1M A;  1D5T A;  1K4Q A;  1S3E A;  2GH5 A;  2TMD A;  3DH9 A;  3DJD A;  4USQ A;  4X4J A;  4E0V A;  1M6I A;  3GD4 A;  3GDN A;  4A9W A;  3CNP A;  4ZCD A;  2UZZ A;  3AE2 A;  2VVL G;  2OLO A;  5GSN A;  4J33 A;  3ICT A;  3UOV A;  3GRT A;  1CJ4 A;  5JCN A;  3D8X A;  3KPF A;  5EB4 A;  1BF3 A;  4WCT A;  3CPI G;  1FEA A;  2JKC A;  1Q1W A;  3AD8 B;  3GWD A;  4C77 A;  1V59 A;  2B7S A;  2VQ7 A;  3K7Q X;  4GDE A;  4H4T A;  3S5W A;  4NZH A;  3SM8 A;  3G5R A;  3CND A;  3VRD B;  2XVI A;  1PDH A;  4RG4 A;  4U2L A;  4Y4L A;  2YWL A;  1GES A;  3NK1 X;  3C4N A;  3ALL A;  3RHA A;  1YQ3 A;  2DKI A;  3Q6J A;  1PBE A;  2Z5Y A;  3HZL A;  4DSG A;  3CNT A;  4AOX A;  1BGN A;  4K22 A;  1KF6 A;  4EM4 A;  2GR2 A;  4D03 A;  3QFA A;  3UOZ A;  1JRY A;  4U8K A;  1S2Q A;  4EQW A;  1GPE A;  4YXD A;  3IHG A;  2B7R A;  3B6D A;  1E39 A;  1RSG A;  1YKJ A;  4DGK A;  4YKG A;  2QAE A;  1GV4 A;  4OPD A;  5HXI A;  1KNP A;  4Z2R A;  4Z25 A;  1AOG A;  3VQR A;  4MJW A;  5FS9 A;  1S2Y A;  3KD9 A;  1O5W A;  4TM4 A;  4GRT A;  1NHS A;  1GRG A;  3RNM A;  3AEA A;  4B68 A;  3AE6 A;  5EBK A;  2CFY A;  1FEB A;  1F8W A;  4YSZ A;  3AE1 A;  1D4D A;  4WX1 A;  3GRS A;  3GSI A;  4JNA A;  2V6O A;  3NTA A;  3EPT A;  3II4 A;  1GER A;  3UKA A;  4JDR A;  4AP3 A;  1NHQ A;  2R4E A;  3AYJ A;  1ZDL A;  3AB1 A;  4B66 A;  1NPX A;  3EF6 A;  4A7A A;  4H4U A;  1LV0 A;  3NYE A;  1SEZ A;  4DNA A;  1Y0P A;  4H4X A;  1IJH A;  1F3P A;  3NK0 X;  1H83 A;  4GCM A;  3RP7 A;  4EQS A;  2WEU A;  3C96 A;  2V5Z A;  3UP5 A;  2IVE A;  3SGL A;  1NHP A;  3QFB A;  1FCD A;  2APG A;  2OA1 A;  2BC0 A;  2NPX A;  1E7P A;  2XFU A;  4FK1 C;  5LV9 A;  2VVL A;  1H86 A;  5GRT A;  2VVM A;  2RAB A;  2JB1 A;  3AEB A;  4D04 A;  2WU5 A;  5U63 A;  2GMJ A;  2E5V A;  3NT6 A;  2OAL A;  4IV9 A;  2C72 A;  4U2T A;  2EQ7 A;  2XFO A;  3VR8 A;  1H7X A;  3CGE A;  4C3X A;  4DSH A;  3IC9 A;  1L9C A;  3L8K A;  4Z26 A;  3IHM A;  1ZKQ A;  1VG0 A;  3QVP A;  1MOK A;  4Y4M A;  2JK6 A;  2ZBW A;  2YR6 A;  4H4R A;  1NG4 A;  1TYT A;  1Q1R A;  4U8J A;  4OCG A;  5FMH A;  3UTE A;  5BRT A;  5KOW A;  2C7G A;  1F8S A;  1XHC A;  1IUX A;  3SFD A;  1OJA A;  2VRM A;  1W4X A;  1GT8 A;  2W0H A;  1X31 B;  3O0H A;  3FPZ A;  2GRT A;  4FK1 A;  1CHU A;  1NHR A;  4BUR A;  4YWO A;  5DBJ A;  2H88 A;  2XVE A;  3V3N A;  3ZYX A;  2F5Z A;  2YLZ A;  4Y4N A;  1QLB A;  1PHH A;  1ZMD A;  2XYO A;  1ONF A;  1D4E A;  3NNE A;  3URH A;  2WES A;  3UP4 A;  2C70 A;  3BI5 A;  2C67 A;  2GAG B;  2WDV A;  4H2N A;  1PJ6 A;  4IVM B;  3QSE A;  1ZP0 A;  1PXB A;  3OC4 A;  1BGJ A;  4JY2 A;  1ZMC A;  2WPE A;  1PBC A;  2Y6Q A;  2B76 A;  2BYB A;  2YLT A;  2I0Z A;  4TM1 A;  2IVD A;  2Q0L A;  3NYC A;  1IUS A;  1Q9I A;  2XLP A;  2CDU A;  5JCK A;  2ACZ A;  3AED A;  4RG3 A;  4A79 A;  3P4S A;  2FJB A;  1S3B A;  5KXJ A;  2J3N A;  2OAM A;  3P4Q A;  3S61 A;  3DK9 A;  2PYX A;  3NG7 X;  4H50 A;  4ZN0 A;  1JNZ A;  3UKF A;  2X50 A;  4OPT A;  3FMW A;  2C73 A;  2FJE A;  2R4J A;  4YTN A;  4H7U A;  3JSK A;  5BVA A;  1BZL A;  2V60 A;  2WHD A;  3LXD A;  4JQ9 A;  1XPQ A;  4B65 A;  2BS4 A;  4Z43 A;  1PJ5 A;  4U8N A;  1PXC A;  4A6N A;  3GDP A;  1QO8 A;  1CJC A;  1KSU A;  4A5L A;  4OPG A;  4U2S A;  1IUV A;  1GSN A;  1NEK A;  3G5S A;  4CRT A;  1IUU A;  4HA6 A;  3AE5 A;  5C3J A;  3DJJ A;  4OPC A;  4HB9 A;  3GMB A;  1EBD A;  5BUL A;  1GRF A;  1GOS A;  5FS7 A;  1VRQ B;  3CNJ A;  4P9S A;  3M0O A;  3LZW A;  4EIQ A;  5JCM A;  4U8M A;  4JN9 A;  4C3Y A;  2BS3 A;  5L46 A;  3CGB A;  3ABV A;  5HY5 A;  4H2P A;  4H2R A;  1CJ2 A;  1E1K A;  2GMH A;  1B8S A;  2WS3 A;  3AEC A;  4REK A;  3WE0 A;  2WP9 A;  4LA1 A;  4EMW A;  1O95 A;  4YSH A;  3LOV A;  3M13 A;  1PJ7 A;  2AAQ A; 
#chains in the Genus database with same CATH topology
 5KVI A;  4GF7 A;  3UTG A;  2H89 A;  1CL0 A;  4FDC B;  2QA2 A;  4ZCC A;  4K5S A;  1YQ4 A;  2YAU A;  4OVI A;  5IPY A;  1ZX9 A;  2GEW A;  3KU9 A;  4RSL A;  3DK4 A;  1Y56 A;  5KRQ A;  4G73 A;  3NRN A;  1FL2 A;  2NVK X;  2YR5 A;  1ZOY A;  3P1W A;  3V3O A;  1PN0 A;  3BHK A;  5TR3 A;  4KX6 A;  1CC2 A;  2JB2 A;  2OLN A;  4J2W A;  1BWC A;  1GND A;  1JRZ A;  4H4Z A;  2BCG G;  3UKH A;  1HYU A;  3M12 A;  1QJD A;  1CBO A;  2Q6U A;  2A87 A;  4PAA A;  1JNR A;  1E1N A;  1EL5 A;  4LII A;  1ZY8 A;  4J34 A;  3NHO X;  2R0G A;  3DJE A;  2Y6R A;  1GRB A;  3AE8 A;  3KPK A;  3NH3 X;  1RYI A;  1LVL A;  3NKS A;  3V76 A;  2GR1 A;  3CTY A;  1D7Y A;  2YM2 A;  3I6D A;  4U8L A;  5JCI A;  5CQF A;  3SXI A;  2HQM A;  3LJP A;  1DOC A;  2Q0K A;  3C4A A;  2B9Y A;  2WET A;  1EL8 A;  5FS8 A;  3UOX A;  3NLC A;  3R9U A;  2GVC A;  4TM3 A;  1YY5 A;  2YLS A;  4A6N B;  4M52 A;  5FS6 A;  1D7L A;  2YVJ A;  4Z2T A;  5JCL A;  4NNJ A;  3UCL A;  2C66 A;  3W4I A;  4UDQ A;  4XWR A;  3NTD A;  1M64 A;  3AD7 B;  5KOX A;  1FOH A;  4Z2U A;  4X9M A;  1DXL A;  1BKW A;  1PBD A;  2XLS A;  1P2E A;  3AXB A;  4H4V A;  5U1O A;  3L1R A;  3LAD A;  4K2X A;  4BJZ A;  2WOW A;  2BC1 A;  4YT0 A;  1H82 A;  2Q7V A;  1MO9 A;  3NIX A;  1D4C A;  2BRA A;  4H4S A;  3VR9 A;  2X3N A;  1B5Q A;  1OJ9 A;  2GR3 A;  5M0Z A;  2R46 A;  3DME A;  1GRH A;  3CPH G;  3BNM A;  3ADA B;  2C3C A;  2C75 A;  4CCQ A;  2WDR A;  3AEF A;  2WQY A;  5IQ1 A;  3VRA A;  1LQT A;  1VQW A;  3AE4 A;  3UTH A;  2ZZC A;  2A89 A;  4IVO B;  4K8D A;  4A65 A;  2GQF A;  3H8I A;  4NTD A;  4BK2 A;  2XVF A;  3P4P A;  2XFQ A;  3T2K A;  1GTE A;  3K7T A;  2GF3 A;  4Z44 A;  1TDE A;  2BCP A;  2FBW A;  2O9Z A;  2BA9 A;  3NK2 X;  4UDR A;  2E4G A;  3AEG A;  2QA1 A;  2WP6 A;  1E1L A;  1TDO A;  3FG2 P;  3UTF A;  1K0L A;  3VRB A;  3DJG X;  1Y56 B;  5BUK A;  2YLX A;  2YVG A;  3EAN A;  3AEE A;  3BHF A;  3GYI A;  3LB8 A;  4H4Y A;  4XXG A;  4YTM A;  5ER0 A;  3K7M X;  4CNK A;  4EQR A;  1REO A;  3SQP A;  2YLW A;  2B9X A;  4CBQ A;  2WP5 A;  3UKK A;  4J31 A;  1DOD A;  5EB5 A;  1GET A;  2EQ8 A;  1ELI A;  2B9W A;  3F8R A;  1H81 A;  2FJA A;  2YM1 A;  1Z6L A;  4X9N A;  3GD3 A;  5KNL A;  3AWI A;  4EQX A;  1P2H A;  3RP6 A;  1VDC A;  1GAL A;  2XVH A;  2A8X A;  4EMI A;  1KDG A;  3QJ4 A;  4NEV A;  1RP0 A;  5J60 A;  3DGH A;  1DNC A;  4N9X A;  3BNU A;  1CF3 A;  1OJT A;  4NWZ A;  2C64 A;  4AT0 A;  2WOV A;  4AT2 A;  4CNJ A;  4GAP A;  3SFE A;  2YVF A;  2C3D A;  4H4W A;  2E49 A;  3KA7 A;  2ZZB A;  3G5Q A;  2YG6 A;  4J36 A;  4Z24 A;  1L0V A;  4LU6 A;  3SZF A;  2XFP A;  3FIM B;  4QFD A;  1XAN A;  2BK5 A;  3EAO A;  4U8O A;  3SYI A;  1K0J A;  1GXF A;  1E6E A;  5KMR A;  4UDP A;  3UKQ A;  4FX9 A;  4OPI A;  3H8L A;  3ICR A;  3KKJ A;  4O5U A;  3T37 A;  2X8G A;  4PAB A;  1N4U A;  3ALM A;  4C74 A;  1DJQ A;  4USR A;  3BI2 A;  2AQJ A;  4B1B A;  1VE9 A;  1JEH A;  2WOI A;  2XVJ A;  4JNQ A;  3ALJ A;  3D1C A;  3UOY A;  4YSX A;  4XWZ A;  1LTX R;  3CGC A;  4TLZ A;  4QFC A;  1B4V A;  5J7X A;  3CIR A;  4EIP A;  2WBA A;  4NTE A;  3IF9 A;  3B3R A;  5KMS A;  3P4R A;  2RGO A;  1DOE A;  1N4V A;  1N4W A;  3UKP A;  1ZOV A;  1UKV G;  2BS2 A;  4ADW A;  4EM3 A;  3BI4 A;  1PBB A;  4OPL A;  2QCU A;  4YKF A;  1TDN A;  1IUT A;  2BAB A;  1NDA A;  3I3L A;  1GEU A;  1L9D A;  1GRA A;  2JB3 A;  4B63 A;  2V3B A;  4I58 A;  4AP1 A;  2YG3 A;  1O94 A;  4IA5 A;  4ICY A;  3E1T A;  3NN0 X;  5M10 A;  1GRT A;  2XLU A;  3GYJ A;  2R9Z A;  2V61 A;  1LJ1 A;  1LPF A;  1PXA A;  3KVE A;  3OZ2 A;  3RP8 A;  1F8R A;  2WPF A;  4H4Q A;  1TDK A;  5HYM A;  3CPJ G;  1CC4 A;  3F8P A;  2RGJ A;  1IUW A;  2RGH A;  1H7W A;  2XLR A;  1JU2 A;  3CNS A;  4APN A;  1PS9 A;  3GWF A;  4AOS A;  3ATR A;  1H6V A;  1DJN A;  4ECH A;  2YLR A;  4A99 A;  3KLJ A;  1CJ3 A;  1XDI A;  1DDO A;  4U8I A;  2WU2 A;  4BK1 A;  4B67 A;  4K7Z A;  3Q9T A;  2BXS A;  4I59 A;  4UP3 A;  2EQ9 A;  3AE9 A;  1C0P A;  2E1M A;  5C2T A;  3ZDN A;  2GR0 A;  2ZZ0 A;  4YJH A;  3AD9 B;  1COY A;  1OJC A;  2ARD A;  1TYP A;  1TDF A;  3CN8 A;  3W4K A;  1CC6 A;  2R0C A;  3QSM A;  2DKH A;  2WDQ A;  2YG4 A;  1EL7 A;  2YG7 A;  2CVJ A;  1KFY A;  4CCR A;  2XDO A;  2CUL A;  3W4J A;  4H2Q A;  2C4C A;  2TPR A;  1NEN A;  3K30 A;  3AE7 A;  4CY6 A;  2GQW A;  4II2 A;  4CY8 A;  3PS9 A;  4B69 A;  2XLT A;  1B37 A;  3NYF A;  2BK4 A;  2IID A;  1K0I A;  3PVC A;  3AE3 A;  3SX6 A;  2YQU A;  3SZC A;  2GV8 A;  1VG9 A;  1MXT A;  3DK8 A;  1YQZ A;  4G6H A;  3RED A;  4C5O A;  1NAA A;  3COX A;  3UKL A;  1OJD A;  3IWA A;  4YSY A;  3ATQ A;  1TRB A;  4IA6 A;  4B64 A;  2BK3 A;  2EQ6 A;  4YTP A;  2BXR A;  2BRY A;  4J56 A;  5IQ4 A;  4EMJ A;  4YJG A;  3GMC A;  1KNR A;  3G3E A;  3QSS A;  2XFN A;  3FBS A;  4GUV A;  4BV6 A;  2DU8 A;  2X8H A;  2X8C A;  2WPC A;  3ITJ A;  3CGD A;  4OPU A;  3CUK A;  1H84 A;  4O5Q A;  2GAH B;  4JY3 A;  1JRX A;  4BK3 A;  3P9U A;  4GR1 A;  4KPR A;  1F6M A;  2YG5 A;  1NG3 A;  1GTH A;  2VRL A;  4K5R A;  2X99 A;  1KSS A;  5HHF A;  1FEC A;  3ICS A;  3DA1 A;  3NGC X;  1EL9 A;  4TLX A;  4BJY A;  1LQU A;  2GB0 A;  2Z5X A;  3AYL A;  4NTC A;  3ZNQ A;  2XCG A;  3WGT A;  3DGZ A;  3PO7 A;  4GDP A;  1C0K A;  1ZK7 A;  2AR8 A;  3ISH A;  2R0P A;  5CKU A;  2YR4 A;  2VQB A;  2JBV A;  2VZ2 A;  2E82 A;  3AYI A;  1L9E A;  3H4K A;  4NEW A;  5U25 A;  2VOU A;  1JOA A;  3T2Z A;  4U8P A;  4H4P A;  2V3A A;  3LZX A;  1GRE A;  3QVR A;  5EOW A;  5KVH A;  2C76 A;  2C65 A;  1DOB A;  1PBF A;  3F8D A;  2FJD A;  3NN6 X;  2R45 A;  1N1P A;  2PHH A;  4TM0 A;  4J57 A;  2BAC A;  3DJD A;  1E1M A;  1D5T A;  1K4Q A;  1S3E A;  2GH5 A;  2JAE A;  2TMD A;  3DH9 A;  4USQ A;  4X4J A;  4E0V A;  1M6I A;  3GD4 A;  3GDN A;  4A9W A;  3CNP A;  4ZCD A;  2UZZ A;  3AE2 A;  2VVL G;  2OLO A;  5GSN A;  4J33 A;  3ICT A;  4YJH B;  3UOV A;  3GRT A;  1CJ4 A;  5JCN A;  3D8X A;  3KPF A;  5EB4 A;  1BF3 A;  4WCT A;  3ZNN A;  3CPI G;  1FEA A;  3AD8 B;  1Q1W A;  2JKC A;  3GWD A;  4C77 A;  1V59 A;  2B7S A;  2VQ7 A;  3K7Q X;  4GDE A;  4H4T A;  3S5W A;  4NZH A;  3SM8 A;  3G5R A;  3CND A;  3VRD B;  2XVI A;  1PDH A;  4RG4 A;  4U2L A;  4Y4L A;  2YWL A;  1GES A;  3NK1 X;  3T2Y A;  3C4N A;  3ALL A;  3RHA A;  3SZ0 A;  1YQ3 A;  2DKI A;  3Q6J A;  1PBE A;  2Z5Y A;  3HZL A;  4DSG A;  3CNT A;  4AOX A;  1BGN A;  4K22 A;  1KF6 A;  4EM4 A;  2GR2 A;  4D03 A;  3QFA A;  3UOZ A;  1JRY A;  4U8K A;  1S2Q A;  4EQW A;  3ZNP A;  1GPE A;  3IHG A;  2B7R A;  4YXD A;  3B6D A;  1E39 A;  1YKJ A;  1RSG A;  4DGK A;  4YKG A;  3T0K A;  2QAE A;  1GV4 A;  4OPD A;  1C0I A;  5HXI A;  1KNP A;  4YJG B;  4Z2R A;  4Z25 A;  4YJF A;  1AOG A;  3VQR A;  4MJW A;  4GAV A;  5FS9 A;  1S2Y A;  3KD9 A;  1O5W A;  4TM4 A;  4GRT A;  1NHS A;  1GRG A;  3RNM A;  3AEA A;  4G6G A;  4B68 A;  3AE6 A;  5EBK A;  2CFY A;  1FEB A;  1F8W A;  4YSZ A;  3AE1 A;  1D4D A;  4WX1 A;  3GSI A;  3GRS A;  4JNA A;  2V6O A;  3NTA A;  3EPT A;  3II4 A;  1GER A;  5KMQ A;  3UKA A;  4JDR A;  4AP3 A;  1NHQ A;  2R4E A;  3ZNO A;  3AYJ A;  1AN9 A;  1ZDL A;  3AB1 A;  4B66 A;  1NPX A;  3EF6 A;  4A7A A;  4H4U A;  3NYE A;  1LV0 A;  1SEZ A;  4DNA A;  1Y0P A;  4H4X A;  1IJH A;  1F3P A;  3NK0 X;  1H83 A;  3RP7 A;  4GCM A;  4EQS A;  3C96 A;  2WEU A;  2V5Z A;  3UP5 A;  2IVE A;  3SGL A;  4II3 A;  1NHP A;  3QFB A;  1FCD A;  2APG A;  2OA1 A;  2BC0 A;  3HYW A;  3SZW A;  2NPX A;  1E7P A;  2XFU A;  4FK1 C;  5LV9 A;  2VVL A;  1H86 A;  5GRT A;  2VVM A;  2RAB A;  2JB1 A;  3AEB A;  4D04 A;  2WU5 A;  5U63 A;  2GMJ A;  2E5V A;  3NT6 A;  2OAL A;  4IV9 A;  2C72 A;  4U2T A;  2EQ7 A;  2XFO A;  3VR8 A;  1H7X A;  3CGE A;  4C3X A;  4DSH A;  3IC9 A;  1L9C A;  3L8K A;  4Z26 A;  3IHM A;  1ZKQ A;  1VG0 A;  3QVP A;  1MOK A;  4Y4M A;  2JK6 A;  3SY4 A;  2ZBW A;  2YR6 A;  4G74 A;  4H4R A;  1NG4 A;  1TYT A;  1Q1R A;  4U8J A;  4OCG A;  5FMH A;  3UTE A;  5BRT A;  5KOW A;  2C7G A;  1F8S A;  1XHC A;  1IUX A;  3SFD A;  1OJA A;  2VRM A;  1W4X A;  1GT8 A;  2W0H A;  1X31 B;  3O0H A;  3FPZ A;  2GRT A;  4FK1 A;  1CHU A;  1NHR A;  4BUR A;  4YWO A;  5DBJ A;  2H88 A;  5KWF A;  2XVE A;  3V3N A;  3ZYX A;  2F5Z A;  2YLZ A;  4Y4N A;  1QLB A;  1PHH A;  1ZMD A;  2XYO A;  1ONF A;  1D4E A;  3NNE A;  3URH A;  2WES A;  3UP4 A;  2C70 A;  3BI5 A;  2C67 A;  2GAG B;  2WDV A;  4H2N A;  1PJ6 A;  4IVM B;  3QSE A;  1ZP0 A;  1PXB A;  3OC4 A;  1C0L A;  1BGJ A;  4JY2 A;  4YJF B;  1ZMC A;  2WPE A;  3GYX A;  1PBC A;  2Y6Q A;  2B76 A;  3CMM A;  1KIF A;  3HYX A;  1EVI A;  2BYB A;  2E4A A;  2I0Z A;  2YLT A;  4TM1 A;  2Q0L A;  2IVD A;  3NYC A;  1IUS A;  1Q9I A;  2XLP A;  2CDU A;  5JCK A;  2ACZ A;  3AED A;  4RG3 A;  4A79 A;  3P4S A;  2FJB A;  1S3B A;  4YJD A;  5KXJ A;  2J3N A;  2OAM A;  3P4Q A;  3S61 A;  3DK9 A;  2PYX A;  3NG7 X;  3T14 A;  4H50 A;  4ZN0 A;  1JNZ A;  3UKF A;  2X50 A;  4OPT A;  3FMW A;  2C73 A;  2FJE A;  5KMP A;  2R4J A;  4YTN A;  4H7U A;  3T31 A;  3JSK A;  5BVA A;  1BZL A;  2V60 A;  2WHD A;  3LXD A;  4JQ9 A;  1XPQ A;  4B65 A;  2BS4 A;  4Z43 A;  1PJ5 A;  4U8N A;  1DAO A;  1PXC A;  4A6N A;  3GDP A;  1QO8 A;  1CJC A;  1KSU A;  4A5L A;  4OPG A;  4U2S A;  1IUV A;  1GSN A;  1NEK A;  3G5S A;  4CRT A;  1IUU A;  4HA6 A;  3AE5 A;  5C3J A;  3DJJ A;  4OPC A;  4HB9 A;  3GMB A;  1EBD A;  5BUL A;  4G9K A;  1GRF A;  1GOS A;  5FS7 A;  1VRQ B;  4P9S A;  3CNJ A;  3M0O A;  3LZW A;  4EIQ A;  5JCM A;  2E48 A;  4U8M A;  4JN9 A;  4C3Y A;  2BS3 A;  5L46 A;  3CGB A;  3ABV A;  5HY5 A;  4H2P A;  4H2R A;  1CJ2 A;  2GMH A;  1E1K A;  1B8S A;  2WS3 A;  3AEC A;  3HYV A;  4YSH A;  2WP9 A;  4LA1 A;  4REK A;  1O95 A;  3WE0 A;  4EMW A;  3LOV A;  3M13 A;  1PJ7 A;  2AAQ A; 
#chains in the Genus database with same CATH homology
 5KVI A;  4GF7 A;  3UTG A;  2H89 A;  1CL0 A;  4FDC B;  2QA2 A;  4ZCC A;  4K5S A;  1YQ4 A;  2YAU A;  4OVI A;  5IPY A;  1ZX9 A;  2GEW A;  3KU9 A;  4RSL A;  3DK4 A;  1Y56 A;  5KRQ A;  4G73 A;  3NRN A;  1FL2 A;  2NVK X;  2YR5 A;  1ZOY A;  3P1W A;  3V3O A;  1PN0 A;  3BHK A;  5TR3 A;  4KX6 A;  1CC2 A;  2JB2 A;  2OLN A;  4J2W A;  1BWC A;  1GND A;  1JRZ A;  4H4Z A;  2BCG G;  3UKH A;  1HYU A;  3M12 A;  1QJD A;  1CBO A;  2Q6U A;  2A87 A;  4PAA A;  1JNR A;  1E1N A;  1EL5 A;  4LII A;  1ZY8 A;  4J34 A;  3NHO X;  2R0G A;  3DJE A;  2Y6R A;  1GRB A;  3AE8 A;  3KPK A;  3NH3 X;  1LVL A;  1RYI A;  3NKS A;  3V76 A;  2GR1 A;  3CTY A;  1D7Y A;  2YM2 A;  3I6D A;  4U8L A;  5JCI A;  5CQF A;  3SXI A;  2HQM A;  3LJP A;  1DOC A;  2Q0K A;  3C4A A;  2B9Y A;  2WET A;  1EL8 A;  5FS8 A;  3UOX A;  3NLC A;  3R9U A;  2GVC A;  4TM3 A;  1YY5 A;  2YLS A;  4A6N B;  4M52 A;  5FS6 A;  1D7L A;  2YVJ A;  4Z2T A;  5JCL A;  4NNJ A;  3UCL A;  2C66 A;  4UDQ A;  4XWR A;  3NTD A;  1M64 A;  3AD7 B;  5KOX A;  1FOH A;  4Z2U A;  1DXL A;  4X9M A;  1BKW A;  1PBD A;  2XLS A;  1P2E A;  3AXB A;  4H4V A;  5U1O A;  3L1R A;  3LAD A;  4K2X A;  4BJZ A;  2WOW A;  2BC1 A;  4YT0 A;  1H82 A;  2Q7V A;  1MO9 A;  3NIX A;  1D4C A;  2BRA A;  4H4S A;  3VR9 A;  2X3N A;  1B5Q A;  1OJ9 A;  2GR3 A;  5M0Z A;  2R46 A;  3DME A;  1GRH A;  3CPH G;  3BNM A;  3ADA B;  2C3C A;  2C75 A;  4CCQ A;  2WDR A;  3AEF A;  2WQY A;  5IQ1 A;  3VRA A;  1LQT A;  1VQW A;  3AE4 A;  3UTH A;  2ZZC A;  2A89 A;  4IVO B;  4K8D A;  4A65 A;  2GQF A;  3H8I A;  4NTD A;  4BK2 A;  2XVF A;  3P4P A;  2XFQ A;  3T2K A;  1GTE A;  3K7T A;  2GF3 A;  4Z44 A;  1TDE A;  2BCP A;  2FBW A;  2O9Z A;  2BA9 A;  3NK2 X;  4UDR A;  2E4G A;  3AEG A;  2QA1 A;  2WP6 A;  1E1L A;  1TDO A;  3FG2 P;  3UTF A;  1K0L A;  3VRB A;  3DJG X;  1Y56 B;  5BUK A;  2YLX A;  2YVG A;  3EAN A;  3AEE A;  3BHF A;  3GYI A;  3LB8 A;  4H4Y A;  4XXG A;  4YTM A;  5ER0 A;  3K7M X;  4CNK A;  4EQR A;  1REO A;  3SQP A;  2YLW A;  2B9X A;  4CBQ A;  2WP5 A;  3UKK A;  4J31 A;  1DOD A;  5EB5 A;  1GET A;  2EQ8 A;  1ELI A;  2B9W A;  3F8R A;  1H81 A;  2FJA A;  2YM1 A;  1Z6L A;  4X9N A;  3GD3 A;  5KNL A;  3AWI A;  4EQX A;  1P2H A;  3RP6 A;  1VDC A;  1GAL A;  2XVH A;  2A8X A;  4EMI A;  1KDG A;  3QJ4 A;  4NEV A;  1RP0 A;  5J60 A;  3DGH A;  1DNC A;  4N9X A;  3BNU A;  1CF3 A;  1OJT A;  4NWZ A;  2C64 A;  4AT0 A;  2WOV A;  4AT2 A;  4CNJ A;  4GAP A;  3SFE A;  2YVF A;  2C3D A;  4H4W A;  3KA7 A;  2ZZB A;  3G5Q A;  2YG6 A;  4J36 A;  4Z24 A;  1L0V A;  4LU6 A;  3SZF A;  2XFP A;  3FIM B;  4U8O A;  1XAN A;  2BK5 A;  3EAO A;  3SYI A;  1K0J A;  1GXF A;  1E6E A;  5KMR A;  4UDP A;  3UKQ A;  4FX9 A;  4OPI A;  3H8L A;  3ICR A;  3KKJ A;  4O5U A;  3T37 A;  2X8G A;  4PAB A;  1N4U A;  3ALM A;  4C74 A;  1DJQ A;  4USR A;  3BI2 A;  2AQJ A;  4B1B A;  1JEH A;  2WOI A;  2XVJ A;  4JNQ A;  3ALJ A;  3D1C A;  3UOY A;  4YSX A;  4XWZ A;  1LTX R;  3CGC A;  4TLZ A;  1B4V A;  5J7X A;  3CIR A;  4EIP A;  2WBA A;  4NTE A;  3IF9 A;  3B3R A;  5KMS A;  3P4R A;  2RGO A;  1DOE A;  1N4V A;  1N4W A;  3UKP A;  1ZOV A;  1UKV G;  2BS2 A;  4ADW A;  4EM3 A;  3BI4 A;  1PBB A;  4OPL A;  2QCU A;  4YKF A;  1TDN A;  1IUT A;  2BAB A;  1NDA A;  3I3L A;  1GEU A;  1L9D A;  1GRA A;  2JB3 A;  4B63 A;  2V3B A;  4I58 A;  4AP1 A;  2YG3 A;  1O94 A;  4IA5 A;  4ICY A;  3E1T A;  3NN0 X;  5M10 A;  1GRT A;  2XLU A;  3GYJ A;  2R9Z A;  2V61 A;  1LJ1 A;  1LPF A;  1PXA A;  3KVE A;  3RP8 A;  3OZ2 A;  1F8R A;  2WPF A;  4H4Q A;  1TDK A;  5HYM A;  3CPJ G;  1CC4 A;  3F8P A;  2RGJ A;  1IUW A;  2RGH A;  1H7W A;  2XLR A;  1JU2 A;  3CNS A;  4APN A;  1PS9 A;  3GWF A;  4AOS A;  3ATR A;  1H6V A;  1DJN A;  4ECH A;  2YLR A;  4A99 A;  3KLJ A;  1CJ3 A;  1XDI A;  4U8I A;  2WU2 A;  4BK1 A;  4B67 A;  4K7Z A;  3Q9T A;  2BXS A;  4I59 A;  4UP3 A;  2EQ9 A;  3AE9 A;  2E1M A;  5C2T A;  3ZDN A;  2GR0 A;  2ZZ0 A;  1COY A;  1OJC A;  2ARD A;  3AD9 B;  1TYP A;  1TDF A;  3CN8 A;  1CC6 A;  2R0C A;  3QSM A;  2DKH A;  2WDQ A;  2YG4 A;  1EL7 A;  2YG7 A;  2CVJ A;  1KFY A;  4CCR A;  2XDO A;  2CUL A;  4H2Q A;  2C4C A;  2TPR A;  1NEN A;  3K30 A;  3AE7 A;  4CY6 A;  2GQW A;  4II2 A;  4CY8 A;  3PS9 A;  4B69 A;  2XLT A;  1B37 A;  2BK4 A;  2IID A;  3NYF A;  1K0I A;  3AE3 A;  3PVC A;  3SX6 A;  2YQU A;  3SZC A;  2GV8 A;  1VG9 A;  1MXT A;  3DK8 A;  1YQZ A;  4G6H A;  3RED A;  4C5O A;  1NAA A;  3COX A;  3UKL A;  1OJD A;  3IWA A;  4YSY A;  3ATQ A;  1TRB A;  4IA6 A;  4B64 A;  2BK3 A;  2EQ6 A;  4YTP A;  2BXR A;  2BRY A;  4J56 A;  5IQ4 A;  4EMJ A;  1KNR A;  3GMC A;  3QSS A;  2XFN A;  3FBS A;  4GUV A;  4BV6 A;  2X8H A;  2X8C A;  2WPC A;  3ITJ A;  3CGD A;  4OPU A;  1H84 A;  4O5Q A;  2GAH B;  4JY3 A;  1JRX A;  4BK3 A;  3P9U A;  4GR1 A;  4KPR A;  1F6M A;  2YG5 A;  1NG3 A;  1GTH A;  2VRL A;  4K5R A;  2X99 A;  1KSS A;  5HHF A;  1FEC A;  3ICS A;  3DA1 A;  3NGC X;  1EL9 A;  4TLX A;  4BJY A;  1LQU A;  2GB0 A;  2Z5X A;  3AYL A;  4NTC A;  2XCG A;  3DGZ A;  3PO7 A;  4GDP A;  1ZK7 A;  2AR8 A;  3ISH A;  2R0P A;  5CKU A;  2YR4 A;  2VQB A;  2JBV A;  2VZ2 A;  3AYI A;  4NEW A;  1L9E A;  3H4K A;  5U25 A;  2VOU A;  1JOA A;  3T2Z A;  4U8P A;  4H4P A;  2V3A A;  3LZX A;  1GRE A;  3QVR A;  5EOW A;  5KVH A;  2C76 A;  2C65 A;  1DOB A;  1PBF A;  3F8D A;  2FJD A;  3NN6 X;  2R45 A;  1N1P A;  2PHH A;  4TM0 A;  4J57 A;  2BAC A;  2JAE A;  1E1M A;  1D5T A;  1K4Q A;  1S3E A;  2GH5 A;  2TMD A;  3DH9 A;  3DJD A;  4USQ A;  4X4J A;  4E0V A;  1M6I A;  3GD4 A;  3GDN A;  4A9W A;  3CNP A;  4ZCD A;  2UZZ A;  3AE2 A;  2VVL G;  2OLO A;  5GSN A;  4J33 A;  3ICT A;  3UOV A;  3GRT A;  1CJ4 A;  5JCN A;  3D8X A;  3KPF A;  5EB4 A;  1BF3 A;  4WCT A;  3CPI G;  1FEA A;  2JKC A;  1Q1W A;  3AD8 B;  3GWD A;  4C77 A;  1V59 A;  2B7S A;  2VQ7 A;  3K7Q X;  4GDE A;  4H4T A;  3S5W A;  4NZH A;  3SM8 A;  3G5R A;  3CND A;  3VRD B;  2XVI A;  1PDH A;  4RG4 A;  4U2L A;  4Y4L A;  2YWL A;  1GES A;  3NK1 X;  3T2Y A;  3C4N A;  3ALL A;  3RHA A;  3SZ0 A;  1YQ3 A;  2DKI A;  3Q6J A;  1PBE A;  2Z5Y A;  3HZL A;  4DSG A;  3CNT A;  4AOX A;  1BGN A;  4K22 A;  1KF6 A;  4EM4 A;  2GR2 A;  4D03 A;  3QFA A;  3UOZ A;  1JRY A;  4U8K A;  1S2Q A;  4EQW A;  1GPE A;  4YXD A;  3IHG A;  2B7R A;  3B6D A;  1E39 A;  1RSG A;  1YKJ A;  4DGK A;  4YKG A;  3T0K A;  2QAE A;  1GV4 A;  4OPD A;  5HXI A;  1KNP A;  4Z2R A;  4Z25 A;  1AOG A;  3VQR A;  4MJW A;  4GAV A;  5FS9 A;  1S2Y A;  3KD9 A;  1O5W A;  4TM4 A;  4GRT A;  1NHS A;  1GRG A;  3RNM A;  3AEA A;  4G6G A;  4B68 A;  3AE6 A;  5EBK A;  2CFY A;  1FEB A;  1F8W A;  4YSZ A;  3AE1 A;  1D4D A;  4WX1 A;  3GRS A;  3GSI A;  4JNA A;  2V6O A;  3NTA A;  3EPT A;  3II4 A;  1GER A;  5KMQ A;  3UKA A;  4JDR A;  4AP3 A;  1NHQ A;  2R4E A;  3AYJ A;  1ZDL A;  3AB1 A;  4B66 A;  1NPX A;  3EF6 A;  4A7A A;  4H4U A;  1LV0 A;  3NYE A;  1SEZ A;  4DNA A;  1Y0P A;  4H4X A;  1IJH A;  1F3P A;  3NK0 X;  1H83 A;  3RP7 A;  4GCM A;  4EQS A;  3C96 A;  2WEU A;  2V5Z A;  3UP5 A;  2IVE A;  3SGL A;  4II3 A;  1NHP A;  3QFB A;  1FCD A;  2APG A;  2OA1 A;  2BC0 A;  3HYW A;  3SZW A;  2NPX A;  1E7P A;  2XFU A;  4FK1 C;  5LV9 A;  2VVL A;  1H86 A;  5GRT A;  2VVM A;  2RAB A;  2JB1 A;  3AEB A;  4D04 A;  2WU5 A;  5U63 A;  2GMJ A;  2E5V A;  3NT6 A;  2OAL A;  4IV9 A;  2C72 A;  4U2T A;  2EQ7 A;  2XFO A;  3VR8 A;  1H7X A;  3CGE A;  4C3X A;  4DSH A;  3IC9 A;  1L9C A;  3L8K A;  4Z26 A;  3IHM A;  1ZKQ A;  1VG0 A;  3QVP A;  1MOK A;  4Y4M A;  2JK6 A;  3SY4 A;  2ZBW A;  2YR6 A;  4G74 A;  4H4R A;  1NG4 A;  1TYT A;  1Q1R A;  4U8J A;  4OCG A;  5FMH A;  3UTE A;  5BRT A;  5KOW A;  2C7G A;  1F8S A;  1XHC A;  1IUX A;  3SFD A;  1OJA A;  2VRM A;  1W4X A;  1GT8 A;  2W0H A;  1X31 B;  3O0H A;  3FPZ A;  2GRT A;  4FK1 A;  1CHU A;  1NHR A;  4BUR A;  4YWO A;  5DBJ A;  2H88 A;  5KWF A;  2XVE A;  3V3N A;  3ZYX A;  2F5Z A;  2YLZ A;  4Y4N A;  1QLB A;  1PHH A;  1ZMD A;  2XYO A;  1ONF A;  1D4E A;  3NNE A;  3URH A;  2WES A;  3UP4 A;  2C70 A;  3BI5 A;  2C67 A;  2GAG B;  2WDV A;  4H2N A;  1PJ6 A;  4IVM B;  3QSE A;  1ZP0 A;  1PXB A;  3OC4 A;  1BGJ A;  4JY2 A;  1ZMC A;  2WPE A;  3GYX A;  1PBC A;  2Y6Q A;  2B76 A;  3CMM A;  3HYX A;  2BYB A;  2YLT A;  2I0Z A;  4TM1 A;  2IVD A;  2Q0L A;  3NYC A;  1IUS A;  1Q9I A;  2XLP A;  2CDU A;  5JCK A;  2ACZ A;  3AED A;  4RG3 A;  4A79 A;  3P4S A;  2FJB A;  1S3B A;  5KXJ A;  2J3N A;  2OAM A;  3P4Q A;  3S61 A;  3DK9 A;  2PYX A;  3NG7 X;  3T14 A;  4H50 A;  4ZN0 A;  1JNZ A;  3UKF A;  2X50 A;  4OPT A;  3FMW A;  2C73 A;  2FJE A;  5KMP A;  2R4J A;  4YTN A;  4H7U A;  3T31 A;  3JSK A;  5BVA A;  1BZL A;  2V60 A;  2WHD A;  3LXD A;  4JQ9 A;  1XPQ A;  4B65 A;  2BS4 A;  4Z43 A;  1PJ5 A;  4U8N A;  1PXC A;  4A6N A;  3GDP A;  1QO8 A;  1CJC A;  1KSU A;  4A5L A;  4OPG A;  4U2S A;  1IUV A;  1GSN A;  1NEK A;  3G5S A;  4CRT A;  1IUU A;  4HA6 A;  3AE5 A;  5C3J A;  3DJJ A;  4OPC A;  4HB9 A;  3GMB A;  1EBD A;  5BUL A;  4G9K A;  1GRF A;  1GOS A;  5FS7 A;  1VRQ B;  3CNJ A;  4P9S A;  3M0O A;  3LZW A;  4EIQ A;  5JCM A;  4U8M A;  4JN9 A;  4C3Y A;  2BS3 A;  5L46 A;  3CGB A;  3ABV A;  5HY5 A;  4H2P A;  4H2R A;  2GMH A;  1CJ2 A;  1E1K A;  1B8S A;  2WS3 A;  3AEC A;  3HYV A;  4REK A;  2WP9 A;  4LA1 A;  3WE0 A;  1O95 A;  4EMW A;  4YSH A;  3LOV A;  3M13 A;  1PJ7 A;  2AAQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...