4IOAH

Crystal structure of compound 4e bound to large ribosomal subunit (50s) from deinococcus radiodurans
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
134
structure length
134
Chain Sequence
MIMPQSRLDVADNSGAREIMCIRVLNSGIGGKGLTTGGGGNKRYAHVGDIIVASVKDAAPRGAVKAGDVVKAVVVRTSHAIKRADGSTIRFDRNAAVIINNQGEPRGTRVFGPVARELRDRRFMKIVSLAPEVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Novel 3-O-carbamoyl erythromycin A derivatives (carbamolides) with activity against resistant staphylococcal and streptococcal isolates.
pubmed doi rcsb
molecule tags Ribosome/ribosome inhibitor
molecule keywords 23S ribosomal RNA
total genus 30
structure length 134
sequence length 134
ec nomenclature
pdb deposition date 2013-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF00238 Ribosomal_L14 Ribosomal protein L14p/L23e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.150.20 Mainly Beta Beta Barrel Ribosomal Protein L14 Ribosomal protein L14 4ioaH00
5DM7H 4U67H 4V19O 1VQ9K 4IOAH 3CCEK 1VQLK 1VQ6K 1K8AL 5HL7H 5GAHL 4IOCH 1Q7YL 2ZJQH 1KD1L 3CXCJ 4WFBH 1VQOK 4IO9H 3CCUK 5DM6H 3PIPH 4WCEH 5JVHH 3J7ZK 3CCRK 3I55K 3PIOH 1VQMK 2OTJK 3CD6K 1YITK 2QEXK 3CCVK 5MLCM 2OTLK 1YJWK 1M90L 1M1KL 3CCQK 5JVGH 3CCSK 1YHQK 1W2BJ 1Q86L 1K73L 1Q81L 3CMAK 3CCLK 4UY8K 4WF9H 1VQ8K 1K9ML 3G4SK 5GADL 3G6EK 5H1SM 3I56K 2ZJPH 5AN9E 1KQSJ 5GAGL 1VQKK 1S72K 4WFNH 3CCJK 1VQ7K 1YIJK 1VQ4K 4WFAH 3CCMK 3CPWJ 2QA4K 3G71K 1KC8L 1YJNK 5GAEL 1VQNK 3CC4K 1QVGJ 1JJ2J 3CC7K 1VQ5K 1QVFJ 1YJ9K 3CF5H 2ZJRH 3CC2K 3OW2J 3J7YL 1YI2K 3DLLH 1Q82L 1N8RL 1NJIL 1VQPK 1WHIA 3CMEK
chains in the Genus database with same CATH superfamily
5DM7H 4U67H 4V19O 1VQ9K 4IOAH 3CCEK 1VQLK 1VQ6K 1K8AL 5HL7H 5GAHL 4IOCH 1Q7YL 2ZJQH 1KD1L 3CXCJ 4WFBH 1VQOK 4IO9H 3CCUK 5DM6H 3PIPH 4WCEH 5JVHH 3J7ZK 3CCRK 3I55K 3PIOH 1VQMK 2OTJK 3CD6K 1YITK 2QEXK 3CCVK 5MLCM 2OTLK 1YJWK 1M90L 1M1KL 3CCQK 5JVGH 3CCSK 1YHQK 1W2BJ 1Q86L 1K73L 1Q81L 3CMAK 3CCLK 4UY8K 4WF9H 1VQ8K 1K9ML 3G4SK 5GADL 3G6EK 5H1SM 3I56K 2ZJPH 5AN9E 1KQSJ 5GAGL 1VQKK 1S72K 4WFNH 3CCJK 1VQ7K 1YIJK 1VQ4K 4WFAH 3CCMK 3CPWJ 2QA4K 3G71K 1KC8L 1YJNK 5GAEL 1VQNK 3CC4K 1QVGJ 1JJ2J 3CC7K 1VQ5K 1QVFJ 1YJ9K 3CF5H 2ZJRH 3CC2K 3OW2J 3J7YL 1YI2K 3DLLH 1Q82L 1N8RL 1NJIL 1VQPK 1WHIA 3CMEK
chains in the Genus database with same CATH topology
5DM7H 4U67H 4V19O 1VQ9K 4IOAH 3CCEK 1VQLK 1VQ6K 1K8AL 5HL7H 5GAHL 4IOCH 1Q7YL 2ZJQH 1KD1L 3CXCJ 4WFBH 1VQOK 4IO9H 3CCUK 5DM6H 3PIPH 4WCEH 5JVHH 3J7ZK 3CCRK 3I55K 3PIOH 1VQMK 2OTJK 3CD6K 1YITK 2QEXK 3CCVK 5MLCM 2OTLK 1YJWK 1M90L 1M1KL 3CCQK 5JVGH 3CCSK 1YHQK 1W2BJ 1Q86L 1K73L 1Q81L 3CMAK 3CCLK 4UY8K 4WF9H 1VQ8K 1K9ML 3G4SK 5GADL 3G6EK 5H1SM 3I56K 2ZJPH 5AN9E 1KQSJ 5GAGL 1VQKK 1S72K 4WFNH 3CCJK 1VQ7K 1YIJK 1VQ4K 4WFAH 3CCMK 3CPWJ 2QA4K 3G71K 1KC8L 1YJNK 5GAEL 1VQNK 3CC4K 1QVGJ 1JJ2J 3CC7K 1VQ5K 1QVFJ 1YJ9K 3CF5H 2ZJRH 3CC2K 3OW2J 3J7YL 1YI2K 3DLLH 1Q82L 1N8RL 1NJIL 1VQPK 1WHIA 3CMEK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DM7 H;  4U67 H;  4V19 O;  1VQ9 K;  4IOA H;  3CCE K;  1VQL K;  1VQ6 K;  1K8A L;  5HL7 H;  5GAH L;  4IOC H;  1Q7Y L;  2ZJQ H;  1KD1 L;  3CXC J;  4WFB H;  1VQO K;  4IO9 H;  3CCU K;  5DM6 H;  3PIP H;  4WCE H;  5JVH H;  3J7Z K;  3CCR K;  3I55 K;  3PIO H;  1VQM K;  2OTJ K;  3CD6 K;  1YIT K;  2QEX K;  3CCV K;  5MLC M;  2OTL K;  1YJW K;  1M90 L;  1M1K L;  3CCQ K;  5JVG H;  3CCS K;  1YHQ K;  1W2B J;  1Q86 L;  1K73 L;  1Q81 L;  3CMA K;  3CCL K;  4UY8 K;  4WF9 H;  1VQ8 K;  1K9M L;  3G4S K;  5GAD L;  3G6E K;  5H1S M;  3I56 K;  2ZJP H;  5AN9 E;  1KQS J;  5GAG L;  1VQK K;  1S72 K;  4WFN H;  3CCJ K;  1VQ7 K;  1YIJ K;  1VQ4 K;  4WFA H;  3CCM K;  3CPW J;  2QA4 K;  3G71 K;  1KC8 L;  1YJN K;  5GAE L;  1VQN K;  3CC4 K;  1QVG J;  1JJ2 J;  3CC7 K;  1VQ5 K;  1QVF J;  1YJ9 K;  3CF5 H;  2ZJR H;  3CC2 K;  3OW2 J;  3J7Y L;  1YI2 K;  3DLL H;  1Q82 L;  1N8R L;  1NJI L;  1VQP K;  1WHI A;  3CME K; 
#chains in the Genus database with same CATH topology
 5DM7 H;  4U67 H;  4V19 O;  1VQ9 K;  4IOA H;  3CCE K;  1VQL K;  1VQ6 K;  1K8A L;  5HL7 H;  5GAH L;  4IOC H;  1Q7Y L;  2ZJQ H;  1KD1 L;  3CXC J;  4WFB H;  1VQO K;  4IO9 H;  3CCU K;  5DM6 H;  3PIP H;  4WCE H;  5JVH H;  3J7Z K;  3CCR K;  3I55 K;  3PIO H;  1VQM K;  2OTJ K;  3CD6 K;  1YIT K;  2QEX K;  3CCV K;  5MLC M;  2OTL K;  1YJW K;  1M90 L;  1M1K L;  3CCQ K;  5JVG H;  3CCS K;  1YHQ K;  1W2B J;  1Q86 L;  1K73 L;  1Q81 L;  3CMA K;  3CCL K;  4UY8 K;  4WF9 H;  1VQ8 K;  1K9M L;  3G4S K;  5GAD L;  3G6E K;  5H1S M;  3I56 K;  2ZJP H;  5AN9 E;  1KQS J;  5GAG L;  1VQK K;  1S72 K;  4WFN H;  3CCJ K;  1VQ7 K;  1YIJ K;  1VQ4 K;  4WFA H;  3CCM K;  3CPW J;  2QA4 K;  3G71 K;  1KC8 L;  1YJN K;  5GAE L;  1VQN K;  3CC4 K;  1QVG J;  1JJ2 J;  3CC7 K;  1VQ5 K;  1QVF J;  1YJ9 K;  3CF5 H;  2ZJR H;  3CC2 K;  3OW2 J;  3J7Y L;  1YI2 K;  3DLL H;  1Q82 L;  1N8R L;  1NJI L;  1VQP K;  1WHI A;  3CME K; 
#chains in the Genus database with same CATH homology
 5DM7 H;  4U67 H;  4V19 O;  1VQ9 K;  4IOA H;  3CCE K;  1VQL K;  1VQ6 K;  1K8A L;  5HL7 H;  5GAH L;  4IOC H;  1Q7Y L;  2ZJQ H;  1KD1 L;  3CXC J;  4WFB H;  1VQO K;  4IO9 H;  3CCU K;  5DM6 H;  3PIP H;  4WCE H;  5JVH H;  3J7Z K;  3CCR K;  3I55 K;  3PIO H;  1VQM K;  2OTJ K;  3CD6 K;  1YIT K;  2QEX K;  3CCV K;  5MLC M;  2OTL K;  1YJW K;  1M90 L;  1M1K L;  3CCQ K;  5JVG H;  3CCS K;  1YHQ K;  1W2B J;  1Q86 L;  1K73 L;  1Q81 L;  3CMA K;  3CCL K;  4UY8 K;  4WF9 H;  1VQ8 K;  1K9M L;  3G4S K;  5GAD L;  3G6E K;  5H1S M;  3I56 K;  2ZJP H;  5AN9 E;  1KQS J;  5GAG L;  1VQK K;  1S72 K;  4WFN H;  3CCJ K;  1VQ7 K;  1YIJ K;  1VQ4 K;  4WFA H;  3CCM K;  3CPW J;  2QA4 K;  3G71 K;  1KC8 L;  1YJN K;  5GAE L;  1VQN K;  3CC4 K;  1QVG J;  1JJ2 J;  3CC7 K;  1VQ5 K;  1QVF J;  1YJ9 K;  3CF5 H;  2ZJR H;  3CC2 K;  3OW2 J;  3J7Y L;  1YI2 K;  3DLL H;  1Q82 L;  1N8R L;  1NJI L;  1VQP K;  1WHI A;  3CME K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...