4I6ZA

Crystal structure of the transcriptional regulator tm1030 with 24bp dna oligonucleotide
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
200
structure length
200
Chain Sequence
b'MLSKRDAILKAAVEVFGKKGYDRATTDEIAEKAGVAKGLIFHYFKNKEELYYQAYMSVTEKLQKEFENFLMKNRNRDIFDFMERWIEKKLEYSASHPEEADFLITLVSVDEGLRKRILLDLEKSQRVFFDFVREKLKDLDLAEDVTEEIALKFLMWFFSGFEEVYLRTYQGKPELLKRDMNTLVEEVKVMLRILKKGMTK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator, TetR family
publication title Crystal structure of the transcriptional regulator TM1030 with 24bp DNA oligonucleotide
rcsb
source organism Thermotoga maritima
molecule tags Transcription regulator/dna
total genus 65
structure length 200
sequence length 200
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 4i6zA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 4i6zA02
2E1OA 1IG7A 1JUPA 2ME0A 2XPVA 3O60A 2IAIA 3BR2A 3HIMA 2XGEA 1I3QJ 4KWAA 1MBFA 2YS9A 5BNGA 3S1RJ 3PPBA 3HOUJ 1F43A 3BG5A 1UG2A 1UI6A 3ZOBA 3OIOA 3OSFA 2GENA 4XIDA 4D7MA 1H88C 2G7LA 2DA1A 1Z0XA 1ZTRA 3FK6A 3ZQCA 4IHYA 4ME9A 4RDUA 2QTQA 3RD3A 1A6IA 1IUFA 4HNVA 3VPRA 5D1RA 4C3HJ 3HGYA 3ANGA 2LP0A 3SDGA 3KZ9A 2Y9ZA 3HOWJ 4DW6A 3NPIA 2DA5A 3KKCA 2GM4A 5F0CA 2W53A 3GTKJ 4M3DA 4MFDA 2HOSA 3FRQA 3HTJA 3P9TA 1WH5A 1FJLA 4GCLA 2G0EA 2N8GA 3HDDA 1ORKA 4S0HB 4XK4A 2ZCXA 2Y30A 3RH2A 3T6NA 4A3IJ 1FEXA 5IOZA 2FQ4A 4QTRA 1A5JA 2G7GA 2DMQA 3E7LA 5C4YA 2DN0A 2L7MP 3CCYA 2XB5A 4ABZA 1PUFA 2UXUA 3O8HA 5K7ZA 3GBGA 2HQ5A 3B6CA 1ETYA 4QIWN 5EFYA 3H3VK 3S5RA 5F1JA 2CJJA 1JKRC 5EDNA 3VVYA 2COBA 3BR0A 3VIBA 1P7JA 5FKKA 3V78A 3WHBA 5EEAA 5J1UA 4AUXA 3DEWA 2QWTA 2WUIA 5C44J 4A3CJ 5EZHA 1SANA 3LHQA 2JA8J 3MNLA 5IYDJ 2TCTA 4JX4A 4GCTA 1JTXA 5J1YA 3C07A 5C3EJ 1GVDA 4JX6A 4W97A 2QKOA 3A01B 1TWAJ 1W0UA 3HBLA 4MFEA 3F1BA 3HEFA 1MSFC 5D19A 3QPSA 4A3JJ 5GPAA 3PM1A 2EBIA 3TP0A 1E3OC 3S15J 2QIBA 3CWRA 1ZKGA 3S14J 3Q0VA 1OJLA 1T56A 3KKDA 1B72B 3NXCA 4BBRJ 4CYCA 5EGOB 2X48A 2EH3A 2UXHA 2PBXA 3S2HJ 4I6ZA 1HCRA 3AQTA 5D18A 2D6YA 1Y1VJ 3BTIA 4W1UA 3S1NJ 1WH7A 2OI8A 1JUSA 3MKLA 2HOTA 5FKNA 2R0QC 4M3BA 5EG0B 1IGNA 4M3EA 3BR1A 1ZQ3P 2K9NA 2CQXA 4V2GA 1P7IA 4A3FJ 1WCMJ 4FCYA 3PASA 1QVUA 2XRLA 4IHWA 2AO9A 3VVZA 1RKTA 2XGCA 2DA3A 3RZOJ 2QOPA 5E3OA 1ZR2A 4A3EJ 3HTHA 1ETWA 5CXGA 1NTCA 1XG1A 2MW8A 3F0CA 2EQRA 3A02A 2LTPA 3OSGA 1EF4A 2K9QA 1IC8A 5HBUA 3FKIJ 3JRAA 3COLA 3TP3A 3GTLJ 2FBQA 4B1RA 3A01A 3SJMA 4BY1J 3HOZJ 2E2IJ 3M3YJ 4MK6A 3HB9A 1U9OA 2JMWA 2M34A 2LK2A 3QQAA 5FKMA 2Y9YA 1ETVA 3VVXA 3BJBA 2ECBA 1XC5A 2X9DA 2Y0SN 4FISA 2NVQJ 3EGQA 5EF6A 4YZEA 1RKWA 2NX4A 5C4JJ 2W48A 1B72A 1TWGJ 2NP3A 2PZ9A 2GFNA 2XPWA 3IV5A 5EGOA 1JKQC 4EEFG 2P81A 1MH4A 2HI3A 2JA5J 1POGA 1HLVA 3LSGA 3BQYA 2AHQA 3DPJA 2O7OA 3BT9A 1GT0C 2UXPA 4RBOA 2IEKA 4D7NA 4C3IJ 1TWHJ 4CYCB 2MG4A 3PO3J 2RHAA 3B81A 3OOUA 3HTIA 3BR3A 2K9SA 3VUQA 1BL0A 5F04A 5EZGA 3DCFA 3NI7A 2DMPA 1ETOA 2H1KA 3RZDJ 3BR5A 4FE7A 1RESA 3BTJA 4XRMA 5EG0A 3S16J 2ME6A 4L62A 5FKLA 4UUSA 3EUPA 5GP9A 3RKQA 3M4OJ 4DYCA 3ON4A 1BJZA 2QF7A 3B6AA 3K2AA 1FIAA 1AU7A 3JREA 2NS8A 5GPCA 5IP7J 2ZCMA 1FTZA 5F0FA 5IOYA 1NK2P 1SGMA 1ITYA 2TRTA 2O9LA 2JJ7A 2REKA 2UXOA 4C2MJ 5CXIA 2HKUA 1IJWC 1HF0A 1JGGA 3LOCA 3VP5A 4C3JJ 2JN6A 3FIWA 3JRCA 2UXIA 2O7TA 2DMTA 2K40A 3TEDA 1Y1WJ 4X1EA 4DYQA 5CW8A 3TW6A 3WHCA 5M5WJ 3QBMA 2RAEA 2XSDC 5IPAA 1MBGA 1D5YA 4QSHA 5E3NA 2XDNA 5HSZA 2DG7A 1GV2A 4MO7A 5FLMJ 5M3FJ 3UKGA 3LJLA 1GV5A 4GFBA 1BW5A 5J1RA 1VNDA 3HE0A 1QRYA 1TWFJ 3JRFA 1Q1VA 2ZCNA 3QPLA 3BHQA 3HM5A 4IHXA 1AHDP 1LE8A 4I76A 1FTTA 1U78A 4JNNA 4M6VA 3NAUA 1ETKA 4BKXA 3GTOJ 2R7ZJ 3VOXA 2DG8A 5H9TA 1HOMA 4AC6A 2VI6A 4DZPA 2VUMJ 2D5VA 2YVEA 1WI3A 5IYCJ 2H8RA 3IH2A 4G12A 1G2HA 3I4NJ 1JJ8C 3GTGJ 2R5ZB 2VKEA 4M3FA 3BQZA 1O4XA 1H8AC 3G56A 2DMUA 2GBYA 1DU0A 1W0TA 4D5FA 2EZHA 1IRZA 4NN1A 4ICHA 3AQSA 4PXIA 5FLVA 2HYJA 5JLXA 5J3LA 2ZOZA 2FD5A 4A69C 3TW7A 2HXOA 2L0KA 3ZQIA 1X58A 4UUSB 4A3KJ 4AYBN 2ZB9A 1B8IA 5DS9A 1ETXA 1OFCX 4IHVA 2DMNA 3BCGA 3NNRA 1FIPA 1JKOC 1RPWA 5E3MA 2CU7A 1JT0A 4B4CA 2DA6A 4M3GA 3KNWA 3GEUA 2NVYJ 2FX0A 3FISA 4D5CA 1R9TJ 3L1PA 4V2FA 1VFCA 5M5YJ 4GFKA 3MN2A 1Z77A 3FK7A 2M9HA 3BG9A 3G1LA 4A93J 5IP9J 2EZLA 2Y2ZA 2M8GX 1CQTA 3G1MA 2JWTA 4AC0A 1SFOJ 1JKPC 4JX5A 1T33A 1YRNA 4ACIA 2L7FP 4JL3A 5M5XJ 5EYRA 3IUVA 3NARA 1OCTC 3GTPJ 2G7SA 1UMQA 2MGQA 2E2HJ 3ZQHA 3S17J 2RASA 2WGBA 2CRGA 1JUMA 1JJ6C 2ID3A 5K7HA 5IYBJ 3BNIA 3JRBA 1MH3A 1X2NA 3GZIA 2KT0A 4BY7J 3GTJJ 4BXXJ 2YVHA 2G3BA 4B3AA 3QKXA 2IU5A 2HYTA 3GTMJ 1ZR4A 2EZIA 4LOCA 1LE8B 2IBDA 3GTQJ 2WV1A 4UDSA 2R5ZA 2XPUA 1VF9A 1X2MA 2CQQA 2EZKA 3MVPA 3G7RA 2OPTA 1ZGWA 2DTZA 1VI0A 2WB1N 2HDDA 4DYRA 3ON2A 2NVTJ 4FE4A 3JRDA 5M3MJ 1ENHA 4Y52J 2OERA 1TWCJ 2R93J 2XGDA 3BTCA 4XICA 3VOKA 1MBEA 2HOAA 2ECCA 4NDLA 4XRSA 2LKXA 4XRSG 2JK3A 2R5YB 3A03A 2LD5A 1K61A 3HTAA 4MLOA 5K7FA 4X6AJ 1TC3C 1IDZA 1I6HJ 1RETA 1WGXA 2DJNA 4IEJA 5F0HA 2YUSA 2LR8A 1UI5A 4A3LJ 1B8IB 2CUEA 2GUHA 5FMPA 1LFUP 3C2BA 3W6VA 1DU6A 2HXIA 2M2EA 1F36A 1GDTA 4FTHA 1MBHA 1UHSA 2E2JJ 2O8KA 2DA4A 2LFBA 5IP6A 5DAJA 2ID6A 3V6GA 1BW6A 3BTLA 3SFIA 1NK3P 2Y31A 5FJ8J 1WPKA 3JRIA 2DA7A 5HAWA 3LSRA 4JKZA 3HOXJ 3O8GA 5E3LA 3JRHA 1AKHB 3CJDA 2YU9J 4JP0A 1YRNB 2M0CA 2F07A 3Q0UA 3VW0A 4JYKA 3LNQA 3E7QA 3LWJA 1ZK8A 2OF7A 3S1MJ 1I50J 3JRGA 1H89C 1LFBA 2Q24A 5FGLA 4GCKA 2CUFA 5HODA 4L5EA 3Q3SA 9ANTA 1IDYA 3ZQFA 3RQIA 4UUTA 3H0GJ 2KDZA 4BBSJ 5AQCA 3HGGA 3D1NI 1IV6A 3Q0WA 4GFLA 2L9RA 3S2DJ 4NELA 3IH4A 2NS7A 1U9NA 3CDLA 2R5YA 2V57A 4DZJA 4A3MJ 2VKVA 5FKOA 2VPRA 4A3BJ 3HOYJ 3NRGA 4HKUA 3CRJA 3I4MJ 3LSJA 1GUUA 5JLWA 5K58A 4MIMA 1BA5A 2E19A 3IH3A 2L7ZA 4MXMA 3S1QJ 2FJ1A 2NP5A 1K83J 4A3DJ 3VW1A 2LY9A 1MBKA 2PMZN 3K7AJ 5C4XJ 3VW2A 1U8BA 1ETQA 2MSYA 5F27A 2GLOA 3LSPA 2X6OA 4Y7NJ 3JR9A 3ANPA 1S7EA 3CQZJ 1HDDC 3CMYA 4A3GJ 4J19A 1QPIA 2LVSA 2R92J 3JSJA 4CGRA 2LLKA 1AKHA 1XS9A 5FHPA 3BRUA 3G1OA 5F08A 1RR7A 2WAQN 3BG3A 1MNMC 2B63J 3HKZN 2XB0X 5DTDA 3PO2J 2QCOA 3HOVJ 1MSEC 2ZOYA 2ELKA 1OCPA 3BR6A 3ZQGA 2I10A 1JTYA 2JA7J 2JA6J 2NVXJ 2NOGA 3ZQLA 1JT6A 2DA2A 1HDPA 1PUFB 1QVTA 4AF5A 1MBJA 1APLC
chains in the Genus database with same CATH superfamily
4LD5A 2XPVA 3FKJA 3BR2A 1H9TA 3S3OA 4KWAA 1MBFA 2ELJA 4L5IA 4P55A 4CXFA 2FQ3A 2VT3A 3H0DA 1X4OA 3WGHA 1RR8C 3OYFA 2CV0A 1FBQA 3OSFA 2XRNA 2FRHA 4XRFA 2G7LA 4NQWA 3ERED 3ZQCA 4IHYA 2Y48A 2XC7A 3H5NA 1RZ4A 2K85A 4LK1F 5E1XA 4ZZLA 1ZG3A 2KIQA 3RD3A 1A6IA 1IUFA 1YIJI 1XN7A 4A5MA 2IA2A 1W7PB 3K4LA 1LUJB 3G3ZA 2LP0A 5DM7F 3SEZA 3LA3A 2EPFA 4RM3A 1Y0NA 3HYIA 5F0CA 4GCVA 3GTKJ 2W53A 2GOXB 2HOSA 3HTJA 1W7PD 1WH5A 5FRMA 1MMDA 4GCLA 1PVEA 1ORKA 4LG0A 3OYMA 1A5JA 5DCMB 5C4YA 3IUOA 3I9V2 2L7MP 3ZMUA 4KIFA 1SD6A 5JHUA 1PUFA 2UXUA 3O2PE 4BH9A 4EM1A 3H3VK 1U3EM 4IRGA 3S5RA 2RVCA 4L9JA 1T6SA 1U6GA 2COBA 3BDDA 3BR0A 3BZCA 1B9MA 4HYEA 3V8JA 5EEAA 2QWTA 2H94A 2KISA 5C44J 5EZHA 2IXSA 1P92A 1UHWA 4F92B 2ZXWH 2LF7A 3FX3A 1K78B 3CUQA 2TCTA 4JX4A 2XIGA 2CMPA 2G7UA 4JX6A 5D5WB 2RNGA 3OY9A 4GDFA 2VKDA 1OLTA 4MFEA 1ZYRF 2JSCA 3F22A 5D19A 4D9JA 2EBIA 2QIBA 1E3OC 3S15J 2ACJA 1MJ9A 4O3MA 3S14J 3Q0VA 4UVBA 3RKYA 3DBHB 4ZDOA 3NXCA 2LOOA 2EH3A 3PQKA 4BNCA 2EILH 3ZQQA 2XAFA 2KKOA 4KIGA 2KL4A 1FX7A 4FT8A 2FBHA 3BTIA 5JVGF 4RGRA 4KDPA 2OI8A 1TQMA 2LY1A 2HOTA 1I1SA 1B9NA 2VOPA 3LQRA 3TO9A 1E3HA 2ZY9A 1Z6TA 4E70A 1IGNA 4M3EA 2VB6A 4EM2A 4HX8A 4Y33A 4V2GA 1XTAA 4KA4A 1Z67A 3MKWB 1B6AA 3PASA 3L2RA 2QQAA 2L54A 3OYAA 5FD5A 4OAZA 5CXGA 4IPAA 3VB2A 2DAOA 4EGZA 4BQNA 2MW8A 1VQPI 2VN2A 2G7HA 4NHJA 3K6GA 3A02A 1EF4A 5HBUA 5KHDA 3L2QA 3JRAA 3A01A 3SJMA 2E1CA 3HB9A 2KZGA 3HOTA 2MABA 3OS2A 1BC7C 4B09A 5FKMA 1IF1A 1ETVA 1WJEA 3OIQA 4GRIA 4PK4A 2O0YA 3RIRA 1IN7A 4YZEA 5EF6A 1RKWA 2CH0A 2ZBKA 5DD4A 3SDBA 5C4JJ 2W48A 1TWGJ 3WG7H 1FSHA 1MMNA 2XPWA 3IV5A 3T8TA 5EGOA 3GF2A 3WGIA 1Z9CA 1JKQC 3F6OA 4YEJA 4WXCA 2XAGA 3FMRA 1MH4A 3T5XA 4ETSA 3OOPA 2AHQA 3DPJA 4OAYA 2A69F 2XF5A 1EJ9A 5E17F 2RN7A 2BY2A 5HDKA 2B3WA 3HTIA 3LFUA 4Z6YA 1QHHD 1P4XA 3NI7A 2ZMEA 3RZDJ 2CFOA 4XRMA 5EG0A 3CJTB 3S16J 2H6BA 4Q4ZF 5FKLA 4UUSA 3BCAA 4L62A 3M4OJ 1HW1A 1W36D 2HKOA 3K2AA 3CF5F 1T38A 1LVKA 1MDMB 1AU7A 2E1MC 2O6GE 1X3ZB 2VJ4A 5DCFA 3F8BA 2K02A 3S8PA 1SGMA 3TL4X 4CCJA 2O9LA 2JVHA 1IZ1A 4ITVA 1IAWA 1LEBA 1G8XA 3H9QA 4U87A 2XKOA 4XSZF 2VASA 3PFIA 4CGZA 3MZYA 5H6RA 4OIQF 2OA4A 5CVUA 3OYEA 3JRCA 4HX4A 2O7TA 4E4HA 1LQ1A 2DMTA 3K4MA 2X4HA 5FD6A 3LAJA 3TEDA 4X1EA 2V6CA 3R4KA 2CYYA 1SD5A 4XM3A 2FUG2 5IPAA 4QSHA 2XDNA 2DDBA 5HSZA 2VC1A 4PGGA 5FLMJ 4QPOA 5M3FJ 3LJLA 2QZ8A 1F5TA 1MMAA 1S3JA 2DFFA 2I8DA 3HE0A 2XAUA 4CCLA 3JRFA 2E71A 4HOBA 5LGNA 2GWRA 2R4GA 3KZYA 1QQIA 4I76A 4CH7A 2DFHA 1RNLA 1KQ9A 4XOTA 4AYBA 1U78A 4IL6C 1ETKA 1SFKA 3I64A 4BKXA 5HS8A 3GTOJ 4KITB 4PZJA 1OKRA 4NUBA 5H6QA 4AC6A 2OV7A 4XNFA 4DZPA 1MKMA 1TQPA 2YVEA 1KU2A 4G12A 3U1DA 4CCMA 1YI2I 2J5PA 1JI8A 3G56A 1V55H 3I58A 4XKCA 2JQ7A 3WTXC 4CICA 2IS2A 2VXZA 2HR3A 3C3WA 3R61A 4D5FA 5TRDA 1IRZA 3AQSA 1I5ZA 3KP2A 3MEXA 1WZ2A 3H3ZA 4XONA 3M9AA 2CWEA 5JLXA 4A69C 3HRUA 4HNTA 5DYMA 2DI3A 2HXOA 3HRSA 1Z91A 2QSHX 2Z1DA 1FWZA 2HU9A 4AYBN 1OFCX 4IHVA 3NNRA 4XKWA 2CU7A 2X6XA 2DA6A 4RA2A 3KNWA 5CVIA 2DFEA 4R79A 5F1RA 5M5YJ 3MN2A 2ZJQF 1NG6A 3FXRA 1K6OA 2HZTA 2M9HA 3QOPA 1XMAA 1BIAA 5IP9J 2DK8A 2M8GX 2OQGA 1CQTA 2EFQA 4KJZA 1OCCH 2VT2A 3KYDB 4ACIA 2HQAA 3GMEA 5LHHA 4JL3A 2V1NA 3IUVA 1FBSA 2LKSA 4E7LA 3VEPA 1Z7LA 3ZQHA 4EVIA 3TQNA 2CRGA 5FROA 1R58A 2M4KA 4Y3OA 1GHCA 1P9QC 2O03A 2LG4A 2NAZA 2L3DA 2A07F 3NEUA 1U5TC 3P9CA 4B3AA 3QKXA 2Z33A 2IU5A 4HG2A 2AXTC 1ZR4A 2CW0F 2IBDA 3GTQJ 4HF0A 3FHZA 2EZKA 2BW3A 1BIBA 3MVPA 3MZ8A 2HTJA 2OPTA 1ZGWA 2E7XA 2NVTJ 3J81Z 3OYJA 2A6EF 4YFKF 2B0LA 5L3EA 3CDHA 3BTCA 3RCOA 1IRXA 1BR4A 1TLHB 2ECCA 2DK5A 2CV2A 3EUKL 3IAS2 2W25A 4MTDA 3A03A 4UUVA 4UY8I 2E7WA 3D5SC 1U0JA 1GVJA 2UXXA 3I3LA 5JVTA 4CHUA 5K7FA 2IGMA 3SQNA 4IQ4A 2CW8A 5FGMA 4ENKA 3ONQA 4G7OF 1WGXA 5F0HA 4ZYGA 4NC6A 3HG9A 1QO0D 2D2WA 5ILVA 3HL2A 2LR8A 2QKMB 3CC7I 4WWCA 1LFUP 1T98A 1F36A 2QVOA 3QAHA 3M7GA 1IXSB 3ASOH 5J4VA 2ETHA 3CCMI 5IP6A 3CCUI 1D1CA 1SFUA 3JRIA 5FJ8J 1WPKA 2DA7A 2KRCA 2QQBA 3O8GA 3AG1H 3GYHX 4WXHA 4EJOA 1SAUA 2VC0A 2XDVA 3L00A 4U88A 4PJLA 3BJAA 5K5QA 3FMQA 3Q0UA 3I4PA 3OYHA 3HRMA 3LWJA 2R7UA 3TO6A 4EJVA 1HW2A 4BJ6C 1FNNA 2M7AA 3N05A 4F93B 2QUFA 1OYIA 2L4AA 5E1ZB 3PQJA 1HW5A 3RQIA 2DT6A 2QWWA 1BI1A 3JSPA 3E5XA 4IXAA 2DCEA 3D1NI 1IV6A 1ONVA 2L2OA 2L9RA 1X4PA 4G6QA 2NS7A 2F4OB 2O5RA 1U9NA 2CSOA 3GFJA 4AVZA 1ZAOA 2CW7A 2VKVA 5FKOA 2LNBA 4J01A 4HX7A 4A3BJ 2BXZA 2ZNYA 3IWFA 4NQWB 2RDPA 2WADA 3QYEA 1X1BA 3LSJA 1MGTA 2BY3A 4U0VA 1BA5A 4U9NA 3H5AA 3M07A 4FX0A 4XLCA 4BQQA 2Q2EA 1CGPA 3S1QJ 2FJ1A 1C0WA 2CUJA 3E6DA 3MKZA 4ENNA 4PSWA 2XHKA 1ETQA 3ECHA 3F8NA 1U8BA 2M45A 3ZPLA 3VYRB 1HC8A 3DKYA 4HSTA 4RMNA 2JRTA 4IHTA 1R1VA 4I02A 1QPIA 4C30A 2LVSA 3JW4A 4CGRA 1TP4A 3CJRB 3K9TA 1X19A 2E1MB 4DIQA 4DOZA 1TBXA 3FXKA 3MAJA 4LG0B 3DTEA 1HA8A 3BG3A 2W82A 5GADJ 2XB0X 1IV8A 4XLEA 5DTDA 1MSEC 2DODA 2ELKA 2PI0A 1OCPA 3FXLA 3W2VA 2I10A 3ZQGA 2JA6J 3W2AA 1PUFB 1Y0UA 4BE2A 1WWXA 2YX7A 2E1OA 3WU2C 1JUPA 2MC4A 2ME0A 3GFLA 2IAIA 3CCVI 3HIMA 1SEUA 4B3XA 4I98B 3HOUJ 4Z2YA 1UG2A 5L3CA 2Z2SB 3ZOBA 2UV1A 3ESWB 3OS1A 2R7SA 3PNYA 2XGXA 3RPQA 3MWMA 5FO5A 4CZZA 2DA1A 1Z0XA 1FOWA 1JHHA 3FK6A 2GA2A 3K69A 4F91B 3UR3C 3RKXA 2X6WA 4ZH4F 4ME9A 3QYFA 1BM9A 4ON0A 2QTQA 1X3WB 3E6CC 2K3PA 3VPRA 4KNYA 1XMKA 3AAFA 3HGYA 3DQVC 3AG2H 2E5ZA 2A68F 2Y9ZA 3HOWJ 3NPIA 2LF8A 2JVGA 3KKCA 2P5VA 4M3DA 4MFDA 2AQEA 2XF6A 2F2EA 4E7SA 5BPDA 2G0EA 3DPUA 2Y30A 5KAFC 3MQ0A 3E6BA 2NYXA 2MFZA 4QTRA 1R1TA 1SVMA 4M6XA 3ZP5A 4PJ0C 2G7GA 1UELB 3LSMA 2GIVA 2W84A 3WE3A 3E3VA 5EEGA 2ZNZA 3QPHA 3DKWA 3K4CA 1IN5A 2DFIA 4PJNA 4RS8A 3FZVA 4ZYHA 5EFYA 1ZGJA 1XDSA 5F1JA 2CJJA 5EDNA 3RI4A 3V42A 1P7JA 1FMVA 1A6QA 3JCUC 4EQQA 2QQ9A 2NS0A 2LC2A 3C2GA 2GXAA 1SANA 3NQOA 3G2BA 3KP7A 3R0JA 4MQ9F 3Q9SA 2JA8J 3LHQA 3MNLA 3ASNH 1AOYA 1R5GA 5HLHA 3C07A 5J1YA 4W97A 3J7AY 3A01B 1UJ8A 3LSKA 4RAZA 3OYLA 2K86A 4E6KG 3F1BA 1BI0A 1U5TB 4YG2F 5LEJA 3HEFA 5KAIC 3QPSA 3H9JA 2X1EA 4I09A 3NWTA 2CO5A 5GPAA 1W36C 1KU9A 1WJCA 4L0ZB 2W7NA 2KRHA 4RGSA 3F23A 2A5WA 1KYZA 2QSFX 4XR6A 1T56A 2EFWA 4CSWA 2VBXA 2E1NA 5EGOB 4HQEA 2X48A 1WJBA 4PDKA 3S2HJ 2FU4A 4I6ZA 4HRIA 3H92A 4CYDA 3RYRA 3V7RA 1YITI 1XSVA 2IRFG 3AQTA 1Y1VJ 2BY1A 1U2WA 5ED4A 1JUSA 4Y4RA 2OD5A 1TNSA 5J8FA 1FP1D 2WC2A 3ROUA 3U9GA 3K10A 3VFZA 5EG0B 4YELA 1ZQ3P 2VPLA 2K9NA 3HUGB 3CP8A 3GFMA 4FCYA 3WG9A 1QVUA 2QOPA 2ZXHA 5E3OA 5CVRA 1ETWA 1NTCA 1RIOH 5L3BA 3F0CA 3L2UA 2LTPA 2K9QA 3GVAA 2WB1A 3TP3A 1T2KA 4D1QA 3M3YJ 4MK6A 3HOZJ 2E2IJ 3HTUA 4O6JA 5E20A 2LREA 1X1AA 5AONA 4WX9A 2OAZA 5K5OA 3VYTB 3VVXA 2ECBA 1XC5A 3DEUA 3FXMA 3P9KA 2X9DA 1MJAA 4H4KC 3L7WA 2FOWA 1B72A 4B47A 5HNFA 1D5VA 2NP3A 2PZ9A 2GFNA 1KYWA 4Q5SF 4IX7A 2TDXA 1Y8RB 3K1MA 2F5EA 4WF2A 2A05A 1Z7UA 2JA2A 1POGA 1HLVA 3HC7A 3LSGA 4OOIA 1VQ4I 4U9LA 3BT9A 1GT0C 3CCSI 4OMYA 2DLLA 4CYCB 1XGOA 3PO3J 4AM3A 2ZFWA 4E7HA 2IVMA 3TDUC 3BR3A 5HDNA 2O3FA 3VUQA 2OZ6A 3GCMA 5EZGA 2UXNA 1ACIA 1WJ5A 4L0YB 2QM3A 4FE7A 2A5YB 3LQQA 2LMDA 4HV6A 1DQUA 2YU3A 1U8RA 3EUPA 3RKQA 4DYCA 3B6AA 5D6FA 5ICFA 1FIAA 2FEZA 3JREA 1LVAA 1LDDA 2L4MA 4G7ZF 4E7KA 5IP7J 1R49A 5F0FA 3WTSC 1NK2P 1ZH5A 4HDVA 1ITYA 2JJ7A 1VQNI 4C2MJ 5CXIA 3IKVA 3V8KA 2HKUA 1O57A 1ZN2A 3E97A 2HEOA 2HDWA 2A2FX 2KLOA 1ZREA 4IVNA 4XLHA 4QPQA 4C3JJ 3VP5A 5DM6F 3QOEA 4CDGA 2QSGX 2JPCA 1Y1WJ 4MEYF 4GGGA 5E8GA 5A2QK 4DYQA 3TW6A 5A2QZ 4HV5A 1SFEA 2RAEA 1OQYA 2CFXA 1IRFA 2Z9OA 1MBGA 4XN0A 4WK8F 1S9HA 1ZG1A 3E1SA 1PUEE 2V4JC 4MGRA 3UKGA 3GZNB 1IXRC 4S05A 1BW5A 1USTA 5J1RA 4KN4X 1QRYA 1TWFJ 2NNNA 1Q1VA 2LY2A 3F3XA 2PFVA 3KCCA 3BHQA 3HM5A 2DOAA 2KPMA 4IHXA 1AHDP 5H20A 4BHBA 2QQ8A 3RSNA 3ZGKA 4M6VA 3OL4A 4UB8C 3PUFA 1L0OC 5H9TA 5L3DA 1HOMA 3EQLF 1BOAA 2VUMJ 1K7AA 1VQ6I 5JHFA 1WI3A 2RKHA 4HSRA 3W6JB 4FX4A 5IYCJ 2A3SA 4ZYAA 3IH2A 3I4NJ 4ENMA 2BW3B 2H1LA 1YOVB 5KCMA 4YIRX 3BQZA 4HZFA 3G4SI 3QODA 2BEOA 2GBYA 2IGKA 4LMYA 3Q5FA 1YO5C 1W0TA 4LG3A 2WTEA 4ICHA 4NN1A 2IJLA 3OYBA 1PP7U 3J7YJ 4CCKA 2PJRA 5LFAA 2ZOZA 2FD5A 5AIQA 1HQCA 2HDCA 1X58A 4A3KJ 1B8IA 4L9VA 5DS9A 3GLLA 2PQ8A 2X1CA 1DGRM 1N78A 2ZKZA 2L02A 3K4NA 1JT0A 1MNDA 4B4CA 4M3GA 5FRNA 2FX0A 2R3SA 1R9TJ 1V5GA 3CD6I 1ZRDA 4GFKA 3IHUA 1ERDA 2V7FA 3FK7A 2VE9A 1KQ0A 2BHZA 3OS0A 2DBBA 1ON1A 5E8IA 3HIFA 3CMAI 1FOYA 1WJDA 4LJZF 1QGPA 3DF8A 4GYIA 4FETA 1T33A 4P9UA 1YRNA 2P5KA 1ZELA 3V7SA 1ZLJA 3DBRB 2X51A 1OCTC 4HEA2 2M4GA 2MGQA 3CTAA 2E2HJ 3HTSB 1D1AA 2HYFA 1JHFA 3DP7A 3OYNA 3EUHA 1UAAA 2BBYA 1JJ6C 2JZYA 1H9GA 2XSJC 4M74A 2PMHA 3I5UA 3BNIA 2ZC2A 2EB7A 3GZIA 4XLAA 4I0BA 1YJ9I 2YVHA 2G3BA 3CO7C 3BC8A 3V8LA 4LOCA 1LE8B 2EINH 1T8IA 2WV1A 5HOOA 2M87A 4KIBA 2XPUA 1VF9A 1X2MA 2GAUA 3G7RA 1AWCA 1FC3A 1OISA 3JTGA 1VI0A 3FXQA 1BI2A 1KZHA 1A04A 2B9SA 2K9LA 2HDDA 3ON2A 1STZA 3JRDA 3S3MA 3ZMDA 1ENHA 4Y52J 4XICA 3J80K 3J80Z 3EYYA 2HOAA 4QLCU 1LPQA 4G9YA 1Z1DA 2LD5A 1S6LA 4M9XA 3BZKA 1J09A 3BPXA 2HQRA 3IP4B 5CYVA 1L3LA 1SVLA 2FF4A 1Z3XA 3BZ6A 2MLGA 4L9NA 3HXLA 1H0MA 3F72A 2DOEA 2KMUA 3DEEA 2VQHA 2Q2EB 2CUEA 4I2OA 2H09A 2P8TA 3PUBA 3W6VA 2FJI1 3M1EA 1CF7A 4AWXB 2X1DA 2QENA 2EWNA 1O3TA 4R1HA 5DAJA 4LB5A 4DGWB 3W6KB 1Z05A 3K4BA 2EFOA 5E3LA 3RPUA 2J5OA 5JR3A 2YU9J 2VKHA 1QNTA 4JP0A 2M0CA 2F07A 2VIXA 2P6SA 4ANJA 2HGCA 2PBIA 3KLOA 2KP6A 3S1MJ 1E2XA 3CUQC 3HRTA 3ZMVA 4KMFA 5HODA 4L5EA 3Q3SA 1V5FA 9ANTA 1IDYA 3SYTA 2AS5F 2M1BA 5HLGA 5AQCA 4LLLA 2HZDA 2VBWA 2MD5A 3CF2A 3E0JB 1ULYA 3Q0WA 1J0RA 2W1OA 4GFLA 3L9FA 3S2DJ 2LBFA 3L2WA 1FY7A 2FOKA 1J2XA 4NELA 2PJPA 3CDLA 2V57A 1BR2A 3H36A 2ZJRF 3CCQI 3HOYJ 3N97A 3CRJA 1Z21A 2KJBA 4DQ2A 4XLFA 3SZTA 4A2UA 5K58A 5D8KB 3M1CA 2JPBA 2EIMH 3C7JA 2P4WA 4MXMA 2L7ZA 2PN6A 3ZMZA 3EYIA 1K83J 4ZDPA 1FOXA 1X1CA 3VW1A 5D5UB 3LSHA 2P7VB 5C4XJ 1QHGA 3K7AJ 3VW2A 1OR7A 2MSYA 5F27A 3JTHA 3L2VA 3ANPA 2LDUA 2EA4A 2M8EA 1HDDC 2I5UA 2IA1A 2KFDA 3MCZA 1J9IA 1J7KA 1BC8C 4AIHA 1XSDA 3JSJA 3BY6A 1XS9A 2YSRA 2V9VA 1G6NA 5F08A 5TGTA 4HF2A 1R23A 1RR7A 5EEHA 1IRGA 2A6HF 3BJ6A 3GXOA 5E1WA 1XGNA 2WY8Q 1D0XA 3TKYA 1FT9A 4HQMA 1FPQA 2L9VA 3CUOA 5LGTA 2AXLA 2WAEA 5B5EC 4EGYA 2NVXJ 4BHPA 4I7HA 5LBQA 4II3A 4IOCF 3ZQLA 1JT6A 1SAXA 1HDPA 1UMQA 4AF5A 1MBJA 2IGNA 5BS6A 1IG7A 3DPLC 1IN6A 4XMYA 3OYIA 1P4AA 4AD9A 2Y75A 4UVAA 5B66C 3KE2A 4MEXF 1F43A 3BG5A 1VQ5I 3EUHC 5GTIC 3OIOA 4J00A 3J81K 4ZTJA 1S7AA 4XIDA 3ABKH 1TT5B 4CA0A 1H88C 4NNJA 1I6XA 1ZTRA 3WTZA 4JBAA 3L09A 1IO2A 2STWA 1YFHA 4EJUA 2MYSA 3W2WA 1HSTA 1QZZA 2RQPA 3OWTA 3BG6A 2MD0A 2PX9A 3TOAA 4HNVA 2VJIA 2FSWA 3IRQA 5D1RA 1O3RA 4C3HJ 2VBYA 3ZMTA 3ANGA 4BEHA 4LLNA 3SDGA 3WTUC 2JUCA 3KP3A 4TV7A 3KZ9A 2ZMEC 4DW6A 2DA5A 4OIRF 2GM4A 3WTWC 2OCEA 1W4MA 1Y8QB 3P9TA 2B1EA 5CLSA 1O7LA 1QZYA 2JT1A 2VJ5A 1LB2A 3HDDA 2ZCXA 2R7QA 4XK4A 4AVPA 4A0ZA 3T6NA 4A3IJ 1XDUA 1YLFA 3ELKA 1D1BA 5IOZA 4AIKA 4G7HF 1VQOI 3EPZA 4CCOA 2D45A 5F6FA 3VYSB 4YIFA 3E7LA 2ADUA 2WWYA 5GAEJ 3CCYA 2XB5A 4ABZA 3DBLB 2B7EA 4IJAA 3GBGA 1MZBA 1ETYA 3TMOA 2VOOA 3OIPA 3VDXA 1XCVA 4BQAA 2R7WA 3GEZA 4I0AA 1JKRC 3VVYA 4ASNA 3VIBA 1QA6A 3D5RC 3V78A 3WHBA 4ZYEA 5J1UA 4AUXA 3DEWA 2A6TA 4HBLA 2WUIA 2DYRH 3OR2C 1EH7A 4XBFA 4A3CJ 4IRHA 4G6TB 4DBRA 4IO9F 3IC7A 2WA0A 4ESFA 3PFYA 5HVQC 3QP5A 2WBMA 4GCTA 2ZJ2A 1GVDA 2F4MB 2FA5A 4HDUA 4U0WA 1KU7A 2F6CA 1A31A 2BXYA 2QKLB 3HPGA 3HBLA 1W0UA 3BWGA 2L5QA 4XORA 4BU2A 4E7JA 3RKWA 3LWFA 1MSFC 3C18A 2CV1A 3RQ4A 3PM1A 3CWRA 3F6VA 1OCRH 2EFNA 2LH9A 3SFZA 2IP2A 4DBQA 4RB1A 3VTIA 5LRSA 1F9NA 5LEKA 2QEXI 2WY7Q 3KKDA 3ZN1A 4UB6C 2MLKA 4B48A 1B72B 4BBRJ 1DP7P 3ZQ7A 1DDNA 3BROA 2P5LC 3FM3A 2PBXA 5J40A 5BMZA 4WXDA 4CUGA 3OMYA 5E79C 4UNOA 1HCRA 5DUIA 4F7ZA 3CCRI 5D18A 2ICWG 2YPRA 4Q47A 2D6YA 4KUMA 5K1YA 1W5TA 1HKTA 4W1UA 1ZRCA 1MDMA 3NRVA 1WH7A 5LHGA 1UCRA 5FKNA 3HHGA 1OR7C 1PJRA 5J8CA 5ERIA 1R6RA 3CO6C 4PUSA 4E7IA 3DPTA 3SZGA 4YFXF 1J5YA 4A0XA 1WCMJ 2DYSH 2P0WA 1X3UA 2AO9A 4JK1X 5LHIA 3VVZA 1EH6A 2DA3A 2DJIA 4XKBA 4H0EA 5BOXA 1XG1A 2DU9A 3KP4A 4HLYA 1W5CC 5HS7A 2EQRA 3S93A 4LK0F 3OSGA 3CJQB 3COLA 3EDPA 2FBQA 4B1RA 3QWLA 4A6EA 4BY1J 2CQNA 3K70D 5CVJA 3LA2A 4KT5C 5HLIA 2MH2A 1HXDA 3LMMA 3QQAA 2Y9YA 1GLNA 5HNHA 3F8CA 1IN4A 1MJBA 3CUQB 2QA4I 4X0GA 2W85A 1T08B 1WI9A 2NVQJ 2IS4A 3EGQA 2NX4A 3HJEA 3LFKA 2UWMA 2HOEA 1E0EA 3A0BC 1XB4A 1J75A 4EEFG 5LLQA 3SWHA 1ZHFA 3KLNA 2P81A 3TBIA 4UVCA 2PEXA 1S29A 2NNYA 4P1WA 4BJTA 4BYYA 2P7CB 2O7OA 4KN7X 2UXPA 2EV0A 2ESNA 2IW5A 3BG7A 4D7NA 1TWHJ 3CCJI 5B1BH 4XQFA 1QBJA 4XLPF 2O8XA 2RHAA 1WFXA 2E34A 2V1XA 3OOUA 3F21A 2K9SA 3COAC 5F04A 3SEQA 2DMPA 3LSIA 1WQ2A 5CKTA 3BR5A 3BTJA 4C2TA 2ME6A 3N4MA 4UV8A 4JOMA 5D8LB 4II2A 2NS8A 5D4SA 5DD8A 2HS5A 4P5OA 2PJRB 1P2FA 2BVLA 3ERMA 3D5LA 3S3NA 1NG7A 3QU3A 3OYGA 1IJWC 2XAHA 1HF0A 1JGGA 2OCCH 4ESJA 2RQQA 3FIWA 3EETA 2GQQA 4RAGA 2VONA 2UXIA 5JFRA 1XPXA 2EIKH 1SVOA 2IS1A 3HHHA 2XROA 2XVCA 2K40A 4M9SA 1G3SA 3RTRA 4DNCA 4RM2A 2LSOA 1BI3A 5CW8A 4DVYP 1REPC 2EV6A 3WHCA 2NVUB 2BOLA 2OJED 5ICCA 3T0YA 1FYKA 2PLYA 1S8NA 1GXPA 4GFBA 3ZN0A 3DFGA 1T39A 1VNDA 4HF1A 1MNEA 1VQLI 1BBYA 3QPLA 2RGVA 1XCBA 2BYVE 1VQ9I 1MIJA 4JNNA 3I53A 4BE1A 3NAUA 3C2HA 2KIUA 2Z3YA 5FFZA 5HLTA 4OIOF 3GZ5A 1LDKB 2HVSA 4XSXF 2R7ZJ 2DG8A 1R71A 2V79A 1RC9A 2VI6A 2VXDA 4M71A 2WAFA 3CJNA 4EJTA 2R7VA 1TL8A 2ZFUA 2H8RA 3A2KA 3T1BA 4U7BA 3DTKA 1G2HA 2JRMA 2NOJB 3J7AO 4KFCA 3A4CA 3ZR8X 1UG0A 2DT7B 1OPCA 2VKEA 4M3FA 4BS9A 3CMMA 1TZLA 3CCEI 2Y69H 3Q9VA 3HKZA 1DU0A 2LKPA 2R7DA 3CMEI 5FLVA 1DP3A 2IPQX 2CQKA 2D1HA 4HW0A 4WCGA 3KZIC 5J3LA 5BPIA 2ZMEB 1X1DA 3A1YA 3BLYA 3VODA 5D5VB 2V1UA 4UUSB 1O7FA 2RNJA 1YYVA 4CO8A 1FIPA 1OYYA 1RPWA 2V1DA 4Q48A 4LFUA 5E3MA 1E17A 3H3UA 3FISA 1DGWY 2HQNA 4D5CA 2FBIA 4V2FA 3L1PA 1YE9A 1Z77A 3K1PA 1FBUA 4IZZA 4A93J 5IY5H 2K27A 1YG2A 4HPQA 1YX5A 4AC0A 3P5JA 4F55A 1JKPC 2FE3A 4JX5A 5FLXZ 1R00A 1CF7B 2Z16A 5M5XJ 1SFXA 5EYRA 3LSTA 1UFMA 3ML6A 2ZSIB 3NARA 3TOBA 3GTPJ 3VSLA 5KVRA 3HSRA 2CQ7A 2XV4S 3S17J 2RASA 4EV0A 2WGBA 4RAYA 4BQOA 2ID3A 3JSOA 2FMLA 3U21A 3ZMSA 2GXBA 3FWEA 3PNTA 4HLXA 1MH3A 1X2NA 3JRBA 2WV0A 4BY7J 5IT9K 1UB9A 2JSPA 2RREA 3GTJJ 1VZ0A 1LDJA 3TGNA 5IT9Z 2QLZA 2R7RA 5F64A 3GTMJ 3RPUD 4P96A 1KQ8A 4UDSA 4B8XA 2R5ZA 2CQQA 3E5UA 4Y17A 2DOFA 2WB1N 2VJJA 4DYRA 3O3KA 3AKZA 1N75A 3VSKA 3NS4A 2CGPA 5M3MJ 2M30A 1TWCJ 2R93J 2XGDA 2IGOA 3IL2A 1LFPA 4KMUX 5CQEA 2LBFB 1SC7A 2HVQA 2LKXA 4Y15A 1TT0A 1FZPB 4MTEA 2ZXIA 2E5NA 4YIIA 4B43A 3OR1C 4O5VA 4MLOA 3LA7A 2E35A 1TC3C 1RETA 2EV5A 3K4JA 1MMGA 4KISA 2DJNA 2JUGA 2YUSA 1UI5A 3CCLI 4A3LJ 2VQLA 2AQFA 3KPHA 2VL8A 3MFKA 3V4GA 5FMPA 3ABMH 3C2BA 2HXIA 2M2EA 2UUZA 1GDTA 3KEQA 4FTHA 4R8HA 1MBHA 2E2JJ 2X85A 2OTLI 2LYCA 4S04A 5FB2A 4RLQA 1BW6A 3BTLA 4GXOA 3SFIA 2ZCWA 1NK3P 2Y31A 4N9HA 4N0BA 3LSRA 1Q1HA 3HOXJ 1DUXC 1UZCA 4XL9A 1USSA 4ZC3A 3CP2A 4FASD 3IRRA 1TW2A 3MZHA 1OCZH 3AFHA 3TO7A 3SZPA 3LNQA 1ZK8A 1I50J 5GTHC 1FSEA 1H89C 2PMUA 4GYGA 1OCOH 2CUFA 2W57A 4PJJA 3FM5A 1EA3A 3RJPA 1NH3A 3ABTA 2KIMA 4UUTA 1T95A 3H0GJ 2MH9A 4HNUA 4LGWA 3NWSA 2DW4A 2F5VA 4PSXA 2EK5A 3PIOF 3I56I 2HKXA 2F5FA 2GOMA 4RB3C 2IT0A 4N4NB 3IH4A 5DEQA 2R5YA 1S5LC 4DZJA 3C1DA 4NBQA 4LIVA 1XX5A 1TW3A 3QYBA 3AG3H 5B1AH 1IW7F 1DPRA 3BP8A 3SXYA 3GO5A 3IH3A 1ZRFA 2JTVA 2NP5A 3KEYA 3U2RA 2LY9A 2ZO4A 3BCBA 5BQTA 5ICEA 3REOA 1XGMA 2Z99A 4BEHB 2ELHA 3GWZA 2X6OA 4Y7NJ 3LSPA 1S7EA 3G73A 5HS9A 4K2EA 5CPRB 1HKQA 2EFPA 4G8XA 1K6YA 2OU2A 3FDYA 4BDZA 2LLKA 4MHGA 1AKHA 1R22A 5FHPA 1MNMC 2VBZA 2X0LA 3PO2J 1LEAA 2QCOA 5ILSA 3HOVJ 4MNUA 1JTYA 2DO7A 2JA7J 4FHTA 4BUPA 1T0FA 3VOEA 3FXUA 4UHTA 1YS6A 1APLC 2HPMA 4M9ZA 3O60A 1RI7A 2XGEA 3O6BB 1I3QJ 1RUNA 3D0SA 1A36A 4PGHA 2O61A 2YS9A 3DU5A 5BNGA 3KYCB 3S1RJ 3PPBA 1YW9A 1UI6A 3K1NA 1FYLA 2LRDA 2ISYA 4I99C 1U5TA 2A61A 3S32A 3OL3A 2GENA 5LGUA 4D7MA 2VODA 1PYVA 4OD5A 3KYLA 3GUDA 3KIOA 1R5HA 1K4SA 1YHQI 4QWQA 1KA8A 2EJRA 4RB0A 2COMA 3PJRA 4YRVA 5GAHJ 4RDUA 2QBYA 5D4RA 3FXOA 4PFPA 3U1KA 2H27A 5KNLA 1LKXA 5D5XB 1VQ7I 3K8PC 3UNGC 4OU0A 4L18B 3AL0C 3DU6A 3MD2A 4UXNA 4IOAF 3FRQA 3ZRGA 3KP5A 1FJLA 4E7ZA 2K3FA 2N8GA 3WU1B 4PFOA 4S0HB 1VQMI 1J59A 3I59A 2IS6A 3RH2A 1FEXA 2FQ4A 5L3GA 3K70C 2BGCA 3H1CA 4P9FA 1JGSA 3HUGA 1O3QA 1LNWA 2DMQA 1YX3A 2DN0A 3L2CA 3E6MA 3GW2A 3B02A 3PNVA 3S2WA 3DWLE 1ZLKA 4N9IA 3O8HA 5K7ZA 2EA2A 2HQ5A 3B6CA 3WE2A 4KYWA 4M6YA 2NRAC 4QIWN 4F3QA 3CZ6A 2Q8KA 4BACA 5ICGA 5FKKA 3WTYC 1E3PA 3WU0A 4UV9A 1EH8A 4XKVA 5CJ9A 4I01A 5IYDJ 2XASA 1JTXA 5C3EJ 2X6YA 2QKOA 1TWAJ 1IXCA 3R0AA 2OUMA 3RDIA 4LB6B 4A3JJ 2HFHA 1W7PA 3ZXSA 3TP0A 1B4AA 1ZKGA 1VQKI 2QGUA 4M72A 1OJLA 1SMTA 3BPVA 2R7XA 1R4NB 3DLAA 4CYCA 1KU3A 3ABUA 5CQGA 2CUZA 2UXHA 4NC8A 4IRIA 2OQRA 1KONA 5EJCA 1V5EA 2L9SA 4AU7A 4A5NA 1XMXA 3F8FA 3R6SA 2CG4A 2FNPA 4ESBA 4DJAA 5DCMA 4LIUA 3LAPA 3S1NJ 1F4KA 1R4MB 1D8JA 2W4SA 3MKLA 2HPIA 3FF5A 2R0QC 2GIZA 3PSIA 4M3BA 3KETA 5TISC 2Y0SA 3QRFF 2XAJA 3BR1A 2CQXA 5FFXA 2E60A 2NXNB 1P7IA 3M8JA 2HWVA 4EATA 4A3FJ 2QYOA 3QU6A 2XRLA 4IHWA 2K9MA 1ON2A 1YJNI 2K7LA 1RKTA 2XGCA 3RZOJ 2P6TA 1ZR2A 4A3EJ 3HTHA 3HOSA 3B73A 3HZJA 2Z5UA 1K78A 1EKEA 1XGSA 1IC8A 2IA0A 3FKIJ 3FHNA 3GTLJ 2ESHA 1T0FC 6PAXA 3X2QH 4FQGA 2XF7A 1U9OA 2JMWA 2M34A 4MQVA 2YVXA 3H35A 2LK2A 1FLIA 2EIJH 1K79A 4KT6A 3OYDA 3BJBA 4AIJA 2Y0SN 4FISA 3T8RA 1Y6IA 3ECOA 1TTYA 1SMYF 4XLNF 1SD4A 2W00A 2HI3A 3F8MA 1DPUA 2JA5J 1I3AA 1QZEA 1YS7A 3BQYA 4ZTFA 3K2ZA 4RBOA 2IEKA 4C3IJ 2OBPA 1WJAA 2MG4A 5IT3A 1TNTA 3F9KA 2CS3A 2V9PA 3B81A 1A35A 3MMYB 2FBKA 1QPMA 2GZWA 1BL0A 4PCQA 3DCFA 2KJCA 2ZXJA 1ETOA 1AA7A 2H1KA 4WIBA 1RESA 2VLAA 5GP9A 4XOPA 3A0HC 3ON4A 1BJZA 2QF7A 1KGSA 2XUBA 3BOQA 1WJFA 5KK1A 1RUOA 1IUYA 4C9YA 4PJMA 1V54H 2DXIA 5GPCA 2ZCMA 1FTZA 3WODF 5IOYA 5L3FA 1Y39A 4OINF 3VYUB 2TRTA 2REKA 1FYMA 2UXOA 3DKXA 3LOCA 4OMZA 1RRJA 2L01A 1M1EB 4C2MA 2JN6A 2RV8A 4C2UA 2BV6A 4OD4A 2F48A 2KDOA 3H5RA 3K0LA 4RAFA 1YW8A 1X1PA 2VQGA 2DPUA 2HNHA 3I71A 5M5WJ 1G4DA 3QBMA 1G3WA 2XSDC 2PFBA 1WSUA 4RGXA 4BGDA 1D5YA 2HVRA 5E3NA 3IKTA 2STTA 2DG7A 3G6EI 1B59A 1GV2A 4MO7A 5LRRA 5ILUA 1D0ZA 1GV5A 2HTSA 3CESA 3ABLH 1FP2A 5DDGA 1TQIA 4JQFA 2ZCNA 2R7TA 2RC4A 3PL8A 2DQLA 4RLFA 1LE8A 1FTTA 1S72I 2M5WA 2DQRA 4IF4A 3VOXA 1FOKA 2C6YA 1R7JA 3SHFA 4NC7A 2D5VA 4ENJA 3OV8A 4CCNA 1JJ8C 3GTGJ 1BJAA 2R5ZB 2YR2A 1N77A 1H8AC 1O4XA 3M8EA 4ZYDA 5J47A 2DMUA 3VWBA 4EJWA 4PXIA 2EZHA 3FXJA 1EV7A 2HYJA 4AIDA 3DXJF 1SD7A 2DPDA 2GXGA 2K4BA 4OIPF 4EMSA 3TW7A 2L0KA 4KICA 3ZQIA 3AL0B 1YTYA 2ZB9A 1ETXA 4G94A 2OTJI 2DMNA 3BCGA 1W1WE 2D1VA 4HAMA 1JKOC 1ZGAA 4CZCA 4B44A 2VE8A 1NHAA 4YFNF 1WRJA 3DTIA 2PG4A 3P9IA 3GEUA 2NVYJ 3CC4I 4XN3A 2BZTA 3GFIA 1HSJA 2BE5F 1VFCA 1JE8A 3ISPA 3V7CA 5GAGJ 1VTNC 2DDAA 3EUAA 3BG9A 3G1LA 3QP6A 1FMWA 2L9NA 4BL0B 2F5DA 1G3YA 2Y2ZA 2EZLA 3IAM2 2F4IA 3G1MA 2JWTA 3KZZA 4L5JA 1SFOJ 3W3CA 4D0PA 2DT5A 2KZVA 2L7FP 3WTVC 3AG4H 4Y13A 5CVVA 1IN8A 5HDGA 2G7SA 3ZCOA 3FBIB 5DUKA 4U7DA 2YX4A 1QU3A 4RGUA 1JUMA 2ZJPF 5K7HA 5LD2C 4V19K 1Y56A 1HKSA 3WTTC 5IYBJ 5D6EA 2W24A 1ZARA 2ISZA 2V6EA 1BR1A 4EM0B 4BAYA 3JAMK 2KT0A 2MA3A 2FXAA 1LJ9A 3JAMZ 1D3YA 1O3SA 4BXXJ 2OC6A 2HYTA 3OYKA 2EZIA 3R60A 5B3SH 1R36A 4N4OB 3WGGA 3HSEA 2DTZA 2M3AA 2KQRA 1Z3YA 4FE4A 2H6CA 3I55I 5E18F 2XKPA 4U0YA 2OERA 4ZZDA 3VOKA 4BHCA 1MBEA 1OMIA 4ZDLA 4NDLA 2OZUA 4XRSA 4LITA 1JXSA 2DTRA 2BY0A 4XRSG 2JK3A 2R5YB 3CC2I 2MC3A 1K61A 3HTAA 2V9KA 3KEOA 4X6AJ 1MMSA 1IDZA 4A12A 3DLLF 1I6HJ 4BXFA 2R7FA 2Q0OA 4IEJA 2V26A 3GX4X 1I27A 1B8IB 2GUHA 1PDNC 4BXUA 3MKYB 1OYWA 1DU6A 1D8KA 3E5QA 1YJWI 1S7OA 4IQJA 1YQAA 2G9WA 3PIPF 1UHSA 4L9TA 4M73A 1Z6RA 2MBFA 2O8KA 2DA4A 2LFBA 3V6GA 2ID6A 4HA8A 3OYCA 5HAWA 5AIPA 1V4RA 1YW7A 4JKZA 1YIOA 3M8FA 3KFWX 1P4WA 1AKHB 5JI6A 3JRHA 1R5ID 3CDIA 3CJDA 1D0YA 1GXQA 2BHYA 2K4JA 1YRNB 3CLQA 2VQCA 3VW0A 1MW7A 4JYKA 3E7QA 3DV8A 3BJOA 2OF7A 4RB2C 1BN5A 3JRGA 2Q24A 1LFBA 5FGLA 2R7OA 4GCKA 1ODDA 2L7KA 1WVRA 2ZSHB 2KRFA 2XAQA 3I0TA 2M0MA 3LL7A 2PMZA 1MD0A 3GLXA 4LLGF 1I1GA 3ZQFA 2UZKA 1N25A 1UHMA 5DV5A 2KDZA 4BBSJ 3P7NA 2FNAA 2K5CA 3HGGA 4BE0A 1BOBA 3KX2A 1B1BA 1ZG5A 2Q1ZB 3I54A 3J7ZI 4IKFA 4GO1A 4A3MJ 2WAQA 2E36A 4IRVA 2VPRA 3NRGA 2BVMA 4HKUA 4A6DA 3ULQB 1PP8F 4IHSA 3I4MJ 4OWRB 2H8WA 3FBNB 1GUUA 2KHMA 3QPTA 5JLWA 4MIMA 2E19A 2Y0MA 5H2FC 1WHUA 2QBYB 3FMSA 1K4TA 4A3DJ 3TDZC 1MBKA 2PMZN 3GZ6A 1VQ8I 4A0YA 3IWZA 3G71I 2GA1A 2GLOA 3JR9A 3H9GA 3PSFA 1F1ZA 1R1UA 3CQZJ 4A3GJ 3CMYA 4J19A 1HBXG 4G6DA 2FMYA 3RYPA 4F52A 2R92J 1XSXA 2KIFA 1G59A 3BRUA 1W5SA 3CLOA 3G1OA 5FLXK 3HPHA 2WAQN 3I59B 2B63J 1V3FA 1I39A 3HKZN 4BJ5C 2F5CA 4ZJZA 2ZOYA 1G3TA 5J4YA 3BR6A 5J6XA 4BDYA 2HYGD 1XD7A 3HSFA 2NOGA 4NB5A 1P6RA 3KP6A 3K4KA 1WKMA 2DA2A 5TJJA 1QVTA 5K5RA 2M7BA
chains in the Genus database with same CATH topology
2E1OA 1IG7A 1JUPA 2ME0A 2XPVA 3O60A 2IAIA 3BR2A 3HIMA 2XGEA 1I3QJ 4KWAA 1MBFA 2YS9A 5BNGA 3S1RJ 3PPBA 3HOUJ 1F43A 3BG5A 1UG2A 1UI6A 3ZOBA 3OIOA 3OSFA 2GENA 4XIDA 4D7MA 1H88C 2G7LA 2DA1A 1Z0XA 1ZTRA 3FK6A 3ZQCA 4IHYA 4ME9A 4RDUA 2QTQA 3RD3A 1A6IA 1IUFA 4HNVA 3VPRA 5D1RA 4C3HJ 3HGYA 3ANGA 2LP0A 3SDGA 3KZ9A 2Y9ZA 3HOWJ 4DW6A 3NPIA 2DA5A 3KKCA 2GM4A 5F0CA 2W53A 3GTKJ 4M3DA 4MFDA 2HOSA 3FRQA 3HTJA 3P9TA 1WH5A 1FJLA 4GCLA 2G0EA 2N8GA 3HDDA 1ORKA 4S0HB 4XK4A 2ZCXA 2Y30A 3RH2A 3T6NA 4A3IJ 1FEXA 5IOZA 2FQ4A 4QTRA 1A5JA 2G7GA 2DMQA 3E7LA 5C4YA 2DN0A 2L7MP 3CCYA 2XB5A 4ABZA 1PUFA 2UXUA 3O8HA 5K7ZA 3GBGA 2HQ5A 3B6CA 1ETYA 4QIWN 5EFYA 3H3VK 3S5RA 5F1JA 2CJJA 1JKRC 5EDNA 3VVYA 2COBA 3BR0A 3VIBA 1P7JA 5FKKA 3V78A 3WHBA 5EEAA 5J1UA 4AUXA 3DEWA 2QWTA 2WUIA 5C44J 4A3CJ 5EZHA 1SANA 3LHQA 2JA8J 3MNLA 5IYDJ 2TCTA 4JX4A 4GCTA 1JTXA 5J1YA 3C07A 5C3EJ 1GVDA 4JX6A 4W97A 2QKOA 3A01B 1TWAJ 1W0UA 3HBLA 4MFEA 3F1BA 3HEFA 1MSFC 5D19A 3QPSA 4A3JJ 5GPAA 3PM1A 2EBIA 3TP0A 1E3OC 3S15J 2QIBA 3CWRA 1ZKGA 3S14J 3Q0VA 1OJLA 1T56A 3KKDA 1B72B 3NXCA 4BBRJ 4CYCA 5EGOB 2X48A 2EH3A 2UXHA 2PBXA 3S2HJ 4I6ZA 1HCRA 3AQTA 5D18A 2D6YA 1Y1VJ 3BTIA 4W1UA 3S1NJ 1WH7A 2OI8A 1JUSA 3MKLA 2HOTA 5FKNA 2R0QC 4M3BA 5EG0B 1IGNA 4M3EA 3BR1A 1ZQ3P 2K9NA 2CQXA 4V2GA 1P7IA 4A3FJ 1WCMJ 4FCYA 3PASA 1QVUA 2XRLA 4IHWA 2AO9A 3VVZA 1RKTA 2XGCA 2DA3A 3RZOJ 2QOPA 5E3OA 1ZR2A 4A3EJ 3HTHA 1ETWA 5CXGA 1NTCA 1XG1A 2MW8A 3F0CA 2EQRA 3A02A 2LTPA 3OSGA 1EF4A 2K9QA 1IC8A 5HBUA 3FKIJ 3JRAA 3COLA 3TP3A 3GTLJ 2FBQA 4B1RA 3A01A 3SJMA 4BY1J 3HOZJ 2E2IJ 3M3YJ 4MK6A 3HB9A 1U9OA 2JMWA 2M34A 2LK2A 3QQAA 5FKMA 2Y9YA 1ETVA 3VVXA 3BJBA 2ECBA 1XC5A 2X9DA 2Y0SN 4FISA 2NVQJ 3EGQA 5EF6A 4YZEA 1RKWA 2NX4A 5C4JJ 2W48A 1B72A 1TWGJ 2NP3A 2PZ9A 2GFNA 2XPWA 3IV5A 5EGOA 1JKQC 4EEFG 2P81A 1MH4A 2HI3A 2JA5J 1POGA 1HLVA 3LSGA 3BQYA 2AHQA 3DPJA 2O7OA 3BT9A 1GT0C 2UXPA 4RBOA 2IEKA 4D7NA 4C3IJ 1TWHJ 4CYCB 2MG4A 3PO3J 2RHAA 3B81A 3OOUA 3HTIA 3BR3A 2K9SA 3VUQA 1BL0A 5F04A 5EZGA 3DCFA 3NI7A 2DMPA 1ETOA 2H1KA 3RZDJ 3BR5A 4FE7A 1RESA 3BTJA 4XRMA 5EG0A 3S16J 2ME6A 4L62A 5FKLA 4UUSA 3EUPA 5GP9A 3RKQA 3M4OJ 4DYCA 3ON4A 1BJZA 2QF7A 3B6AA 3K2AA 1FIAA 1AU7A 3JREA 2NS8A 5GPCA 5IP7J 2ZCMA 1FTZA 5F0FA 5IOYA 1NK2P 1SGMA 1ITYA 2TRTA 2O9LA 2JJ7A 2REKA 2UXOA 4C2MJ 5CXIA 2HKUA 1IJWC 1HF0A 1JGGA 3LOCA 3VP5A 4C3JJ 2JN6A 3FIWA 3JRCA 2UXIA 2O7TA 2DMTA 2K40A 3TEDA 1Y1WJ 4X1EA 4DYQA 5CW8A 3TW6A 3WHCA 5M5WJ 3QBMA 2RAEA 2XSDC 5IPAA 1MBGA 1D5YA 4QSHA 5E3NA 2XDNA 5HSZA 2DG7A 1GV2A 4MO7A 5FLMJ 5M3FJ 3UKGA 3LJLA 1GV5A 4GFBA 1BW5A 5J1RA 1VNDA 3HE0A 1QRYA 1TWFJ 3JRFA 1Q1VA 2ZCNA 3QPLA 3BHQA 3HM5A 4IHXA 1AHDP 1LE8A 4I76A 1FTTA 1U78A 4JNNA 4M6VA 3NAUA 1ETKA 4BKXA 3GTOJ 2R7ZJ 3VOXA 2DG8A 5H9TA 1HOMA 4AC6A 2VI6A 4DZPA 2VUMJ 2D5VA 2YVEA 1WI3A 5IYCJ 2H8RA 3IH2A 4G12A 1G2HA 3I4NJ 1JJ8C 3GTGJ 2R5ZB 2VKEA 4M3FA 3BQZA 1O4XA 1H8AC 3G56A 2DMUA 2GBYA 1DU0A 1W0TA 4D5FA 2EZHA 1IRZA 4NN1A 4ICHA 3AQSA 4PXIA 5FLVA 2HYJA 5JLXA 5J3LA 2ZOZA 2FD5A 4A69C 3TW7A 2HXOA 2L0KA 3ZQIA 1X58A 4UUSB 4A3KJ 4AYBN 2ZB9A 1B8IA 5DS9A 1ETXA 1OFCX 4IHVA 2DMNA 3BCGA 3NNRA 1FIPA 1JKOC 1RPWA 5E3MA 2CU7A 1JT0A 4B4CA 2DA6A 4M3GA 3KNWA 3GEUA 2NVYJ 2FX0A 3FISA 4D5CA 1R9TJ 3L1PA 4V2FA 1VFCA 5M5YJ 4GFKA 3MN2A 1Z77A 3FK7A 2M9HA 3BG9A 3G1LA 4A93J 5IP9J 2EZLA 2Y2ZA 2M8GX 1CQTA 3G1MA 2JWTA 4AC0A 1SFOJ 1JKPC 4JX5A 1T33A 1YRNA 4ACIA 2L7FP 4JL3A 5M5XJ 5EYRA 3IUVA 3NARA 1OCTC 3GTPJ 2G7SA 1UMQA 2MGQA 2E2HJ 3ZQHA 3S17J 2RASA 2WGBA 2CRGA 1JUMA 1JJ6C 2ID3A 5K7HA 5IYBJ 3BNIA 3JRBA 1MH3A 1X2NA 3GZIA 2KT0A 4BY7J 3GTJJ 4BXXJ 2YVHA 2G3BA 4B3AA 3QKXA 2IU5A 2HYTA 3GTMJ 1ZR4A 2EZIA 4LOCA 1LE8B 2IBDA 3GTQJ 2WV1A 4UDSA 2R5ZA 2XPUA 1VF9A 1X2MA 2CQQA 2EZKA 3MVPA 3G7RA 2OPTA 1ZGWA 2DTZA 1VI0A 2WB1N 2HDDA 4DYRA 3ON2A 2NVTJ 4FE4A 3JRDA 5M3MJ 1ENHA 4Y52J 2OERA 1TWCJ 2R93J 2XGDA 3BTCA 4XICA 3VOKA 1MBEA 2HOAA 2ECCA 4NDLA 4XRSA 2LKXA 4XRSG 2JK3A 2R5YB 3A03A 2LD5A 1K61A 3HTAA 4MLOA 5K7FA 4X6AJ 1TC3C 1IDZA 1I6HJ 1RETA 1WGXA 2DJNA 4IEJA 5F0HA 2YUSA 2LR8A 1UI5A 4A3LJ 1B8IB 2CUEA 2GUHA 5FMPA 1LFUP 3C2BA 3W6VA 1DU6A 2HXIA 2M2EA 1F36A 1GDTA 4FTHA 1MBHA 1UHSA 2E2JJ 2O8KA 2DA4A 2LFBA 5IP6A 5DAJA 2ID6A 3V6GA 1BW6A 3BTLA 3SFIA 1NK3P 2Y31A 5FJ8J 1WPKA 3JRIA 2DA7A 5HAWA 3LSRA 4JKZA 3HOXJ 3O8GA 5E3LA 3JRHA 1AKHB 3CJDA 2YU9J 4JP0A 1YRNB 2M0CA 2F07A 3Q0UA 3VW0A 4JYKA 3LNQA 3E7QA 3LWJA 1ZK8A 2OF7A 3S1MJ 1I50J 3JRGA 1H89C 1LFBA 2Q24A 5FGLA 4GCKA 2CUFA 5HODA 4L5EA 3Q3SA 9ANTA 1IDYA 3ZQFA 3RQIA 4UUTA 3H0GJ 2KDZA 4BBSJ 5AQCA 3HGGA 3D1NI 1IV6A 3Q0WA 4GFLA 2L9RA 3S2DJ 4NELA 3IH4A 2NS7A 1U9NA 3CDLA 2R5YA 2V57A 4DZJA 4A3MJ 2VKVA 5FKOA 2VPRA 4A3BJ 3HOYJ 3NRGA 4HKUA 3CRJA 3I4MJ 3LSJA 1GUUA 5JLWA 5K58A 4MIMA 1BA5A 2E19A 3IH3A 2L7ZA 4MXMA 3S1QJ 2FJ1A 2NP5A 1K83J 4A3DJ 3VW1A 2LY9A 1MBKA 2PMZN 3K7AJ 5C4XJ 3VW2A 1U8BA 1ETQA 2MSYA 5F27A 2GLOA 3LSPA 2X6OA 4Y7NJ 3JR9A 3ANPA 1S7EA 3CQZJ 1HDDC 3CMYA 4A3GJ 4J19A 1QPIA 2LVSA 2R92J 3JSJA 4CGRA 2LLKA 1AKHA 1XS9A 5FHPA 3BRUA 3G1OA 5F08A 1RR7A 2WAQN 3BG3A 1MNMC 2B63J 3HKZN 2XB0X 5DTDA 3PO2J 2QCOA 3HOVJ 1MSEC 2ZOYA 2ELKA 1OCPA 3BR6A 3ZQGA 2I10A 1JTYA 2JA7J 2JA6J 2NVXJ 2NOGA 3ZQLA 1JT6A 2DA2A 1HDPA 1PUFB 1QVTA 4AF5A 1MBJA 1APLC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E1O A;  1IG7 A;  1JUP A;  2ME0 A;  2XPV A;  3O60 A;  2IAI A;  3BR2 A;  3HIM A;  2XGE A;  1I3Q J;  4KWA A;  1MBF A;  2YS9 A;  5BNG A;  3S1R J;  3PPB A;  3HOU J;  1F43 A;  3BG5 A;  1UG2 A;  1UI6 A;  3ZOB A;  3OIO A;  3OSF A;  2GEN A;  4XID A;  4D7M A;  1H88 C;  2G7L A;  2DA1 A;  1Z0X A;  1ZTR A;  3FK6 A;  3ZQC A;  4IHY A;  4ME9 A;  4RDU A;  2QTQ A;  3RD3 A;  1A6I A;  1IUF A;  4HNV A;  3VPR A;  5D1R A;  4C3H J;  3HGY A;  3ANG A;  2LP0 A;  3SDG A;  3KZ9 A;  2Y9Z A;  3HOW J;  4DW6 A;  3NPI A;  2DA5 A;  3KKC A;  2GM4 A;  5F0C A;  2W53 A;  3GTK J;  4M3D A;  4MFD A;  2HOS A;  3FRQ A;  3HTJ A;  3P9T A;  1WH5 A;  1FJL A;  4GCL A;  2G0E A;  2N8G A;  3HDD A;  1ORK A;  4S0H B;  4XK4 A;  2ZCX A;  2Y30 A;  3RH2 A;  3T6N A;  4A3I J;  1FEX A;  5IOZ A;  2FQ4 A;  4QTR A;  1A5J A;  2G7G A;  2DMQ A;  3E7L A;  5C4Y A;  2DN0 A;  2L7M P;  3CCY A;  2XB5 A;  4ABZ A;  1PUF A;  2UXU A;  3O8H A;  5K7Z A;  3GBG A;  2HQ5 A;  3B6C A;  1ETY A;  4QIW N;  5EFY A;  3H3V K;  3S5R A;  5F1J A;  2CJJ A;  1JKR C;  5EDN A;  3VVY A;  2COB A;  3BR0 A;  3VIB A;  1P7J A;  5FKK A;  3V78 A;  3WHB A;  5EEA A;  5J1U A;  4AUX A;  3DEW A;  2QWT A;  2WUI A;  5C44 J;  4A3C J;  5EZH A;  1SAN A;  3LHQ A;  2JA8 J;  3MNL A;  5IYD J;  2TCT A;  4JX4 A;  4GCT A;  1JTX A;  5J1Y A;  3C07 A;  5C3E J;  1GVD A;  4JX6 A;  4W97 A;  2QKO A;  3A01 B;  1TWA J;  1W0U A;  3HBL A;  4MFE A;  3F1B A;  3HEF A;  1MSF C;  5D19 A;  3QPS A;  4A3J J;  5GPA A;  3PM1 A;  2EBI A;  3TP0 A;  1E3O C;  3S15 J;  2QIB A;  3CWR A;  1ZKG A;  3S14 J;  3Q0V A;  1OJL A;  1T56 A;  3KKD A;  1B72 B;  3NXC A;  4BBR J;  4CYC A;  5EGO B;  2X48 A;  2EH3 A;  2UXH A;  2PBX A;  3S2H J;  4I6Z A;  1HCR A;  3AQT A;  5D18 A;  2D6Y A;  1Y1V J;  3BTI A;  4W1U A;  3S1N J;  1WH7 A;  2OI8 A;  1JUS A;  3MKL A;  2HOT A;  5FKN A;  2R0Q C;  4M3B A;  5EG0 B;  1IGN A;  4M3E A;  3BR1 A;  1ZQ3 P;  2K9N A;  2CQX A;  4V2G A;  1P7I A;  4A3F J;  1WCM J;  4FCY A;  3PAS A;  1QVU A;  2XRL A;  4IHW A;  2AO9 A;  3VVZ A;  1RKT A;  2XGC A;  2DA3 A;  3RZO J;  2QOP A;  5E3O A;  1ZR2 A;  4A3E J;  3HTH A;  1ETW A;  5CXG A;  1NTC A;  1XG1 A;  2MW8 A;  3F0C A;  2EQR A;  3A02 A;  2LTP A;  3OSG A;  1EF4 A;  2K9Q A;  1IC8 A;  5HBU A;  3FKI J;  3JRA A;  3COL A;  3TP3 A;  3GTL J;  2FBQ A;  4B1R A;  3A01 A;  3SJM A;  4BY1 J;  3HOZ J;  2E2I J;  3M3Y J;  4MK6 A;  3HB9 A;  1U9O A;  2JMW A;  2M34 A;  2LK2 A;  3QQA A;  5FKM A;  2Y9Y A;  1ETV A;  3VVX A;  3BJB A;  2ECB A;  1XC5 A;  2X9D A;  2Y0S N;  4FIS A;  2NVQ J;  3EGQ A;  5EF6 A;  4YZE A;  1RKW A;  2NX4 A;  5C4J J;  2W48 A;  1B72 A;  1TWG J;  2NP3 A;  2PZ9 A;  2GFN A;  2XPW A;  3IV5 A;  5EGO A;  1JKQ C;  4EEF G;  2P81 A;  1MH4 A;  2HI3 A;  2JA5 J;  1POG A;  1HLV A;  3LSG A;  3BQY A;  2AHQ A;  3DPJ A;  2O7O A;  3BT9 A;  1GT0 C;  2UXP A;  4RBO A;  2IEK A;  4D7N A;  4C3I J;  1TWH J;  4CYC B;  2MG4 A;  3PO3 J;  2RHA A;  3B81 A;  3OOU A;  3HTI A;  3BR3 A;  2K9S A;  3VUQ A;  1BL0 A;  5F04 A;  5EZG A;  3DCF A;  3NI7 A;  2DMP A;  1ETO A;  2H1K A;  3RZD J;  3BR5 A;  4FE7 A;  1RES A;  3BTJ A;  4XRM A;  5EG0 A;  3S16 J;  2ME6 A;  4L62 A;  5FKL A;  4UUS A;  3EUP A;  5GP9 A;  3RKQ A;  3M4O J;  4DYC A;  3ON4 A;  1BJZ A;  2QF7 A;  3B6A A;  3K2A A;  1FIA A;  1AU7 A;  3JRE A;  2NS8 A;  5GPC A;  5IP7 J;  2ZCM A;  1FTZ A;  5F0F A;  5IOY A;  1NK2 P;  1SGM A;  1ITY A;  2TRT A;  2O9L A;  2JJ7 A;  2REK A;  2UXO A;  4C2M J;  5CXI A;  2HKU A;  1IJW C;  1HF0 A;  1JGG A;  3LOC A;  3VP5 A;  4C3J J;  2JN6 A;  3FIW A;  3JRC A;  2UXI A;  2O7T A;  2DMT A;  2K40 A;  3TED A;  1Y1W J;  4X1E A;  4DYQ A;  5CW8 A;  3TW6 A;  3WHC A;  5M5W J;  3QBM A;  2RAE A;  2XSD C;  5IPA A;  1MBG A;  1D5Y A;  4QSH A;  5E3N A;  2XDN A;  5HSZ A;  2DG7 A;  1GV2 A;  4MO7 A;  5FLM J;  5M3F J;  3UKG A;  3LJL A;  1GV5 A;  4GFB A;  1BW5 A;  5J1R A;  1VND A;  3HE0 A;  1QRY A;  1TWF J;  3JRF A;  1Q1V A;  2ZCN A;  3QPL A;  3BHQ A;  3HM5 A;  4IHX A;  1AHD P;  1LE8 A;  4I76 A;  1FTT A;  1U78 A;  4JNN A;  4M6V A;  3NAU A;  1ETK A;  4BKX A;  3GTO J;  2R7Z J;  3VOX A;  2DG8 A;  5H9T A;  1HOM A;  4AC6 A;  2VI6 A;  4DZP A;  2VUM J;  2D5V A;  2YVE A;  1WI3 A;  5IYC J;  2H8R A;  3IH2 A;  4G12 A;  1G2H A;  3I4N J;  1JJ8 C;  3GTG J;  2R5Z B;  2VKE A;  4M3F A;  3BQZ A;  1O4X A;  1H8A C;  3G56 A;  2DMU A;  2GBY A;  1DU0 A;  1W0T A;  4D5F A;  2EZH A;  1IRZ A;  4NN1 A;  4ICH A;  3AQS A;  4PXI A;  5FLV A;  2HYJ A;  5JLX A;  5J3L A;  2ZOZ A;  2FD5 A;  4A69 C;  3TW7 A;  2HXO A;  2L0K A;  3ZQI A;  1X58 A;  4UUS B;  4A3K J;  4AYB N;  2ZB9 A;  1B8I A;  5DS9 A;  1ETX A;  1OFC X;  4IHV A;  2DMN A;  3BCG A;  3NNR A;  1FIP A;  1JKO C;  1RPW A;  5E3M A;  2CU7 A;  1JT0 A;  4B4C A;  2DA6 A;  4M3G A;  3KNW A;  3GEU A;  2NVY J;  2FX0 A;  3FIS A;  4D5C A;  1R9T J;  3L1P A;  4V2F A;  1VFC A;  5M5Y J;  4GFK A;  3MN2 A;  1Z77 A;  3FK7 A;  2M9H A;  3BG9 A;  3G1L A;  4A93 J;  5IP9 J;  2EZL A;  2Y2Z A;  2M8G X;  1CQT A;  3G1M A;  2JWT A;  4AC0 A;  1SFO J;  1JKP C;  4JX5 A;  1T33 A;  1YRN A;  4ACI A;  2L7F P;  4JL3 A;  5M5X J;  5EYR A;  3IUV A;  3NAR A;  1OCT C;  3GTP J;  2G7S A;  1UMQ A;  2MGQ A;  2E2H J;  3ZQH A;  3S17 J;  2RAS A;  2WGB A;  2CRG A;  1JUM A;  1JJ6 C;  2ID3 A;  5K7H A;  5IYB J;  3BNI A;  3JRB A;  1MH3 A;  1X2N A;  3GZI A;  2KT0 A;  4BY7 J;  3GTJ J;  4BXX J;  2YVH A;  2G3B A;  4B3A A;  3QKX A;  2IU5 A;  2HYT A;  3GTM J;  1ZR4 A;  2EZI A;  4LOC A;  1LE8 B;  2IBD A;  3GTQ J;  2WV1 A;  4UDS A;  2R5Z A;  2XPU A;  1VF9 A;  1X2M A;  2CQQ A;  2EZK A;  3MVP A;  3G7R A;  2OPT A;  1ZGW A;  2DTZ A;  1VI0 A;  2WB1 N;  2HDD A;  4DYR A;  3ON2 A;  2NVT J;  4FE4 A;  3JRD A;  5M3M J;  1ENH A;  4Y52 J;  2OER A;  1TWC J;  2R93 J;  2XGD A;  3BTC A;  4XIC A;  3VOK A;  1MBE A;  2HOA A;  2ECC A;  4NDL A;  4XRS A;  2LKX A;  4XRS G;  2JK3 A;  2R5Y B;  3A03 A;  2LD5 A;  1K61 A;  3HTA A;  4MLO A;  5K7F A;  4X6A J;  1TC3 C;  1IDZ A;  1I6H J;  1RET A;  1WGX A;  2DJN A;  4IEJ A;  5F0H A;  2YUS A;  2LR8 A;  1UI5 A;  4A3L J;  1B8I B;  2CUE A;  2GUH A;  5FMP A;  1LFU P;  3C2B A;  3W6V A;  1DU6 A;  2HXI A;  2M2E A;  1F36 A;  1GDT A;  4FTH A;  1MBH A;  1UHS A;  2E2J J;  2O8K A;  2DA4 A;  2LFB A;  5IP6 A;  5DAJ A;  2ID6 A;  3V6G A;  1BW6 A;  3BTL A;  3SFI A;  1NK3 P;  2Y31 A;  5FJ8 J;  1WPK A;  3JRI A;  2DA7 A;  5HAW A;  3LSR A;  4JKZ A;  3HOX J;  3O8G A;  5E3L A;  3JRH A;  1AKH B;  3CJD A;  2YU9 J;  4JP0 A;  1YRN B;  2M0C A;  2F07 A;  3Q0U A;  3VW0 A;  4JYK A;  3LNQ A;  3E7Q A;  3LWJ A;  1ZK8 A;  2OF7 A;  3S1M J;  1I50 J;  3JRG A;  1H89 C;  1LFB A;  2Q24 A;  5FGL A;  4GCK A;  2CUF A;  5HOD A;  4L5E A;  3Q3S A;  9ANT A;  1IDY A;  3ZQF A;  3RQI A;  4UUT A;  3H0G J;  2KDZ A;  4BBS J;  5AQC A;  3HGG A;  3D1N I;  1IV6 A;  3Q0W A;  4GFL A;  2L9R A;  3S2D J;  4NEL A;  3IH4 A;  2NS7 A;  1U9N A;  3CDL A;  2R5Y A;  2V57 A;  4DZJ A;  4A3M J;  2VKV A;  5FKO A;  2VPR A;  4A3B J;  3HOY J;  3NRG A;  4HKU A;  3CRJ A;  3I4M J;  3LSJ A;  1GUU A;  5JLW A;  5K58 A;  4MIM A;  1BA5 A;  2E19 A;  3IH3 A;  2L7Z A;  4MXM A;  3S1Q J;  2FJ1 A;  2NP5 A;  1K83 J;  4A3D J;  3VW1 A;  2LY9 A;  1MBK A;  2PMZ N;  3K7A J;  5C4X J;  3VW2 A;  1U8B A;  1ETQ A;  2MSY A;  5F27 A;  2GLO A;  3LSP A;  2X6O A;  4Y7N J;  3JR9 A;  3ANP A;  1S7E A;  3CQZ J;  1HDD C;  3CMY A;  4A3G J;  4J19 A;  1QPI A;  2LVS A;  2R92 J;  3JSJ A;  4CGR A;  2LLK A;  1AKH A;  1XS9 A;  5FHP A;  3BRU A;  3G1O A;  5F08 A;  1RR7 A;  2WAQ N;  3BG3 A;  1MNM C;  2B63 J;  3HKZ N;  2XB0 X;  5DTD A;  3PO2 J;  2QCO A;  3HOV J;  1MSE C;  2ZOY A;  2ELK A;  1OCP A;  3BR6 A;  3ZQG A;  2I10 A;  1JTY A;  2JA7 J;  2JA6 J;  2NVX J;  2NOG A;  3ZQL A;  1JT6 A;  2DA2 A;  1HDP A;  1PUF B;  1QVT A;  4AF5 A;  1MBJ A;  1APL C; 
#chains in the Genus database with same CATH topology
 4LD5 A;  2XPV A;  3FKJ A;  3BR2 A;  1H9T A;  3S3O A;  4KWA A;  1MBF A;  2ELJ A;  4L5I A;  4P55 A;  4CXF A;  2FQ3 A;  2VT3 A;  3H0D A;  1X4O A;  3WGH A;  1RR8 C;  3OYF A;  2CV0 A;  1FBQ A;  3OSF A;  2XRN A;  2FRH A;  4XRF A;  2G7L A;  4NQW A;  3ERE D;  3ZQC A;  4IHY A;  2Y48 A;  2XC7 A;  3H5N A;  1RZ4 A;  2K85 A;  4LK1 F;  5E1X A;  4ZZL A;  1ZG3 A;  2KIQ A;  3RD3 A;  1A6I A;  1IUF A;  1YIJ I;  1XN7 A;  4A5M A;  2IA2 A;  1W7P B;  3K4L A;  1LUJ B;  3G3Z A;  2LP0 A;  5DM7 F;  3SEZ A;  3LA3 A;  2EPF A;  4RM3 A;  1Y0N A;  3HYI A;  5F0C A;  4GCV A;  3GTK J;  2W53 A;  2GOX B;  2HOS A;  3HTJ A;  1W7P D;  1WH5 A;  5FRM A;  1MMD A;  4GCL A;  1PVE A;  1ORK A;  4LG0 A;  3OYM A;  1A5J A;  5DCM B;  5C4Y A;  3IUO A;  3I9V 2;  2L7M P;  3ZMU A;  4KIF A;  1SD6 A;  5JHU A;  1PUF A;  2UXU A;  3O2P E;  4BH9 A;  4EM1 A;  3H3V K;  1U3E M;  4IRG A;  3S5R A;  2RVC A;  4L9J A;  1T6S A;  1U6G A;  2COB A;  3BDD A;  3BR0 A;  3BZC A;  1B9M A;  4HYE A;  3V8J A;  5EEA A;  2QWT A;  2H94 A;  2KIS A;  5C44 J;  5EZH A;  2IXS A;  1P92 A;  1UHW A;  4F92 B;  2ZXW H;  2LF7 A;  3FX3 A;  1K78 B;  3CUQ A;  2TCT A;  4JX4 A;  2XIG A;  2CMP A;  2G7U A;  4JX6 A;  5D5W B;  2RNG A;  3OY9 A;  4GDF A;  2VKD A;  1OLT A;  4MFE A;  1ZYR F;  2JSC A;  3F22 A;  5D19 A;  4D9J A;  2EBI A;  2QIB A;  1E3O C;  3S15 J;  2ACJ A;  1MJ9 A;  4O3M A;  3S14 J;  3Q0V A;  4UVB A;  3RKY A;  3DBH B;  4ZDO A;  3NXC A;  2LOO A;  2EH3 A;  3PQK A;  4BNC A;  2EIL H;  3ZQQ A;  2XAF A;  2KKO A;  4KIG A;  2KL4 A;  1FX7 A;  4FT8 A;  2FBH A;  3BTI A;  5JVG F;  4RGR A;  4KDP A;  2OI8 A;  1TQM A;  2LY1 A;  2HOT A;  1I1S A;  1B9N A;  2VOP A;  3LQR A;  3TO9 A;  1E3H A;  2ZY9 A;  1Z6T A;  4E70 A;  1IGN A;  4M3E A;  2VB6 A;  4EM2 A;  4HX8 A;  4Y33 A;  4V2G A;  1XTA A;  4KA4 A;  1Z67 A;  3MKW B;  1B6A A;  3PAS A;  3L2R A;  2QQA A;  2L54 A;  3OYA A;  5FD5 A;  4OAZ A;  5CXG A;  4IPA A;  3VB2 A;  2DAO A;  4EGZ A;  4BQN A;  2MW8 A;  1VQP I;  2VN2 A;  2G7H A;  4NHJ A;  3K6G A;  3A02 A;  1EF4 A;  5HBU A;  5KHD A;  3L2Q A;  3JRA A;  3A01 A;  3SJM A;  2E1C A;  3HB9 A;  2KZG A;  3HOT A;  2MAB A;  3OS2 A;  1BC7 C;  4B09 A;  5FKM A;  1IF1 A;  1ETV A;  1WJE A;  3OIQ A;  4GRI A;  4PK4 A;  2O0Y A;  3RIR A;  1IN7 A;  4YZE A;  5EF6 A;  1RKW A;  2CH0 A;  2ZBK A;  5DD4 A;  3SDB A;  5C4J J;  2W48 A;  1TWG J;  3WG7 H;  1FSH A;  1MMN A;  2XPW A;  3IV5 A;  3T8T A;  5EGO A;  3GF2 A;  3WGI A;  1Z9C A;  1JKQ C;  3F6O A;  4YEJ A;  4WXC A;  2XAG A;  3FMR A;  1MH4 A;  3T5X A;  4ETS A;  3OOP A;  2AHQ A;  3DPJ A;  4OAY A;  2A69 F;  2XF5 A;  1EJ9 A;  5E17 F;  2RN7 A;  2BY2 A;  5HDK A;  2B3W A;  3HTI A;  3LFU A;  4Z6Y A;  1QHH D;  1P4X A;  3NI7 A;  2ZME A;  3RZD J;  2CFO A;  4XRM A;  5EG0 A;  3CJT B;  3S16 J;  2H6B A;  4Q4Z F;  5FKL A;  4UUS A;  3BCA A;  4L62 A;  3M4O J;  1HW1 A;  1W36 D;  2HKO A;  3K2A A;  3CF5 F;  1T38 A;  1LVK A;  1MDM B;  1AU7 A;  2E1M C;  2O6G E;  1X3Z B;  2VJ4 A;  5DCF A;  3F8B A;  2K02 A;  3S8P A;  1SGM A;  3TL4 X;  4CCJ A;  2O9L A;  2JVH A;  1IZ1 A;  4ITV A;  1IAW A;  1LEB A;  1G8X A;  3H9Q A;  4U87 A;  2XKO A;  4XSZ F;  2VAS A;  3PFI A;  4CGZ A;  3MZY A;  5H6R A;  4OIQ F;  2OA4 A;  5CVU A;  3OYE A;  3JRC A;  4HX4 A;  2O7T A;  4E4H A;  1LQ1 A;  2DMT A;  3K4M A;  2X4H A;  5FD6 A;  3LAJ A;  3TED A;  4X1E A;  2V6C A;  3R4K A;  2CYY A;  1SD5 A;  4XM3 A;  2FUG 2;  5IPA A;  4QSH A;  2XDN A;  2DDB A;  5HSZ A;  2VC1 A;  4PGG A;  5FLM J;  4QPO A;  5M3F J;  3LJL A;  2QZ8 A;  1F5T A;  1MMA A;  1S3J A;  2DFF A;  2I8D A;  3HE0 A;  2XAU A;  4CCL A;  3JRF A;  2E71 A;  4HOB A;  5LGN A;  2GWR A;  2R4G A;  3KZY A;  1QQI A;  4I76 A;  4CH7 A;  2DFH A;  1RNL A;  1KQ9 A;  4XOT A;  4AYB A;  1U78 A;  4IL6 C;  1ETK A;  1SFK A;  3I64 A;  4BKX A;  5HS8 A;  3GTO J;  4KIT B;  4PZJ A;  1OKR A;  4NUB A;  5H6Q A;  4AC6 A;  2OV7 A;  4XNF A;  4DZP A;  1MKM A;  1TQP A;  2YVE A;  1KU2 A;  4G12 A;  3U1D A;  4CCM A;  1YI2 I;  2J5P A;  1JI8 A;  3G56 A;  1V55 H;  3I58 A;  4XKC A;  2JQ7 A;  3WTX C;  4CIC A;  2IS2 A;  2VXZ A;  2HR3 A;  3C3W A;  3R61 A;  4D5F A;  5TRD A;  1IRZ A;  3AQS A;  1I5Z A;  3KP2 A;  3MEX A;  1WZ2 A;  3H3Z A;  4XON A;  3M9A A;  2CWE A;  5JLX A;  4A69 C;  3HRU A;  4HNT A;  5DYM A;  2DI3 A;  2HXO A;  3HRS A;  1Z91 A;  2QSH X;  2Z1D A;  1FWZ A;  2HU9 A;  4AYB N;  1OFC X;  4IHV A;  3NNR A;  4XKW A;  2CU7 A;  2X6X A;  2DA6 A;  4RA2 A;  3KNW A;  5CVI A;  2DFE A;  4R79 A;  5F1R A;  5M5Y J;  3MN2 A;  2ZJQ F;  1NG6 A;  3FXR A;  1K6O A;  2HZT A;  2M9H A;  3QOP A;  1XMA A;  1BIA A;  5IP9 J;  2DK8 A;  2M8G X;  2OQG A;  1CQT A;  2EFQ A;  4KJZ A;  1OCC H;  2VT2 A;  3KYD B;  4ACI A;  2HQA A;  3GME A;  5LHH A;  4JL3 A;  2V1N A;  3IUV A;  1FBS A;  2LKS A;  4E7L A;  3VEP A;  1Z7L A;  3ZQH A;  4EVI A;  3TQN A;  2CRG A;  5FRO A;  1R58 A;  2M4K A;  4Y3O A;  1GHC A;  1P9Q C;  2O03 A;  2LG4 A;  2NAZ A;  2L3D A;  2A07 F;  3NEU A;  1U5T C;  3P9C A;  4B3A A;  3QKX A;  2Z33 A;  2IU5 A;  4HG2 A;  2AXT C;  1ZR4 A;  2CW0 F;  2IBD A;  3GTQ J;  4HF0 A;  3FHZ A;  2EZK A;  2BW3 A;  1BIB A;  3MVP A;  3MZ8 A;  2HTJ A;  2OPT A;  1ZGW A;  2E7X A;  2NVT J;  3J81 Z;  3OYJ A;  2A6E F;  4YFK F;  2B0L A;  5L3E A;  3CDH A;  3BTC A;  3RCO A;  1IRX A;  1BR4 A;  1TLH B;  2ECC A;  2DK5 A;  2CV2 A;  3EUK L;  3IAS 2;  2W25 A;  4MTD A;  3A03 A;  4UUV A;  4UY8 I;  2E7W A;  3D5S C;  1U0J A;  1GVJ A;  2UXX A;  3I3L A;  5JVT A;  4CHU A;  5K7F A;  2IGM A;  3SQN A;  4IQ4 A;  2CW8 A;  5FGM A;  4ENK A;  3ONQ A;  4G7O F;  1WGX A;  5F0H A;  4ZYG A;  4NC6 A;  3HG9 A;  1QO0 D;  2D2W A;  5ILV A;  3HL2 A;  2LR8 A;  2QKM B;  3CC7 I;  4WWC A;  1LFU P;  1T98 A;  1F36 A;  2QVO A;  3QAH A;  3M7G A;  1IXS B;  3ASO H;  5J4V A;  2ETH A;  3CCM I;  5IP6 A;  3CCU I;  1D1C A;  1SFU A;  3JRI A;  5FJ8 J;  1WPK A;  2DA7 A;  2KRC A;  2QQB A;  3O8G A;  3AG1 H;  3GYH X;  4WXH A;  4EJO A;  1SAU A;  2VC0 A;  2XDV A;  3L00 A;  4U88 A;  4PJL A;  3BJA A;  5K5Q A;  3FMQ A;  3Q0U A;  3I4P A;  3OYH A;  3HRM A;  3LWJ A;  2R7U A;  3TO6 A;  4EJV A;  1HW2 A;  4BJ6 C;  1FNN A;  2M7A A;  3N05 A;  4F93 B;  2QUF A;  1OYI A;  2L4A A;  5E1Z B;  3PQJ A;  1HW5 A;  3RQI A;  2DT6 A;  2QWW A;  1BI1 A;  3JSP A;  3E5X A;  4IXA A;  2DCE A;  3D1N I;  1IV6 A;  1ONV A;  2L2O A;  2L9R A;  1X4P A;  4G6Q A;  2NS7 A;  2F4O B;  2O5R A;  1U9N A;  2CSO A;  3GFJ A;  4AVZ A;  1ZAO A;  2CW7 A;  2VKV A;  5FKO A;  2LNB A;  4J01 A;  4HX7 A;  4A3B J;  2BXZ A;  2ZNY A;  3IWF A;  4NQW B;  2RDP A;  2WAD A;  3QYE A;  1X1B A;  3LSJ A;  1MGT A;  2BY3 A;  4U0V A;  1BA5 A;  4U9N A;  3H5A A;  3M07 A;  4FX0 A;  4XLC A;  4BQQ A;  2Q2E A;  1CGP A;  3S1Q J;  2FJ1 A;  1C0W A;  2CUJ A;  3E6D A;  3MKZ A;  4ENN A;  4PSW A;  2XHK A;  1ETQ A;  3ECH A;  3F8N A;  1U8B A;  2M45 A;  3ZPL A;  3VYR B;  1HC8 A;  3DKY A;  4HST A;  4RMN A;  2JRT A;  4IHT A;  1R1V A;  4I02 A;  1QPI A;  4C30 A;  2LVS A;  3JW4 A;  4CGR A;  1TP4 A;  3CJR B;  3K9T A;  1X19 A;  2E1M B;  4DIQ A;  4DOZ A;  1TBX A;  3FXK A;  3MAJ A;  4LG0 B;  3DTE A;  1HA8 A;  3BG3 A;  2W82 A;  5GAD J;  2XB0 X;  1IV8 A;  4XLE A;  5DTD A;  1MSE C;  2DOD A;  2ELK A;  2PI0 A;  1OCP A;  3FXL A;  3W2V A;  2I10 A;  3ZQG A;  2JA6 J;  3W2A A;  1PUF B;  1Y0U A;  4BE2 A;  1WWX A;  2YX7 A;  2E1O A;  3WU2 C;  1JUP A;  2MC4 A;  2ME0 A;  3GFL A;  2IAI A;  3CCV I;  3HIM A;  1SEU A;  4B3X A;  4I98 B;  3HOU J;  4Z2Y A;  1UG2 A;  5L3C A;  2Z2S B;  3ZOB A;  2UV1 A;  3ESW B;  3OS1 A;  2R7S A;  3PNY A;  2XGX A;  3RPQ A;  3MWM A;  5FO5 A;  4CZZ A;  2DA1 A;  1Z0X A;  1FOW A;  1JHH A;  3FK6 A;  2GA2 A;  3K69 A;  4F91 B;  3UR3 C;  3RKX A;  2X6W A;  4ZH4 F;  4ME9 A;  3QYF A;  1BM9 A;  4ON0 A;  2QTQ A;  1X3W B;  3E6C C;  2K3P A;  3VPR A;  4KNY A;  1XMK A;  3AAF A;  3HGY A;  3DQV C;  3AG2 H;  2E5Z A;  2A68 F;  2Y9Z A;  3HOW J;  3NPI A;  2LF8 A;  2JVG A;  3KKC A;  2P5V A;  4M3D A;  4MFD A;  2AQE A;  2XF6 A;  2F2E A;  4E7S A;  5BPD A;  2G0E A;  3DPU A;  2Y30 A;  5KAF C;  3MQ0 A;  3E6B A;  2NYX A;  2MFZ A;  4QTR A;  1R1T A;  1SVM A;  4M6X A;  3ZP5 A;  4PJ0 C;  2G7G A;  1UEL B;  3LSM A;  2GIV A;  2W84 A;  3WE3 A;  3E3V A;  5EEG A;  2ZNZ A;  3QPH A;  3DKW A;  3K4C A;  1IN5 A;  2DFI A;  4PJN A;  4RS8 A;  3FZV A;  4ZYH A;  5EFY A;  1ZGJ A;  1XDS A;  5F1J A;  2CJJ A;  5EDN A;  3RI4 A;  3V42 A;  1P7J A;  1FMV A;  1A6Q A;  3JCU C;  4EQQ A;  2QQ9 A;  2NS0 A;  2LC2 A;  3C2G A;  2GXA A;  1SAN A;  3NQO A;  3G2B A;  3KP7 A;  3R0J A;  4MQ9 F;  3Q9S A;  2JA8 J;  3LHQ A;  3MNL A;  3ASN H;  1AOY A;  1R5G A;  5HLH A;  3C07 A;  5J1Y A;  4W97 A;  3J7A Y;  3A01 B;  1UJ8 A;  3LSK A;  4RAZ A;  3OYL A;  2K86 A;  4E6K G;  3F1B A;  1BI0 A;  1U5T B;  4YG2 F;  5LEJ A;  3HEF A;  5KAI C;  3QPS A;  3H9J A;  2X1E A;  4I09 A;  3NWT A;  2CO5 A;  5GPA A;  1W36 C;  1KU9 A;  1WJC A;  4L0Z B;  2W7N A;  2KRH A;  4RGS A;  3F23 A;  2A5W A;  1KYZ A;  2QSF X;  4XR6 A;  1T56 A;  2EFW A;  4CSW A;  2VBX A;  2E1N A;  5EGO B;  4HQE A;  2X48 A;  1WJB A;  4PDK A;  3S2H J;  2FU4 A;  4I6Z A;  4HRI A;  3H92 A;  4CYD A;  3RYR A;  3V7R A;  1YIT I;  1XSV A;  2IRF G;  3AQT A;  1Y1V J;  2BY1 A;  1U2W A;  5ED4 A;  1JUS A;  4Y4R A;  2OD5 A;  1TNS A;  5J8F A;  1FP1 D;  2WC2 A;  3ROU A;  3U9G A;  3K10 A;  3VFZ A;  5EG0 B;  4YEL A;  1ZQ3 P;  2VPL A;  2K9N A;  3HUG B;  3CP8 A;  3GFM A;  4FCY A;  3WG9 A;  1QVU A;  2QOP A;  2ZXH A;  5E3O A;  5CVR A;  1ETW A;  1NTC A;  1RIO H;  5L3B A;  3F0C A;  3L2U A;  2LTP A;  2K9Q A;  3GVA A;  2WB1 A;  3TP3 A;  1T2K A;  4D1Q A;  3M3Y J;  4MK6 A;  3HOZ J;  2E2I J;  3HTU A;  4O6J A;  5E20 A;  2LRE A;  1X1A A;  5AON A;  4WX9 A;  2OAZ A;  5K5O A;  3VYT B;  3VVX A;  2ECB A;  1XC5 A;  3DEU A;  3FXM A;  3P9K A;  2X9D A;  1MJA A;  4H4K C;  3L7W A;  2FOW A;  1B72 A;  4B47 A;  5HNF A;  1D5V A;  2NP3 A;  2PZ9 A;  2GFN A;  1KYW A;  4Q5S F;  4IX7 A;  2TDX A;  1Y8R B;  3K1M A;  2F5E A;  4WF2 A;  2A05 A;  1Z7U A;  2JA2 A;  1POG A;  1HLV A;  3HC7 A;  3LSG A;  4OOI A;  1VQ4 I;  4U9L A;  3BT9 A;  1GT0 C;  3CCS I;  4OMY A;  2DLL A;  4CYC B;  1XGO A;  3PO3 J;  4AM3 A;  2ZFW A;  4E7H A;  2IVM A;  3TDU C;  3BR3 A;  5HDN A;  2O3F A;  3VUQ A;  2OZ6 A;  3GCM A;  5EZG A;  2UXN A;  1ACI A;  1WJ5 A;  4L0Y B;  2QM3 A;  4FE7 A;  2A5Y B;  3LQQ A;  2LMD A;  4HV6 A;  1DQU A;  2YU3 A;  1U8R A;  3EUP A;  3RKQ A;  4DYC A;  3B6A A;  5D6F A;  5ICF A;  1FIA A;  2FEZ A;  3JRE A;  1LVA A;  1LDD A;  2L4M A;  4G7Z F;  4E7K A;  5IP7 J;  1R49 A;  5F0F A;  3WTS C;  1NK2 P;  1ZH5 A;  4HDV A;  1ITY A;  2JJ7 A;  1VQN I;  4C2M J;  5CXI A;  3IKV A;  3V8K A;  2HKU A;  1O57 A;  1ZN2 A;  3E97 A;  2HEO A;  2HDW A;  2A2F X;  2KLO A;  1ZRE A;  4IVN A;  4XLH A;  4QPQ A;  4C3J J;  3VP5 A;  5DM6 F;  3QOE A;  4CDG A;  2QSG X;  2JPC A;  1Y1W J;  4MEY F;  4GGG A;  5E8G A;  5A2Q K;  4DYQ A;  3TW6 A;  5A2Q Z;  4HV5 A;  1SFE A;  2RAE A;  1OQY A;  2CFX A;  1IRF A;  2Z9O A;  1MBG A;  4XN0 A;  4WK8 F;  1S9H A;  1ZG1 A;  3E1S A;  1PUE E;  2V4J C;  4MGR A;  3UKG A;  3GZN B;  1IXR C;  4S05 A;  1BW5 A;  1UST A;  5J1R A;  4KN4 X;  1QRY A;  1TWF J;  2NNN A;  1Q1V A;  2LY2 A;  3F3X A;  2PFV A;  3KCC A;  3BHQ A;  3HM5 A;  2DOA A;  2KPM A;  4IHX A;  1AHD P;  5H20 A;  4BHB A;  2QQ8 A;  3RSN A;  3ZGK A;  4M6V A;  3OL4 A;  4UB8 C;  3PUF A;  1L0O C;  5H9T A;  5L3D A;  1HOM A;  3EQL F;  1BOA A;  2VUM J;  1K7A A;  1VQ6 I;  5JHF A;  1WI3 A;  2RKH A;  4HSR A;  3W6J B;  4FX4 A;  5IYC J;  2A3S A;  4ZYA A;  3IH2 A;  3I4N J;  4ENM A;  2BW3 B;  2H1L A;  1YOV B;  5KCM A;  4YIR X;  3BQZ A;  4HZF A;  3G4S I;  3QOD A;  2BEO A;  2GBY A;  2IGK A;  4LMY A;  3Q5F A;  1YO5 C;  1W0T A;  4LG3 A;  2WTE A;  4ICH A;  4NN1 A;  2IJL A;  3OYB A;  1PP7 U;  3J7Y J;  4CCK A;  2PJR A;  5LFA A;  2ZOZ A;  2FD5 A;  5AIQ A;  1HQC A;  2HDC A;  1X58 A;  4A3K J;  1B8I A;  4L9V A;  5DS9 A;  3GLL A;  2PQ8 A;  2X1C A;  1DGR M;  1N78 A;  2ZKZ A;  2L02 A;  3K4N A;  1JT0 A;  1MND A;  4B4C A;  4M3G A;  5FRN A;  2FX0 A;  2R3S A;  1R9T J;  1V5G A;  3CD6 I;  1ZRD A;  4GFK A;  3IHU A;  1ERD A;  2V7F A;  3FK7 A;  2VE9 A;  1KQ0 A;  2BHZ A;  3OS0 A;  2DBB A;  1ON1 A;  5E8I A;  3HIF A;  3CMA I;  1FOY A;  1WJD A;  4LJZ F;  1QGP A;  3DF8 A;  4GYI A;  4FET A;  1T33 A;  4P9U A;  1YRN A;  2P5K A;  1ZEL A;  3V7S A;  1ZLJ A;  3DBR B;  2X51 A;  1OCT C;  4HEA 2;  2M4G A;  2MGQ A;  3CTA A;  2E2H J;  3HTS B;  1D1A A;  2HYF A;  1JHF A;  3DP7 A;  3OYN A;  3EUH A;  1UAA A;  2BBY A;  1JJ6 C;  2JZY A;  1H9G A;  2XSJ C;  4M74 A;  2PMH A;  3I5U A;  3BNI A;  2ZC2 A;  2EB7 A;  3GZI A;  4XLA A;  4I0B A;  1YJ9 I;  2YVH A;  2G3B A;  3CO7 C;  3BC8 A;  3V8L A;  4LOC A;  1LE8 B;  2EIN H;  1T8I A;  2WV1 A;  5HOO A;  2M87 A;  4KIB A;  2XPU A;  1VF9 A;  1X2M A;  2GAU A;  3G7R A;  1AWC A;  1FC3 A;  1OIS A;  3JTG A;  1VI0 A;  3FXQ A;  1BI2 A;  1KZH A;  1A04 A;  2B9S A;  2K9L A;  2HDD A;  3ON2 A;  1STZ A;  3JRD A;  3S3M A;  3ZMD A;  1ENH A;  4Y52 J;  4XIC A;  3J80 K;  3J80 Z;  3EYY A;  2HOA A;  4QLC U;  1LPQ A;  4G9Y A;  1Z1D A;  2LD5 A;  1S6L A;  4M9X A;  3BZK A;  1J09 A;  3BPX A;  2HQR A;  3IP4 B;  5CYV A;  1L3L A;  1SVL A;  2FF4 A;  1Z3X A;  3BZ6 A;  2MLG A;  4L9N A;  3HXL A;  1H0M A;  3F72 A;  2DOE A;  2KMU A;  3DEE A;  2VQH A;  2Q2E B;  2CUE A;  4I2O A;  2H09 A;  2P8T A;  3PUB A;  3W6V A;  2FJI 1;  3M1E A;  1CF7 A;  4AWX B;  2X1D A;  2QEN A;  2EWN A;  1O3T A;  4R1H A;  5DAJ A;  4LB5 A;  4DGW B;  3W6K B;  1Z05 A;  3K4B A;  2EFO A;  5E3L A;  3RPU A;  2J5O A;  5JR3 A;  2YU9 J;  2VKH A;  1QNT A;  4JP0 A;  2M0C A;  2F07 A;  2VIX A;  2P6S A;  4ANJ A;  2HGC A;  2PBI A;  3KLO A;  2KP6 A;  3S1M J;  1E2X A;  3CUQ C;  3HRT A;  3ZMV A;  4KMF A;  5HOD A;  4L5E A;  3Q3S A;  1V5F A;  9ANT A;  1IDY A;  3SYT A;  2AS5 F;  2M1B A;  5HLG A;  5AQC A;  4LLL A;  2HZD A;  2VBW A;  2MD5 A;  3CF2 A;  3E0J B;  1ULY A;  3Q0W A;  1J0R A;  2W1O A;  4GFL A;  3L9F A;  3S2D J;  2LBF A;  3L2W A;  1FY7 A;  2FOK A;  1J2X A;  4NEL A;  2PJP A;  3CDL A;  2V57 A;  1BR2 A;  3H36 A;  2ZJR F;  3CCQ I;  3HOY J;  3N97 A;  3CRJ A;  1Z21 A;  2KJB A;  4DQ2 A;  4XLF A;  3SZT A;  4A2U A;  5K58 A;  5D8K B;  3M1C A;  2JPB A;  2EIM H;  3C7J A;  2P4W A;  4MXM A;  2L7Z A;  2PN6 A;  3ZMZ A;  3EYI A;  1K83 J;  4ZDP A;  1FOX A;  1X1C A;  3VW1 A;  5D5U B;  3LSH A;  2P7V B;  5C4X J;  1QHG A;  3K7A J;  3VW2 A;  1OR7 A;  2MSY A;  5F27 A;  3JTH A;  3L2V A;  3ANP A;  2LDU A;  2EA4 A;  2M8E A;  1HDD C;  2I5U A;  2IA1 A;  2KFD A;  3MCZ A;  1J9I A;  1J7K A;  1BC8 C;  4AIH A;  1XSD A;  3JSJ A;  3BY6 A;  1XS9 A;  2YSR A;  2V9V A;  1G6N A;  5F08 A;  5TGT A;  4HF2 A;  1R23 A;  1RR7 A;  5EEH A;  1IRG A;  2A6H F;  3BJ6 A;  3GXO A;  5E1W A;  1XGN A;  2WY8 Q;  1D0X A;  3TKY A;  1FT9 A;  4HQM A;  1FPQ A;  2L9V A;  3CUO A;  5LGT A;  2AXL A;  2WAE A;  5B5E C;  4EGY A;  2NVX J;  4BHP A;  4I7H A;  5LBQ A;  4II3 A;  4IOC F;  3ZQL A;  1JT6 A;  1SAX A;  1HDP A;  1UMQ A;  4AF5 A;  1MBJ A;  2IGN A;  5BS6 A;  1IG7 A;  3DPL C;  1IN6 A;  4XMY A;  3OYI A;  1P4A A;  4AD9 A;  2Y75 A;  4UVA A;  5B66 C;  3KE2 A;  4MEX F;  1F43 A;  3BG5 A;  1VQ5 I;  3EUH C;  5GTI C;  3OIO A;  4J00 A;  3J81 K;  4ZTJ A;  1S7A A;  4XID A;  3ABK H;  1TT5 B;  4CA0 A;  1H88 C;  4NNJ A;  1I6X A;  1ZTR A;  3WTZ A;  4JBA A;  3L09 A;  1IO2 A;  2STW A;  1YFH A;  4EJU A;  2MYS A;  3W2W A;  1HST A;  1QZZ A;  2RQP A;  3OWT A;  3BG6 A;  2MD0 A;  2PX9 A;  3TOA A;  4HNV A;  2VJI A;  2FSW A;  3IRQ A;  5D1R A;  1O3R A;  4C3H J;  2VBY A;  3ZMT A;  3ANG A;  4BEH A;  4LLN A;  3SDG A;  3WTU C;  2JUC A;  3KP3 A;  4TV7 A;  3KZ9 A;  2ZME C;  4DW6 A;  2DA5 A;  4OIR F;  2GM4 A;  3WTW C;  2OCE A;  1W4M A;  1Y8Q B;  3P9T A;  2B1E A;  5CLS A;  1O7L A;  1QZY A;  2JT1 A;  2VJ5 A;  1LB2 A;  3HDD A;  2ZCX A;  2R7Q A;  4XK4 A;  4AVP A;  4A0Z A;  3T6N A;  4A3I J;  1XDU A;  1YLF A;  3ELK A;  1D1B A;  5IOZ A;  4AIK A;  4G7H F;  1VQO I;  3EPZ A;  4CCO A;  2D45 A;  5F6F A;  3VYS B;  4YIF A;  3E7L A;  2ADU A;  2WWY A;  5GAE J;  3CCY A;  2XB5 A;  4ABZ A;  3DBL B;  2B7E A;  4IJA A;  3GBG A;  1MZB A;  1ETY A;  3TMO A;  2VOO A;  3OIP A;  3VDX A;  1XCV A;  4BQA A;  2R7W A;  3GEZ A;  4I0A A;  1JKR C;  3VVY A;  4ASN A;  3VIB A;  1QA6 A;  3D5R C;  3V78 A;  3WHB A;  4ZYE A;  5J1U A;  4AUX A;  3DEW A;  2A6T A;  4HBL A;  2WUI A;  2DYR H;  3OR2 C;  1EH7 A;  4XBF A;  4A3C J;  4IRH A;  4G6T B;  4DBR A;  4IO9 F;  3IC7 A;  2WA0 A;  4ESF A;  3PFY A;  5HVQ C;  3QP5 A;  2WBM A;  4GCT A;  2ZJ2 A;  1GVD A;  2F4M B;  2FA5 A;  4HDU A;  4U0W A;  1KU7 A;  2F6C A;  1A31 A;  2BXY A;  2QKL B;  3HPG A;  3HBL A;  1W0U A;  3BWG A;  2L5Q A;  4XOR A;  4BU2 A;  4E7J A;  3RKW A;  3LWF A;  1MSF C;  3C18 A;  2CV1 A;  3RQ4 A;  3PM1 A;  3CWR A;  3F6V A;  1OCR H;  2EFN A;  2LH9 A;  3SFZ A;  2IP2 A;  4DBQ A;  4RB1 A;  3VTI A;  5LRS A;  1F9N A;  5LEK A;  2QEX I;  2WY7 Q;  3KKD A;  3ZN1 A;  4UB6 C;  2MLK A;  4B48 A;  1B72 B;  4BBR J;  1DP7 P;  3ZQ7 A;  1DDN A;  3BRO A;  2P5L C;  3FM3 A;  2PBX A;  5J40 A;  5BMZ A;  4WXD A;  4CUG A;  3OMY A;  5E79 C;  4UNO A;  1HCR A;  5DUI A;  4F7Z A;  3CCR I;  5D18 A;  2ICW G;  2YPR A;  4Q47 A;  2D6Y A;  4KUM A;  5K1Y A;  1W5T A;  1HKT A;  4W1U A;  1ZRC A;  1MDM A;  3NRV A;  1WH7 A;  5LHG A;  1UCR A;  5FKN A;  3HHG A;  1OR7 C;  1PJR A;  5J8C A;  5ERI A;  1R6R A;  3CO6 C;  4PUS A;  4E7I A;  3DPT A;  3SZG A;  4YFX F;  1J5Y A;  4A0X A;  1WCM J;  2DYS H;  2P0W A;  1X3U A;  2AO9 A;  4JK1 X;  5LHI A;  3VVZ A;  1EH6 A;  2DA3 A;  2DJI A;  4XKB A;  4H0E A;  5BOX A;  1XG1 A;  2DU9 A;  3KP4 A;  4HLY A;  1W5C C;  5HS7 A;  2EQR A;  3S93 A;  4LK0 F;  3OSG A;  3CJQ B;  3COL A;  3EDP A;  2FBQ A;  4B1R A;  3QWL A;  4A6E A;  4BY1 J;  2CQN A;  3K70 D;  5CVJ A;  3LA2 A;  4KT5 C;  5HLI A;  2MH2 A;  1HXD A;  3LMM A;  3QQA A;  2Y9Y A;  1GLN A;  5HNH A;  3F8C A;  1IN4 A;  1MJB A;  3CUQ B;  2QA4 I;  4X0G A;  2W85 A;  1T08 B;  1WI9 A;  2NVQ J;  2IS4 A;  3EGQ A;  2NX4 A;  3HJE A;  3LFK A;  2UWM A;  2HOE A;  1E0E A;  3A0B C;  1XB4 A;  1J75 A;  4EEF G;  5LLQ A;  3SWH A;  1ZHF A;  3KLN A;  2P81 A;  3TBI A;  4UVC A;  2PEX A;  1S29 A;  2NNY A;  4P1W A;  4BJT A;  4BYY A;  2P7C B;  2O7O A;  4KN7 X;  2UXP A;  2EV0 A;  2ESN A;  2IW5 A;  3BG7 A;  4D7N A;  1TWH J;  3CCJ I;  5B1B H;  4XQF A;  1QBJ A;  4XLP F;  2O8X A;  2RHA A;  1WFX A;  2E34 A;  2V1X A;  3OOU A;  3F21 A;  2K9S A;  3COA C;  5F04 A;  3SEQ A;  2DMP A;  3LSI A;  1WQ2 A;  5CKT A;  3BR5 A;  3BTJ A;  4C2T A;  2ME6 A;  3N4M A;  4UV8 A;  4JOM A;  5D8L B;  4II2 A;  2NS8 A;  5D4S A;  5DD8 A;  2HS5 A;  4P5O A;  2PJR B;  1P2F A;  2BVL A;  3ERM A;  3D5L A;  3S3N A;  1NG7 A;  3QU3 A;  3OYG A;  1IJW C;  2XAH A;  1HF0 A;  1JGG A;  2OCC H;  4ESJ A;  2RQQ A;  3FIW A;  3EET A;  2GQQ A;  4RAG A;  2VON A;  2UXI A;  5JFR A;  1XPX A;  2EIK H;  1SVO A;  2IS1 A;  3HHH A;  2XRO A;  2XVC A;  2K40 A;  4M9S A;  1G3S A;  3RTR A;  4DNC A;  4RM2 A;  2LSO A;  1BI3 A;  5CW8 A;  4DVY P;  1REP C;  2EV6 A;  3WHC A;  2NVU B;  2BOL A;  2OJE D;  5ICC A;  3T0Y A;  1FYK A;  2PLY A;  1S8N A;  1GXP A;  4GFB A;  3ZN0 A;  3DFG A;  1T39 A;  1VND A;  4HF1 A;  1MNE A;  1VQL I;  1BBY A;  3QPL A;  2RGV A;  1XCB A;  2BYV E;  1VQ9 I;  1MIJ A;  4JNN A;  3I53 A;  4BE1 A;  3NAU A;  3C2H A;  2KIU A;  2Z3Y A;  5FFZ A;  5HLT A;  4OIO F;  3GZ5 A;  1LDK B;  2HVS A;  4XSX F;  2R7Z J;  2DG8 A;  1R71 A;  2V79 A;  1RC9 A;  2VI6 A;  2VXD A;  4M71 A;  2WAF A;  3CJN A;  4EJT A;  2R7V A;  1TL8 A;  2ZFU A;  2H8R A;  3A2K A;  3T1B A;  4U7B A;  3DTK A;  1G2H A;  2JRM A;  2NOJ B;  3J7A O;  4KFC A;  3A4C A;  3ZR8 X;  1UG0 A;  2DT7 B;  1OPC A;  2VKE A;  4M3F A;  4BS9 A;  3CMM A;  1TZL A;  3CCE I;  2Y69 H;  3Q9V A;  3HKZ A;  1DU0 A;  2LKP A;  2R7D A;  3CME I;  5FLV A;  1DP3 A;  2IPQ X;  2CQK A;  2D1H A;  4HW0 A;  4WCG A;  3KZI C;  5J3L A;  5BPI A;  2ZME B;  1X1D A;  3A1Y A;  3BLY A;  3VOD A;  5D5V B;  2V1U A;  4UUS B;  1O7F A;  2RNJ A;  1YYV A;  4CO8 A;  1FIP A;  1OYY A;  1RPW A;  2V1D A;  4Q48 A;  4LFU A;  5E3M A;  1E17 A;  3H3U A;  3FIS A;  1DGW Y;  2HQN A;  4D5C A;  2FBI A;  4V2F A;  3L1P A;  1YE9 A;  1Z77 A;  3K1P A;  1FBU A;  4IZZ A;  4A93 J;  5IY5 H;  2K27 A;  1YG2 A;  4HPQ A;  1YX5 A;  4AC0 A;  3P5J A;  4F55 A;  1JKP C;  2FE3 A;  4JX5 A;  5FLX Z;  1R00 A;  1CF7 B;  2Z16 A;  5M5X J;  1SFX A;  5EYR A;  3LST A;  1UFM A;  3ML6 A;  2ZSI B;  3NAR A;  3TOB A;  3GTP J;  3VSL A;  5KVR A;  3HSR A;  2CQ7 A;  2XV4 S;  3S17 J;  2RAS A;  4EV0 A;  2WGB A;  4RAY A;  4BQO A;  2ID3 A;  3JSO A;  2FML A;  3U21 A;  3ZMS A;  2GXB A;  3FWE A;  3PNT A;  4HLX A;  1MH3 A;  1X2N A;  3JRB A;  2WV0 A;  4BY7 J;  5IT9 K;  1UB9 A;  2JSP A;  2RRE A;  3GTJ J;  1VZ0 A;  1LDJ A;  3TGN A;  5IT9 Z;  2QLZ A;  2R7R A;  5F64 A;  3GTM J;  3RPU D;  4P96 A;  1KQ8 A;  4UDS A;  4B8X A;  2R5Z A;  2CQQ A;  3E5U A;  4Y17 A;  2DOF A;  2WB1 N;  2VJJ A;  4DYR A;  3O3K A;  3AKZ A;  1N75 A;  3VSK A;  3NS4 A;  2CGP A;  5M3M J;  2M30 A;  1TWC J;  2R93 J;  2XGD A;  2IGO A;  3IL2 A;  1LFP A;  4KMU X;  5CQE A;  2LBF B;  1SC7 A;  2HVQ A;  2LKX A;  4Y15 A;  1TT0 A;  1FZP B;  4MTE A;  2ZXI A;  2E5N A;  4YII A;  4B43 A;  3OR1 C;  4O5V A;  4MLO A;  3LA7 A;  2E35 A;  1TC3 C;  1RET A;  2EV5 A;  3K4J A;  1MMG A;  4KIS A;  2DJN A;  2JUG A;  2YUS A;  1UI5 A;  3CCL I;  4A3L J;  2VQL A;  2AQF A;  3KPH A;  2VL8 A;  3MFK A;  3V4G A;  5FMP A;  3ABM H;  3C2B A;  2HXI A;  2M2E A;  2UUZ A;  1GDT A;  3KEQ A;  4FTH A;  4R8H A;  1MBH A;  2E2J J;  2X85 A;  2OTL I;  2LYC A;  4S04 A;  5FB2 A;  4RLQ A;  1BW6 A;  3BTL A;  4GXO A;  3SFI A;  2ZCW A;  1NK3 P;  2Y31 A;  4N9H A;  4N0B A;  3LSR A;  1Q1H A;  3HOX J;  1DUX C;  1UZC A;  4XL9 A;  1USS A;  4ZC3 A;  3CP2 A;  4FAS D;  3IRR A;  1TW2 A;  3MZH A;  1OCZ H;  3AFH A;  3TO7 A;  3SZP A;  3LNQ A;  1ZK8 A;  1I50 J;  5GTH C;  1FSE A;  1H89 C;  2PMU A;  4GYG A;  1OCO H;  2CUF A;  2W57 A;  4PJJ A;  3FM5 A;  1EA3 A;  3RJP A;  1NH3 A;  3ABT A;  2KIM A;  4UUT A;  1T95 A;  3H0G J;  2MH9 A;  4HNU A;  4LGW A;  3NWS A;  2DW4 A;  2F5V A;  4PSX A;  2EK5 A;  3PIO F;  3I56 I;  2HKX A;  2F5F A;  2GOM A;  4RB3 C;  2IT0 A;  4N4N B;  3IH4 A;  5DEQ A;  2R5Y A;  1S5L C;  4DZJ A;  3C1D A;  4NBQ A;  4LIV A;  1XX5 A;  1TW3 A;  3QYB A;  3AG3 H;  5B1A H;  1IW7 F;  1DPR A;  3BP8 A;  3SXY A;  3GO5 A;  3IH3 A;  1ZRF A;  2JTV A;  2NP5 A;  3KEY A;  3U2R A;  2LY9 A;  2ZO4 A;  3BCB A;  5BQT A;  5ICE A;  3REO A;  1XGM A;  2Z99 A;  4BEH B;  2ELH A;  3GWZ A;  2X6O A;  4Y7N J;  3LSP A;  1S7E A;  3G73 A;  5HS9 A;  4K2E A;  5CPR B;  1HKQ A;  2EFP A;  4G8X A;  1K6Y A;  2OU2 A;  3FDY A;  4BDZ A;  2LLK A;  4MHG A;  1AKH A;  1R22 A;  5FHP A;  1MNM C;  2VBZ A;  2X0L A;  3PO2 J;  1LEA A;  2QCO A;  5ILS A;  3HOV J;  4MNU A;  1JTY A;  2DO7 A;  2JA7 J;  4FHT A;  4BUP A;  1T0F A;  3VOE A;  3FXU A;  4UHT A;  1YS6 A;  1APL C;  2HPM A;  4M9Z A;  3O60 A;  1RI7 A;  2XGE A;  3O6B B;  1I3Q J;  1RUN A;  3D0S A;  1A36 A;  4PGH A;  2O61 A;  2YS9 A;  3DU5 A;  5BNG A;  3KYC B;  3S1R J;  3PPB A;  1YW9 A;  1UI6 A;  3K1N A;  1FYL A;  2LRD A;  2ISY A;  4I99 C;  1U5T A;  2A61 A;  3S32 A;  3OL3 A;  2GEN A;  5LGU A;  4D7M A;  2VOD A;  1PYV A;  4OD5 A;  3KYL A;  3GUD A;  3KIO A;  1R5H A;  1K4S A;  1YHQ I;  4QWQ A;  1KA8 A;  2EJR A;  4RB0 A;  2COM A;  3PJR A;  4YRV A;  5GAH J;  4RDU A;  2QBY A;  5D4R A;  3FXO A;  4PFP A;  3U1K A;  2H27 A;  5KNL A;  1LKX A;  5D5X B;  1VQ7 I;  3K8P C;  3UNG C;  4OU0 A;  4L18 B;  3AL0 C;  3DU6 A;  3MD2 A;  4UXN A;  4IOA F;  3FRQ A;  3ZRG A;  3KP5 A;  1FJL A;  4E7Z A;  2K3F A;  2N8G A;  3WU1 B;  4PFO A;  4S0H B;  1VQM I;  1J59 A;  3I59 A;  2IS6 A;  3RH2 A;  1FEX A;  2FQ4 A;  5L3G A;  3K70 C;  2BGC A;  3H1C A;  4P9F A;  1JGS A;  3HUG A;  1O3Q A;  1LNW A;  2DMQ A;  1YX3 A;  2DN0 A;  3L2C A;  3E6M A;  3GW2 A;  3B02 A;  3PNV A;  3S2W A;  3DWL E;  1ZLK A;  4N9I A;  3O8H A;  5K7Z A;  2EA2 A;  2HQ5 A;  3B6C A;  3WE2 A;  4KYW A;  4M6Y A;  2NRA C;  4QIW N;  4F3Q A;  3CZ6 A;  2Q8K A;  4BAC A;  5ICG A;  5FKK A;  3WTY C;  1E3P A;  3WU0 A;  4UV9 A;  1EH8 A;  4XKV A;  5CJ9 A;  4I01 A;  5IYD J;  2XAS A;  1JTX A;  5C3E J;  2X6Y A;  2QKO A;  1TWA J;  1IXC A;  3R0A A;  2OUM A;  3RDI A;  4LB6 B;  4A3J J;  2HFH A;  1W7P A;  3ZXS A;  3TP0 A;  1B4A A;  1ZKG A;  1VQK I;  2QGU A;  4M72 A;  1OJL A;  1SMT A;  3BPV A;  2R7X A;  1R4N B;  3DLA A;  4CYC A;  1KU3 A;  3ABU A;  5CQG A;  2CUZ A;  2UXH A;  4NC8 A;  4IRI A;  2OQR A;  1KON A;  5EJC A;  1V5E A;  2L9S A;  4AU7 A;  4A5N A;  1XMX A;  3F8F A;  3R6S A;  2CG4 A;  2FNP A;  4ESB A;  4DJA A;  5DCM A;  4LIU A;  3LAP A;  3S1N J;  1F4K A;  1R4M B;  1D8J A;  2W4S A;  3MKL A;  2HPI A;  3FF5 A;  2R0Q C;  2GIZ A;  3PSI A;  4M3B A;  3KET A;  5TIS C;  2Y0S A;  3QRF F;  2XAJ A;  3BR1 A;  2CQX A;  5FFX A;  2E60 A;  2NXN B;  1P7I A;  3M8J A;  2HWV A;  4EAT A;  4A3F J;  2QYO A;  3QU6 A;  2XRL A;  4IHW A;  2K9M A;  1ON2 A;  1YJN I;  2K7L A;  1RKT A;  2XGC A;  3RZO J;  2P6T A;  1ZR2 A;  4A3E J;  3HTH A;  3HOS A;  3B73 A;  3HZJ A;  2Z5U A;  1K78 A;  1EKE A;  1XGS A;  1IC8 A;  2IA0 A;  3FKI J;  3FHN A;  3GTL J;  2ESH A;  1T0F C;  6PAX A;  3X2Q H;  4FQG A;  2XF7 A;  1U9O A;  2JMW A;  2M34 A;  4MQV A;  2YVX A;  3H35 A;  2LK2 A;  1FLI A;  2EIJ H;  1K79 A;  4KT6 A;  3OYD A;  3BJB A;  4AIJ A;  2Y0S N;  4FIS A;  3T8R A;  1Y6I A;  3ECO A;  1TTY A;  1SMY F;  4XLN F;  1SD4 A;  2W00 A;  2HI3 A;  3F8M A;  1DPU A;  2JA5 J;  1I3A A;  1QZE A;  1YS7 A;  3BQY A;  4ZTF A;  3K2Z A;  4RBO A;  2IEK A;  4C3I J;  2OBP A;  1WJA A;  2MG4 A;  5IT3 A;  1TNT A;  3F9K A;  2CS3 A;  2V9P A;  3B81 A;  1A35 A;  3MMY B;  2FBK A;  1QPM A;  2GZW A;  1BL0 A;  4PCQ A;  3DCF A;  2KJC A;  2ZXJ A;  1ETO A;  1AA7 A;  2H1K A;  4WIB A;  1RES A;  2VLA A;  5GP9 A;  4XOP A;  3A0H C;  3ON4 A;  1BJZ A;  2QF7 A;  1KGS A;  2XUB A;  3BOQ A;  1WJF A;  5KK1 A;  1RUO A;  1IUY A;  4C9Y A;  4PJM A;  1V54 H;  2DXI A;  5GPC A;  2ZCM A;  1FTZ A;  3WOD F;  5IOY A;  5L3F A;  1Y39 A;  4OIN F;  3VYU B;  2TRT A;  2REK A;  1FYM A;  2UXO A;  3DKX A;  3LOC A;  4OMZ A;  1RRJ A;  2L01 A;  1M1E B;  4C2M A;  2JN6 A;  2RV8 A;  4C2U A;  2BV6 A;  4OD4 A;  2F48 A;  2KDO A;  3H5R A;  3K0L A;  4RAF A;  1YW8 A;  1X1P A;  2VQG A;  2DPU A;  2HNH A;  3I71 A;  5M5W J;  1G4D A;  3QBM A;  1G3W A;  2XSD C;  2PFB A;  1WSU A;  4RGX A;  4BGD A;  1D5Y A;  2HVR A;  5E3N A;  3IKT A;  2STT A;  2DG7 A;  3G6E I;  1B59 A;  1GV2 A;  4MO7 A;  5LRR A;  5ILU A;  1D0Z A;  1GV5 A;  2HTS A;  3CES A;  3ABL H;  1FP2 A;  5DDG A;  1TQI A;  4JQF A;  2ZCN A;  2R7T A;  2RC4 A;  3PL8 A;  2DQL A;  4RLF A;  1LE8 A;  1FTT A;  1S72 I;  2M5W A;  2DQR A;  4IF4 A;  3VOX A;  1FOK A;  2C6Y A;  1R7J A;  3SHF A;  4NC7 A;  2D5V A;  4ENJ A;  3OV8 A;  4CCN A;  1JJ8 C;  3GTG J;  1BJA A;  2R5Z B;  2YR2 A;  1N77 A;  1H8A C;  1O4X A;  3M8E A;  4ZYD A;  5J47 A;  2DMU A;  3VWB A;  4EJW A;  4PXI A;  2EZH A;  3FXJ A;  1EV7 A;  2HYJ A;  4AID A;  3DXJ F;  1SD7 A;  2DPD A;  2GXG A;  2K4B A;  4OIP F;  4EMS A;  3TW7 A;  2L0K A;  4KIC A;  3ZQI A;  3AL0 B;  1YTY A;  2ZB9 A;  1ETX A;  4G94 A;  2OTJ I;  2DMN A;  3BCG A;  1W1W E;  2D1V A;  4HAM A;  1JKO C;  1ZGA A;  4CZC A;  4B44 A;  2VE8 A;  1NHA A;  4YFN F;  1WRJ A;  3DTI A;  2PG4 A;  3P9I A;  3GEU A;  2NVY J;  3CC4 I;  4XN3 A;  2BZT A;  3GFI A;  1HSJ A;  2BE5 F;  1VFC A;  1JE8 A;  3ISP A;  3V7C A;  5GAG J;  1VTN C;  2DDA A;  3EUA A;  3BG9 A;  3G1L A;  3QP6 A;  1FMW A;  2L9N A;  4BL0 B;  2F5D A;  1G3Y A;  2Y2Z A;  2EZL A;  3IAM 2;  2F4I A;  3G1M A;  2JWT A;  3KZZ A;  4L5J A;  1SFO J;  3W3C A;  4D0P A;  2DT5 A;  2KZV A;  2L7F P;  3WTV C;  3AG4 H;  4Y13 A;  5CVV A;  1IN8 A;  5HDG A;  2G7S A;  3ZCO A;  3FBI B;  5DUK A;  4U7D A;  2YX4 A;  1QU3 A;  4RGU A;  1JUM A;  2ZJP F;  5K7H A;  5LD2 C;  4V19 K;  1Y56 A;  1HKS A;  3WTT C;  5IYB J;  5D6E A;  2W24 A;  1ZAR A;  2ISZ A;  2V6E A;  1BR1 A;  4EM0 B;  4BAY A;  3JAM K;  2KT0 A;  2MA3 A;  2FXA A;  1LJ9 A;  3JAM Z;  1D3Y A;  1O3S A;  4BXX J;  2OC6 A;  2HYT A;  3OYK A;  2EZI A;  3R60 A;  5B3S H;  1R36 A;  4N4O B;  3WGG A;  3HSE A;  2DTZ A;  2M3A A;  2KQR A;  1Z3Y A;  4FE4 A;  2H6C A;  3I55 I;  5E18 F;  2XKP A;  4U0Y A;  2OER A;  4ZZD A;  3VOK A;  4BHC A;  1MBE A;  1OMI A;  4ZDL A;  4NDL A;  2OZU A;  4XRS A;  4LIT A;  1JXS A;  2DTR A;  2BY0 A;  4XRS G;  2JK3 A;  2R5Y B;  3CC2 I;  2MC3 A;  1K61 A;  3HTA A;  2V9K A;  3KEO A;  4X6A J;  1MMS A;  1IDZ A;  4A12 A;  3DLL F;  1I6H J;  4BXF A;  2R7F A;  2Q0O A;  4IEJ A;  2V26 A;  3GX4 X;  1I27 A;  1B8I B;  2GUH A;  1PDN C;  4BXU A;  3MKY B;  1OYW A;  1DU6 A;  1D8K A;  3E5Q A;  1YJW I;  1S7O A;  4IQJ A;  1YQA A;  2G9W A;  3PIP F;  1UHS A;  4L9T A;  4M73 A;  1Z6R A;  2MBF A;  2O8K A;  2DA4 A;  2LFB A;  3V6G A;  2ID6 A;  4HA8 A;  3OYC A;  5HAW A;  5AIP A;  1V4R A;  1YW7 A;  4JKZ A;  1YIO A;  3M8F A;  3KFW X;  1P4W A;  1AKH B;  5JI6 A;  3JRH A;  1R5I D;  3CDI A;  3CJD A;  1D0Y A;  1GXQ A;  2BHY A;  2K4J A;  1YRN B;  3CLQ A;  2VQC A;  3VW0 A;  1MW7 A;  4JYK A;  3E7Q A;  3DV8 A;  3BJO A;  2OF7 A;  4RB2 C;  1BN5 A;  3JRG A;  2Q24 A;  1LFB A;  5FGL A;  2R7O A;  4GCK A;  1ODD A;  2L7K A;  1WVR A;  2ZSH B;  2KRF A;  2XAQ A;  3I0T A;  2M0M A;  3LL7 A;  2PMZ A;  1MD0 A;  3GLX A;  4LLG F;  1I1G A;  3ZQF A;  2UZK A;  1N25 A;  1UHM A;  5DV5 A;  2KDZ A;  4BBS J;  3P7N A;  2FNA A;  2K5C A;  3HGG A;  4BE0 A;  1BOB A;  3KX2 A;  1B1B A;  1ZG5 A;  2Q1Z B;  3I54 A;  3J7Z I;  4IKF A;  4GO1 A;  4A3M J;  2WAQ A;  2E36 A;  4IRV A;  2VPR A;  3NRG A;  2BVM A;  4HKU A;  4A6D A;  3ULQ B;  1PP8 F;  4IHS A;  3I4M J;  4OWR B;  2H8W A;  3FBN B;  1GUU A;  2KHM A;  3QPT A;  5JLW A;  4MIM A;  2E19 A;  2Y0M A;  5H2F C;  1WHU A;  2QBY B;  3FMS A;  1K4T A;  4A3D J;  3TDZ C;  1MBK A;  2PMZ N;  3GZ6 A;  1VQ8 I;  4A0Y A;  3IWZ A;  3G71 I;  2GA1 A;  2GLO A;  3JR9 A;  3H9G A;  3PSF A;  1F1Z A;  1R1U A;  3CQZ J;  4A3G J;  3CMY A;  4J19 A;  1HBX G;  4G6D A;  2FMY A;  3RYP A;  4F52 A;  2R92 J;  1XSX A;  2KIF A;  1G59 A;  3BRU A;  1W5S A;  3CLO A;  3G1O A;  5FLX K;  3HPH A;  2WAQ N;  3I59 B;  2B63 J;  1V3F A;  1I39 A;  3HKZ N;  4BJ5 C;  2F5C A;  4ZJZ A;  2ZOY A;  1G3T A;  5J4Y A;  3BR6 A;  5J6X A;  4BDY A;  2HYG D;  1XD7 A;  3HSF A;  2NOG A;  4NB5 A;  1P6R A;  3KP6 A;  3K4K A;  1WKM A;  2DA2 A;  5TJJ A;  1QVT A;  5K5R A;  2M7B A; 
#chains in the Genus database with same CATH homology
 2E1O A;  1IG7 A;  1JUP A;  2ME0 A;  2XPV A;  3O60 A;  2IAI A;  3BR2 A;  3HIM A;  2XGE A;  1I3Q J;  4KWA A;  1MBF A;  2YS9 A;  5BNG A;  3S1R J;  3PPB A;  3HOU J;  1F43 A;  3BG5 A;  1UG2 A;  1UI6 A;  3ZOB A;  3OIO A;  3OSF A;  2GEN A;  4XID A;  4D7M A;  1H88 C;  2G7L A;  2DA1 A;  1Z0X A;  1ZTR A;  3FK6 A;  3ZQC A;  4IHY A;  4ME9 A;  4RDU A;  2QTQ A;  3RD3 A;  1A6I A;  1IUF A;  4HNV A;  3VPR A;  5D1R A;  4C3H J;  3HGY A;  3ANG A;  2LP0 A;  3SDG A;  3KZ9 A;  2Y9Z A;  3HOW J;  4DW6 A;  3NPI A;  2DA5 A;  3KKC A;  2GM4 A;  5F0C A;  2W53 A;  3GTK J;  4M3D A;  4MFD A;  2HOS A;  3FRQ A;  3HTJ A;  3P9T A;  1WH5 A;  1FJL A;  4GCL A;  2G0E A;  2N8G A;  3HDD A;  1ORK A;  4S0H B;  4XK4 A;  2ZCX A;  2Y30 A;  3RH2 A;  3T6N A;  4A3I J;  1FEX A;  5IOZ A;  2FQ4 A;  4QTR A;  1A5J A;  2G7G A;  2DMQ A;  3E7L A;  5C4Y A;  2DN0 A;  2L7M P;  3CCY A;  2XB5 A;  4ABZ A;  1PUF A;  2UXU A;  3O8H A;  5K7Z A;  3GBG A;  2HQ5 A;  3B6C A;  1ETY A;  4QIW N;  5EFY A;  3H3V K;  3S5R A;  5F1J A;  2CJJ A;  1JKR C;  5EDN A;  3VVY A;  2COB A;  3BR0 A;  3VIB A;  1P7J A;  5FKK A;  3V78 A;  3WHB A;  5EEA A;  5J1U A;  4AUX A;  3DEW A;  2QWT A;  2WUI A;  5C44 J;  4A3C J;  5EZH A;  1SAN A;  3LHQ A;  2JA8 J;  3MNL A;  5IYD J;  2TCT A;  4JX4 A;  4GCT A;  1JTX A;  5J1Y A;  3C07 A;  5C3E J;  1GVD A;  4JX6 A;  4W97 A;  2QKO A;  3A01 B;  1TWA J;  1W0U A;  3HBL A;  4MFE A;  3F1B A;  3HEF A;  1MSF C;  5D19 A;  3QPS A;  4A3J J;  5GPA A;  3PM1 A;  2EBI A;  3TP0 A;  1E3O C;  3S15 J;  2QIB A;  3CWR A;  1ZKG A;  3S14 J;  3Q0V A;  1OJL A;  1T56 A;  3KKD A;  1B72 B;  3NXC A;  4BBR J;  4CYC A;  5EGO B;  2X48 A;  2EH3 A;  2UXH A;  2PBX A;  3S2H J;  4I6Z A;  1HCR A;  3AQT A;  5D18 A;  2D6Y A;  1Y1V J;  3BTI A;  4W1U A;  3S1N J;  1WH7 A;  2OI8 A;  1JUS A;  3MKL A;  2HOT A;  5FKN A;  2R0Q C;  4M3B A;  5EG0 B;  1IGN A;  4M3E A;  3BR1 A;  1ZQ3 P;  2K9N A;  2CQX A;  4V2G A;  1P7I A;  4A3F J;  1WCM J;  4FCY A;  3PAS A;  1QVU A;  2XRL A;  4IHW A;  2AO9 A;  3VVZ A;  1RKT A;  2XGC A;  2DA3 A;  3RZO J;  2QOP A;  5E3O A;  1ZR2 A;  4A3E J;  3HTH A;  1ETW A;  5CXG A;  1NTC A;  1XG1 A;  2MW8 A;  3F0C A;  2EQR A;  3A02 A;  2LTP A;  3OSG A;  1EF4 A;  2K9Q A;  1IC8 A;  5HBU A;  3FKI J;  3JRA A;  3COL A;  3TP3 A;  3GTL J;  2FBQ A;  4B1R A;  3A01 A;  3SJM A;  4BY1 J;  3HOZ J;  2E2I J;  3M3Y J;  4MK6 A;  3HB9 A;  1U9O A;  2JMW A;  2M34 A;  2LK2 A;  3QQA A;  5FKM A;  2Y9Y A;  1ETV A;  3VVX A;  3BJB A;  2ECB A;  1XC5 A;  2X9D A;  2Y0S N;  4FIS A;  2NVQ J;  3EGQ A;  5EF6 A;  4YZE A;  1RKW A;  2NX4 A;  5C4J J;  2W48 A;  1B72 A;  1TWG J;  2NP3 A;  2PZ9 A;  2GFN A;  2XPW A;  3IV5 A;  5EGO A;  1JKQ C;  4EEF G;  2P81 A;  1MH4 A;  2HI3 A;  2JA5 J;  1POG A;  1HLV A;  3LSG A;  3BQY A;  2AHQ A;  3DPJ A;  2O7O A;  3BT9 A;  1GT0 C;  2UXP A;  4RBO A;  2IEK A;  4D7N A;  4C3I J;  1TWH J;  4CYC B;  2MG4 A;  3PO3 J;  2RHA A;  3B81 A;  3OOU A;  3HTI A;  3BR3 A;  2K9S A;  3VUQ A;  1BL0 A;  5F04 A;  5EZG A;  3DCF A;  3NI7 A;  2DMP A;  1ETO A;  2H1K A;  3RZD J;  3BR5 A;  4FE7 A;  1RES A;  3BTJ A;  4XRM A;  5EG0 A;  3S16 J;  2ME6 A;  4L62 A;  5FKL A;  4UUS A;  3EUP A;  5GP9 A;  3RKQ A;  3M4O J;  4DYC A;  3ON4 A;  1BJZ A;  2QF7 A;  3B6A A;  3K2A A;  1FIA A;  1AU7 A;  3JRE A;  2NS8 A;  5GPC A;  5IP7 J;  2ZCM A;  1FTZ A;  5F0F A;  5IOY A;  1NK2 P;  1SGM A;  1ITY A;  2TRT A;  2O9L A;  2JJ7 A;  2REK A;  2UXO A;  4C2M J;  5CXI A;  2HKU A;  1IJW C;  1HF0 A;  1JGG A;  3LOC A;  3VP5 A;  4C3J J;  2JN6 A;  3FIW A;  3JRC A;  2UXI A;  2O7T A;  2DMT A;  2K40 A;  3TED A;  1Y1W J;  4X1E A;  4DYQ A;  5CW8 A;  3TW6 A;  3WHC A;  5M5W J;  3QBM A;  2RAE A;  2XSD C;  5IPA A;  1MBG A;  1D5Y A;  4QSH A;  5E3N A;  2XDN A;  5HSZ A;  2DG7 A;  1GV2 A;  4MO7 A;  5FLM J;  5M3F J;  3UKG A;  3LJL A;  1GV5 A;  4GFB A;  1BW5 A;  5J1R A;  1VND A;  3HE0 A;  1QRY A;  1TWF J;  3JRF A;  1Q1V A;  2ZCN A;  3QPL A;  3BHQ A;  3HM5 A;  4IHX A;  1AHD P;  1LE8 A;  4I76 A;  1FTT A;  1U78 A;  4JNN A;  4M6V A;  3NAU A;  1ETK A;  4BKX A;  3GTO J;  2R7Z J;  3VOX A;  2DG8 A;  5H9T A;  1HOM A;  4AC6 A;  2VI6 A;  4DZP A;  2VUM J;  2D5V A;  2YVE A;  1WI3 A;  5IYC J;  2H8R A;  3IH2 A;  4G12 A;  1G2H A;  3I4N J;  1JJ8 C;  3GTG J;  2R5Z B;  2VKE A;  4M3F A;  3BQZ A;  1O4X A;  1H8A C;  3G56 A;  2DMU A;  2GBY A;  1DU0 A;  1W0T A;  4D5F A;  2EZH A;  1IRZ A;  4NN1 A;  4ICH A;  3AQS A;  4PXI A;  5FLV A;  2HYJ A;  5JLX A;  5J3L A;  2ZOZ A;  2FD5 A;  4A69 C;  3TW7 A;  2HXO A;  2L0K A;  3ZQI A;  1X58 A;  4UUS B;  4A3K J;  4AYB N;  2ZB9 A;  1B8I A;  5DS9 A;  1ETX A;  1OFC X;  4IHV A;  2DMN A;  3BCG A;  3NNR A;  1FIP A;  1JKO C;  1RPW A;  5E3M A;  2CU7 A;  1JT0 A;  4B4C A;  2DA6 A;  4M3G A;  3KNW A;  3GEU A;  2NVY J;  2FX0 A;  3FIS A;  4D5C A;  1R9T J;  3L1P A;  4V2F A;  1VFC A;  5M5Y J;  4GFK A;  3MN2 A;  1Z77 A;  3FK7 A;  2M9H A;  3BG9 A;  3G1L A;  4A93 J;  5IP9 J;  2EZL A;  2Y2Z A;  2M8G X;  1CQT A;  3G1M A;  2JWT A;  4AC0 A;  1SFO J;  1JKP C;  4JX5 A;  1T33 A;  1YRN A;  4ACI A;  2L7F P;  4JL3 A;  5M5X J;  5EYR A;  3IUV A;  3NAR A;  1OCT C;  3GTP J;  2G7S A;  1UMQ A;  2MGQ A;  2E2H J;  3ZQH A;  3S17 J;  2RAS A;  2WGB A;  2CRG A;  1JUM A;  1JJ6 C;  2ID3 A;  5K7H A;  5IYB J;  3BNI A;  3JRB A;  1MH3 A;  1X2N A;  3GZI A;  2KT0 A;  4BY7 J;  3GTJ J;  4BXX J;  2YVH A;  2G3B A;  4B3A A;  3QKX A;  2IU5 A;  2HYT A;  3GTM J;  1ZR4 A;  2EZI A;  4LOC A;  1LE8 B;  2IBD A;  3GTQ J;  2WV1 A;  4UDS A;  2R5Z A;  2XPU A;  1VF9 A;  1X2M A;  2CQQ A;  2EZK A;  3MVP A;  3G7R A;  2OPT A;  1ZGW A;  2DTZ A;  1VI0 A;  2WB1 N;  2HDD A;  4DYR A;  3ON2 A;  2NVT J;  4FE4 A;  3JRD A;  5M3M J;  1ENH A;  4Y52 J;  2OER A;  1TWC J;  2R93 J;  2XGD A;  3BTC A;  4XIC A;  3VOK A;  1MBE A;  2HOA A;  2ECC A;  4NDL A;  4XRS A;  2LKX A;  4XRS G;  2JK3 A;  2R5Y B;  3A03 A;  2LD5 A;  1K61 A;  3HTA A;  4MLO A;  5K7F A;  4X6A J;  1TC3 C;  1IDZ A;  1I6H J;  1RET A;  1WGX A;  2DJN A;  4IEJ A;  5F0H A;  2YUS A;  2LR8 A;  1UI5 A;  4A3L J;  1B8I B;  2CUE A;  2GUH A;  5FMP A;  1LFU P;  3C2B A;  3W6V A;  1DU6 A;  2HXI A;  2M2E A;  1F36 A;  1GDT A;  4FTH A;  1MBH A;  1UHS A;  2E2J J;  2O8K A;  2DA4 A;  2LFB A;  5IP6 A;  5DAJ A;  2ID6 A;  3V6G A;  1BW6 A;  3BTL A;  3SFI A;  1NK3 P;  2Y31 A;  5FJ8 J;  1WPK A;  3JRI A;  2DA7 A;  5HAW A;  3LSR A;  4JKZ A;  3HOX J;  3O8G A;  5E3L A;  3JRH A;  1AKH B;  3CJD A;  2YU9 J;  4JP0 A;  1YRN B;  2M0C A;  2F07 A;  3Q0U A;  3VW0 A;  4JYK A;  3LNQ A;  3E7Q A;  3LWJ A;  1ZK8 A;  2OF7 A;  3S1M J;  1I50 J;  3JRG A;  1H89 C;  1LFB A;  2Q24 A;  5FGL A;  4GCK A;  2CUF A;  5HOD A;  4L5E A;  3Q3S A;  9ANT A;  1IDY A;  3ZQF A;  3RQI A;  4UUT A;  3H0G J;  2KDZ A;  4BBS J;  5AQC A;  3HGG A;  3D1N I;  1IV6 A;  3Q0W A;  4GFL A;  2L9R A;  3S2D J;  4NEL A;  3IH4 A;  2NS7 A;  1U9N A;  3CDL A;  2R5Y A;  2V57 A;  4DZJ A;  4A3M J;  2VKV A;  5FKO A;  2VPR A;  4A3B J;  3HOY J;  3NRG A;  4HKU A;  3CRJ A;  3I4M J;  3LSJ A;  1GUU A;  5JLW A;  5K58 A;  4MIM A;  1BA5 A;  2E19 A;  3IH3 A;  2L7Z A;  4MXM A;  3S1Q J;  2FJ1 A;  2NP5 A;  1K83 J;  4A3D J;  3VW1 A;  2LY9 A;  1MBK A;  2PMZ N;  3K7A J;  5C4X J;  3VW2 A;  1U8B A;  1ETQ A;  2MSY A;  5F27 A;  2GLO A;  3LSP A;  2X6O A;  4Y7N J;  3JR9 A;  3ANP A;  1S7E A;  3CQZ J;  1HDD C;  3CMY A;  4A3G J;  4J19 A;  1QPI A;  2LVS A;  2R92 J;  3JSJ A;  4CGR A;  2LLK A;  1AKH A;  1XS9 A;  5FHP A;  3BRU A;  3G1O A;  5F08 A;  1RR7 A;  2WAQ N;  3BG3 A;  1MNM C;  2B63 J;  3HKZ N;  2XB0 X;  5DTD A;  3PO2 J;  2QCO A;  3HOV J;  1MSE C;  2ZOY A;  2ELK A;  1OCP A;  3BR6 A;  3ZQG A;  2I10 A;  1JTY A;  2JA7 J;  2JA6 J;  2NVX J;  2NOG A;  3ZQL A;  1JT6 A;  2DA2 A;  1HDP A;  1PUF B;  1QVT A;  4AF5 A;  1MBJ A;  1APL C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...