4IKTA

Crystal structure of truncated (delta 1-89) human methionine aminopeptidase type 1 in complex with n1-(5-chloro-6-methyl-2-(pyridin-2-yl)pyrimidin-4-yl)-n2-(5-(trifluoromethyl)pyridin-2-yl)ethane-1,2-diamine
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
304
structure length
304
Chain Sequence
YRYTGKLRPHYPLMPTRPVPSYIQRPDYADHPLGMSESEQALKGTSQIKLLSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCYPSPLNYYNFPKSCCTSVNEVICHGIPDRRPLQEGDIVNVDITLYRNGYHGDLNETFFVGEVDDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQANGFSVVRSYCGHGIHKLFHTAPNVPHYAKNKAVGVMKSGHVFTIEPMICEGGWQDETWPDGWTAVTRDGKRSAQFEHTLLVTDTGCEILTRRLDSARPHFMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Identification, Biochemical and Structural Evaluation of Species-Specific Inhibitors against Type I Methionine Aminopeptidases
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Methionine aminopeptidase 1
total genus 99
structure length 304
sequence length 304
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2012-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 4iktA00
4U69A 2P99A 2IW2A 5CDLA 1WN1A 2BH3A 2NQ6A 4IKTA 4S01A 1XNZA 4A6WA 4U76A 4U6EA 4FLKA 3CB6A 2P9AA 3FMRA 4FO8A 4S00A 4R60A 1C23A 1QXZA 5JI6A 2HOWA 1O0XA 3CTZA 1YJ3A 1Y1NA 5D6FA 2G6PA 1QXYA 2BHDA 4U73A 2B3KA 2DFIA 3Q6DA 2BWSA 3FMQA 4U70A 1W2MA 2EA2A 2V3XA 1YW9A 4IDYA 2BWXA 1C22A 1XGSA 4FKCA 4S2TP 2Q96A 3L7GA 2BHAA 2GG8A 2Q92A 3IU8A 2EVOA 2EVMA 2GG7A 4RZZA 4IKRA 1WBQA 1CHMA 3CB5A 3IU7A 2EVCA 3MX6A 4JUQA 5CLSA 2BN7A 3MR1A 4KM3A 2BWTA 1XGOA 4ZWUA 5CDEA 3RVAA 4U6ZA 4B28A 2P98A 2B3LA 4IKUA 4A6VA 2BB7A 2GG9A 3IG4A 4IPAA 2BWWA 1XGNA 5CIKA 1PV9A 2GZ5A 4OOKA 2V3YA 3TAVA 1KQ0A 2GTXA 2EA4A 1WLRA 5D6EA 3L24A 4EGEA 2BHCA 4RZYA 3TB5A 2OKNA 1BOAA 2ZSGA 3D27A 1YW8A 4IF7A 2Q95A 4FLIA 1B6AA 1M35A 2BWVA 2GU5A 2GU6A 2BWUA 1XGMA 1WY2A 4IU6A 5E5BA 4ZWPA 4U71A 1QZYA 4U6JA 5CE6A 2V6CA 4HXXA 4RGZ1 1WKMA 4FO7A 3IU9A 3PKBA 4U1BA 2MATA 2OAZA 1WL9A 4IKSA 3PKDA 2NQ7A 4ZNGA 2Q93A 1JAWA 5JHUA 1C21A 1MATA 1R5HA 2GGBA 1C27A 2GGCA 1BN5A 3BIPA 4PNCA 2BHBA 2GG3A 3PKCA 2GG0A 5CNXA 2GU4A 4Z7MA 1R58A 3FM3A 4FLLA 1WL6A 2V3ZA 4QR8A 1A16A 1YVMA 3S6BA 4U6CA 4FLJA 1QXWA 4U6WA 3PKAA 3BIQA 5FCFA 2Q8KA 4ZWOA 1KQ9A 1YW7A 1KP0A 1C24A 4IECA 2BWYA 1B59A 4S2RP 4MATA 4PV4A 3PKEA 5CDVA 5FCHA 2GG2A 1R5GA 3RORA 3BITA 3MATA 2GA2A 4U75A 2B3HA 4FUKA 2Q94A 2GG5A 2GU7A 1W7VA 2ADUA 5JFRA 1N51A
chains in the Genus database with same CATH superfamily
4U69A 2P99A 2IW2A 5CDLA 1WN1A 2BH3A 2NQ6A 4IKTA 4S01A 1XNZA 4A6WA 4U76A 4U6EA 4FLKA 3CB6A 2P9AA 3FMRA 4FO8A 4S00A 4R60A 1C23A 1QXZA 5JI6A 2HOWA 1O0XA 3CTZA 1YJ3A 1Y1NA 5D6FA 2G6PA 1QXYA 2BHDA 4U73A 2B3KA 2DFIA 3Q6DA 2BWSA 3FMQA 4U70A 1W2MA 2EA2A 2V3XA 1YW9A 4IDYA 2BWXA 1C22A 1XGSA 4FKCA 4S2TP 2Q96A 3L7GA 2BHAA 2GG8A 2Q92A 3IU8A 2EVOA 2EVMA 2GG7A 4RZZA 4IKRA 1WBQA 1CHMA 3CB5A 3IU7A 2EVCA 3MX6A 4JUQA 5CLSA 2BN7A 3MR1A 4KM3A 2BWTA 1XGOA 4ZWUA 5CDEA 3RVAA 4U6ZA 4B28A 2P98A 2B3LA 4IKUA 4A6VA 2BB7A 2GG9A 3IG4A 4IPAA 2BWWA 1XGNA 5CIKA 1PV9A 2GZ5A 4OOKA 2V3YA 3TAVA 1KQ0A 2GTXA 2EA4A 1WLRA 5D6EA 3L24A 4EGEA 2BHCA 4RZYA 3TB5A 2OKNA 1BOAA 2ZSGA 3D27A 1YW8A 4IF7A 2Q95A 4FLIA 1B6AA 1M35A 2BWVA 2GU5A 2GU6A 2BWUA 1XGMA 1WY2A 4IU6A 5E5BA 4ZWPA 4U71A 1QZYA 4U6JA 5CE6A 2V6CA 4HXXA 4RGZ1 1WKMA 4FO7A 3IU9A 3PKBA 4U1BA 2MATA 2OAZA 1WL9A 4IKSA 3PKDA 2NQ7A 4ZNGA 2Q93A 1JAWA 5JHUA 1C21A 1MATA 1R5HA 2GGBA 1C27A 2GGCA 1BN5A 3BIPA 4PNCA 2BHBA 2GG3A 3PKCA 2GG0A 5CNXA 2GU4A 4Z7MA 1R58A 3FM3A 4FLLA 1WL6A 2V3ZA 4QR8A 1A16A 1YVMA 3S6BA 4U6CA 4FLJA 1QXWA 4U6WA 3PKAA 3BIQA 5FCFA 2Q8KA 4ZWOA 1KQ9A 1YW7A 1KP0A 1C24A 4IECA 2BWYA 1B59A 4S2RP 4MATA 4PV4A 3PKEA 5CDVA 5FCHA 2GG2A 1R5GA 3RORA 3BITA 3MATA 2GA2A 4U75A 2B3HA 4FUKA 2Q94A 2GG5A 2GU7A 1W7VA 2ADUA 5JFRA 1N51A
chains in the Genus database with same CATH topology
4U69A 2P99A 2IW2A 5CDLA 1WN1A 2BH3A 2NQ6A 4IKTA 4S01A 1XNZA 4A6WA 4U76A 4U6EA 4FLKA 3CB6A 2P9AA 3FMRA 4FO8A 4S00A 4R60A 1C23A 1QXZA 5JI6A 2HOWA 1O0XA 3CTZA 1YJ3A 1Y1NA 5D6FA 2G6PA 1QXYA 2BHDA 4U73A 2B3KA 2DFIA 3Q6DA 2BWSA 3FMQA 4U70A 1W2MA 2EA2A 2V3XA 1YW9A 4IDYA 2BWXA 1C22A 1XGSA 4FKCA 4S2TP 2Q96A 3L7GA 2BHAA 2GG8A 2Q92A 3IU8A 2EVOA 2EVMA 2GG7A 4RZZA 4IKRA 1WBQA 1CHMA 3CB5A 3IU7A 2EVCA 3MX6A 4JUQA 5CLSA 2BN7A 3MR1A 4KM3A 2BWTA 1XGOA 4ZWUA 5CDEA 3RVAA 4U6ZA 4B28A 2P98A 2B3LA 4IKUA 4A6VA 2BB7A 2GG9A 3IG4A 4IPAA 2BWWA 1XGNA 5CIKA 1PV9A 2GZ5A 4OOKA 2V3YA 3TAVA 1KQ0A 2GTXA 2EA4A 1WLRA 5D6EA 3L24A 4EGEA 2BHCA 4RZYA 3TB5A 2OKNA 1BOAA 2ZSGA 3D27A 1YW8A 4IF7A 2Q95A 4FLIA 1B6AA 1M35A 2BWVA 2GU5A 2GU6A 2BWUA 1XGMA 1WY2A 4IU6A 5E5BA 4ZWPA 4U71A 1QZYA 4U6JA 5CE6A 2V6CA 4HXXA 4RGZ1 1WKMA 4FO7A 3IU9A 3PKBA 4U1BA 2MATA 2OAZA 1WL9A 4IKSA 3PKDA 2NQ7A 4ZNGA 2Q93A 1JAWA 5JHUA 1C21A 1MATA 1R5HA 2GGBA 1C27A 2GGCA 1BN5A 3BIPA 4PNCA 2BHBA 2GG3A 3PKCA 2GG0A 5CNXA 2GU4A 4Z7MA 1R58A 3FM3A 4FLLA 1WL6A 2V3ZA 4QR8A 1A16A 1YVMA 3S6BA 4U6CA 4FLJA 1QXWA 4U6WA 3PKAA 3BIQA 5FCFA 2Q8KA 4ZWOA 1KQ9A 1YW7A 1KP0A 1C24A 4IECA 2BWYA 1B59A 4S2RP 4MATA 4PV4A 3PKEA 5CDVA 5FCHA 2GG2A 1R5GA 3RORA 3BITA 3MATA 2GA2A 4U75A 2B3HA 4FUKA 2Q94A 2GG5A 2GU7A 1W7VA 2ADUA 5JFRA 1N51A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U69 A;  2P99 A;  2IW2 A;  5CDL A;  1WN1 A;  2BH3 A;  2NQ6 A;  4IKT A;  4S01 A;  1XNZ A;  4A6W A;  4U76 A;  4U6E A;  4FLK A;  3CB6 A;  2P9A A;  3FMR A;  4FO8 A;  4S00 A;  4R60 A;  1C23 A;  1QXZ A;  5JI6 A;  2HOW A;  1O0X A;  3CTZ A;  1YJ3 A;  1Y1N A;  5D6F A;  2G6P A;  1QXY A;  2BHD A;  4U73 A;  2B3K A;  2DFI A;  3Q6D A;  2BWS A;  3FMQ A;  4U70 A;  1W2M A;  2EA2 A;  2V3X A;  1YW9 A;  4IDY A;  2BWX A;  1C22 A;  1XGS A;  4FKC A;  4S2T P;  2Q96 A;  3L7G A;  2BHA A;  2GG8 A;  2Q92 A;  3IU8 A;  2EVO A;  2EVM A;  2GG7 A;  4RZZ A;  4IKR A;  1WBQ A;  1CHM A;  3CB5 A;  3IU7 A;  2EVC A;  3MX6 A;  4JUQ A;  5CLS A;  2BN7 A;  3MR1 A;  4KM3 A;  2BWT A;  1XGO A;  4ZWU A;  5CDE A;  3RVA A;  4U6Z A;  4B28 A;  2P98 A;  2B3L A;  4IKU A;  4A6V A;  2BB7 A;  2GG9 A;  3IG4 A;  4IPA A;  2BWW A;  1XGN A;  5CIK A;  1PV9 A;  2GZ5 A;  4OOK A;  2V3Y A;  3TAV A;  1KQ0 A;  2GTX A;  2EA4 A;  1WLR A;  5D6E A;  3L24 A;  4EGE A;  2BHC A;  4RZY A;  3TB5 A;  2OKN A;  1BOA A;  2ZSG A;  3D27 A;  1YW8 A;  4IF7 A;  2Q95 A;  4FLI A;  1B6A A;  1M35 A;  2BWV A;  2GU5 A;  2GU6 A;  2BWU A;  1XGM A;  1WY2 A;  4IU6 A;  5E5B A;  4ZWP A;  4U71 A;  1QZY A;  4U6J A;  5CE6 A;  2V6C A;  4HXX A;  4RGZ 1;  1WKM A;  4FO7 A;  3IU9 A;  3PKB A;  4U1B A;  2MAT A;  2OAZ A;  1WL9 A;  4IKS A;  3PKD A;  2NQ7 A;  4ZNG A;  2Q93 A;  1JAW A;  5JHU A;  1C21 A;  1MAT A;  1R5H A;  2GGB A;  1C27 A;  2GGC A;  1BN5 A;  3BIP A;  4PNC A;  2BHB A;  2GG3 A;  3PKC A;  2GG0 A;  5CNX A;  2GU4 A;  4Z7M A;  1R58 A;  3FM3 A;  4FLL A;  1WL6 A;  2V3Z A;  4QR8 A;  1A16 A;  1YVM A;  3S6B A;  4U6C A;  4FLJ A;  1QXW A;  4U6W A;  3PKA A;  3BIQ A;  5FCF A;  2Q8K A;  4ZWO A;  1KQ9 A;  1YW7 A;  1KP0 A;  1C24 A;  4IEC A;  2BWY A;  1B59 A;  4S2R P;  4MAT A;  4PV4 A;  3PKE A;  5CDV A;  5FCH A;  2GG2 A;  1R5G A;  3ROR A;  3BIT A;  3MAT A;  2GA2 A;  4U75 A;  2B3H A;  4FUK A;  2Q94 A;  2GG5 A;  2GU7 A;  1W7V A;  2ADU A;  5JFR A;  1N51 A; 
#chains in the Genus database with same CATH topology
 4U69 A;  2P99 A;  2IW2 A;  5CDL A;  1WN1 A;  2BH3 A;  2NQ6 A;  4IKT A;  4S01 A;  1XNZ A;  4A6W A;  4U76 A;  4U6E A;  4FLK A;  3CB6 A;  2P9A A;  3FMR A;  4FO8 A;  4S00 A;  4R60 A;  1C23 A;  1QXZ A;  5JI6 A;  2HOW A;  1O0X A;  3CTZ A;  1YJ3 A;  1Y1N A;  5D6F A;  2G6P A;  1QXY A;  2BHD A;  4U73 A;  2B3K A;  2DFI A;  3Q6D A;  2BWS A;  3FMQ A;  4U70 A;  1W2M A;  2EA2 A;  2V3X A;  1YW9 A;  4IDY A;  2BWX A;  1C22 A;  1XGS A;  4FKC A;  4S2T P;  2Q96 A;  3L7G A;  2BHA A;  2GG8 A;  2Q92 A;  3IU8 A;  2EVO A;  2EVM A;  2GG7 A;  4RZZ A;  4IKR A;  1WBQ A;  1CHM A;  3CB5 A;  3IU7 A;  2EVC A;  3MX6 A;  4JUQ A;  5CLS A;  2BN7 A;  3MR1 A;  4KM3 A;  2BWT A;  1XGO A;  4ZWU A;  5CDE A;  3RVA A;  4U6Z A;  4B28 A;  2P98 A;  2B3L A;  4IKU A;  4A6V A;  2BB7 A;  2GG9 A;  3IG4 A;  4IPA A;  2BWW A;  1XGN A;  5CIK A;  1PV9 A;  2GZ5 A;  4OOK A;  2V3Y A;  3TAV A;  1KQ0 A;  2GTX A;  2EA4 A;  1WLR A;  5D6E A;  3L24 A;  4EGE A;  2BHC A;  4RZY A;  3TB5 A;  2OKN A;  1BOA A;  2ZSG A;  3D27 A;  1YW8 A;  4IF7 A;  2Q95 A;  4FLI A;  1B6A A;  1M35 A;  2BWV A;  2GU5 A;  2GU6 A;  2BWU A;  1XGM A;  1WY2 A;  4IU6 A;  5E5B A;  4ZWP A;  4U71 A;  1QZY A;  4U6J A;  5CE6 A;  2V6C A;  4HXX A;  4RGZ 1;  1WKM A;  4FO7 A;  3IU9 A;  3PKB A;  4U1B A;  2MAT A;  2OAZ A;  1WL9 A;  4IKS A;  3PKD A;  2NQ7 A;  4ZNG A;  2Q93 A;  1JAW A;  5JHU A;  1C21 A;  1MAT A;  1R5H A;  2GGB A;  1C27 A;  2GGC A;  1BN5 A;  3BIP A;  4PNC A;  2BHB A;  2GG3 A;  3PKC A;  2GG0 A;  5CNX A;  2GU4 A;  4Z7M A;  1R58 A;  3FM3 A;  4FLL A;  1WL6 A;  2V3Z A;  4QR8 A;  1A16 A;  1YVM A;  3S6B A;  4U6C A;  4FLJ A;  1QXW A;  4U6W A;  3PKA A;  3BIQ A;  5FCF A;  2Q8K A;  4ZWO A;  1KQ9 A;  1YW7 A;  1KP0 A;  1C24 A;  4IEC A;  2BWY A;  1B59 A;  4S2R P;  4MAT A;  4PV4 A;  3PKE A;  5CDV A;  5FCH A;  2GG2 A;  1R5G A;  3ROR A;  3BIT A;  3MAT A;  2GA2 A;  4U75 A;  2B3H A;  4FUK A;  2Q94 A;  2GG5 A;  2GU7 A;  1W7V A;  2ADU A;  5JFR A;  1N51 A; 
#chains in the Genus database with same CATH homology
 4U69 A;  2P99 A;  2IW2 A;  5CDL A;  1WN1 A;  2BH3 A;  2NQ6 A;  4IKT A;  4S01 A;  1XNZ A;  4A6W A;  4U76 A;  4U6E A;  4FLK A;  3CB6 A;  2P9A A;  3FMR A;  4FO8 A;  4S00 A;  4R60 A;  1C23 A;  1QXZ A;  5JI6 A;  2HOW A;  1O0X A;  3CTZ A;  1YJ3 A;  1Y1N A;  5D6F A;  2G6P A;  1QXY A;  2BHD A;  4U73 A;  2B3K A;  2DFI A;  3Q6D A;  2BWS A;  3FMQ A;  4U70 A;  1W2M A;  2EA2 A;  2V3X A;  1YW9 A;  4IDY A;  2BWX A;  1C22 A;  1XGS A;  4FKC A;  4S2T P;  2Q96 A;  3L7G A;  2BHA A;  2GG8 A;  2Q92 A;  3IU8 A;  2EVO A;  2EVM A;  2GG7 A;  4RZZ A;  4IKR A;  1WBQ A;  1CHM A;  3CB5 A;  3IU7 A;  2EVC A;  3MX6 A;  4JUQ A;  5CLS A;  2BN7 A;  3MR1 A;  4KM3 A;  2BWT A;  1XGO A;  4ZWU A;  5CDE A;  3RVA A;  4U6Z A;  4B28 A;  2P98 A;  2B3L A;  4IKU A;  4A6V A;  2BB7 A;  2GG9 A;  3IG4 A;  4IPA A;  2BWW A;  1XGN A;  5CIK A;  1PV9 A;  2GZ5 A;  4OOK A;  2V3Y A;  3TAV A;  1KQ0 A;  2GTX A;  2EA4 A;  1WLR A;  5D6E A;  3L24 A;  4EGE A;  2BHC A;  4RZY A;  3TB5 A;  2OKN A;  1BOA A;  2ZSG A;  3D27 A;  1YW8 A;  4IF7 A;  2Q95 A;  4FLI A;  1B6A A;  1M35 A;  2BWV A;  2GU5 A;  2GU6 A;  2BWU A;  1XGM A;  1WY2 A;  4IU6 A;  5E5B A;  4ZWP A;  4U71 A;  1QZY A;  4U6J A;  5CE6 A;  2V6C A;  4HXX A;  4RGZ 1;  1WKM A;  4FO7 A;  3IU9 A;  3PKB A;  4U1B A;  2MAT A;  2OAZ A;  1WL9 A;  4IKS A;  3PKD A;  2NQ7 A;  4ZNG A;  2Q93 A;  1JAW A;  5JHU A;  1C21 A;  1MAT A;  1R5H A;  2GGB A;  1C27 A;  2GGC A;  1BN5 A;  3BIP A;  4PNC A;  2BHB A;  2GG3 A;  3PKC A;  2GG0 A;  5CNX A;  2GU4 A;  4Z7M A;  1R58 A;  3FM3 A;  4FLL A;  1WL6 A;  2V3Z A;  4QR8 A;  1A16 A;  1YVM A;  3S6B A;  4U6C A;  4FLJ A;  1QXW A;  4U6W A;  3PKA A;  3BIQ A;  5FCF A;  2Q8K A;  4ZWO A;  1KQ9 A;  1YW7 A;  1KP0 A;  1C24 A;  4IEC A;  2BWY A;  1B59 A;  4S2R P;  4MAT A;  4PV4 A;  3PKE A;  5CDV A;  5FCH A;  2GG2 A;  1R5G A;  3ROR A;  3BIT A;  3MAT A;  2GA2 A;  4U75 A;  2B3H A;  4FUK A;  2Q94 A;  2GG5 A;  2GU7 A;  1W7V A;  2ADU A;  5JFR A;  1N51 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...