4IOAJ

Crystal structure of compound 4e bound to large ribosomal subunit (50s) from deinococcus radiodurans
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
136
structure length
136
Chain Sequence
KRTKFRKQFRGRMTGDAKGGDYVAFGDYGLIAMEPAWIKSNQIEACRIVMSRHFRRGGKIYIRIFPDKPVTKKPAETRMGKGKGAVEYWVSVVKPGRVMFEVAGVTEEQAKEAFRLAGHKLPIQTKMVKREVYDEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Novel 3-O-carbamoyl erythromycin A derivatives (carbamolides) with activity against resistant staphylococcal and streptococcal isolates.
pubmed doi rcsb
molecule keywords 23S ribosomal RNA
molecule tags Ribosome/ribosome inhibitor
total genus 20
structure length 136
sequence length 136
ec nomenclature
pdb deposition date 2013-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF00252 Ribosomal_L16 Ribosomal protein L16p/L10e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.1170.10 Alpha Beta Alpha-Beta Complex Aldehyde Oxidoreductase; domain 3 Ribosomal protein L10e/L16 4ioaJ01
3DLLJ 3CF5J 5GAHN 1M1KJ 1VQNH 3CPWH 1VQ8H 2ZJPJ 1K73J 1YJ9H 1VQOH 1Q81J 1VQLH 3CC4H 3CCRH 1VQ7H 1Y69K 5H1SO 3J7ZM 1K8AJ 1JJ2H 2ZJQJ 3CC7H 4IOAJ 4WF9J 1Q82J 1YI2H 1W2BH 3CCQH 3I55H 4WCEJ 5JVGJ 3I56H 3CC2H 4WFBJ 5GADN 1M90J 1WKIA 1VQ5H 3PIOJ 3CMAH 5AN9F 1KQSH 3CMEH 2QA4H 3OW2H 1QVGH 5GAEN 1VQKH 1YJNH 1QVFH 3CXCH 4U67J 3CCJH 1VQPH 2OTJH 1K9MJ 1YIJH 1Q86J 5DM6J 1N8RJ 1KC8J 3CCSH 1VQ4H 5GAGN 2PA2A 3PIPJ 1Q7YJ 1VQ6H 1YHQH 5MLCO 1YJWH 3CCLH 1YITH 2ZJRJ 3G6EH 2QEXH 3CCVH 3CD6H 3CCEH 5DM7J 4UY8M 3CCMH 4WFAJ 1VQ9H 1S72H 2OTLH 5JVHJ 4WFNJ 1KD1J 4IO9J 3G71H 1NJIJ 1VQMH 4IOCJ 3G4SH 3CCUH 5HL7J
chains in the Genus database with same CATH superfamily
3C2OA 3DLLJ 1JROB 3CF5J 3NS1C 1N63B 5GAHN 1M1KJ 1VQNH 1FMAE 4C80A 3CPWH 2J0FA 1VQ8H 2DSJA 2ZJPJ 1K73J 1YJ9H 4ZOHA 3WO0A 1N62B 4GA5A 2OMDA 2QIEA 1VQOH 1YTEA 5HULA 1OTPA 1Q81J 1VQLH 1N60B 3CC4H 4AP8A 3CCRH 1VQ7H 1Y69K 5H1SO 3AN1A 4KWWA 2W3SB 3J7ZM 1K8AJ 2I14A 1YTDA 1JJ2H 2W3RB 2ZJQJ 1VDVA 3NVVC 3CC7H 4IOAJ 4WF9J 1Q82J 5AYZA 1YI2H 1AZYA 1W2BH 3CCQH 3PAJA 3FAHA 3I55H 2B7NA 1O4UA 1FIQC 1FFUB 1QPNA 4WCEJ 1NVJA 2E3TA 5JVGJ 1VLBA 5MPOC 2B7QA 3I56H 3CC2H 4XR5A 2W54B 1ZXIB 4WFBJ 3WNZA 5GADN 2I1OA 3VMMA 1DGJA 2WK5A 1M90J 1WKIA 1VQ5H 1QPRA 3L0GA 4GA6A 1FM0E 3EUB4 3TQVA 3PIOJ 3RPFA 4EAFA 3CMAH 3C2EA 3NRZC 5AYXA 1FO4A 5AN9F 1KQSH 4X46A 3CMEH 2QA4H 2JBMA 1NVIE 3B9JC 5EP8A 5HUPA 1V97A 1X1OA 3OW2H 4C7YA 4C7ZA 5GAEN 1QVGH 1UOUA 3L4PA 1N5WB 1VQKH 4YEKA 1N5XA 1YJNH 4US9A 1QVFH 1WYGA 3AM9A 3CXCH 4U67J 3NVZC 1N61B 3CCJH 4KWVA 1VQPH 3BIIE 1K9MJ 2OTJH 1YIJH 1Q86J 5DM6J 1N8RJ 1KC8J 3CCSH 1VQ4H 1JRPB 4I9AA 5GAGN 1BRWA 3NVYC 3SR6C 2PA2A 1FFVB 2Q5WE 1RM6A 2TPTA 5HUOA 3PIPJ 1Q7YJ 1VQ6H 1YHQH 5MLCO 1YJWH 3CCLH 1YITH 2ZJRJ 3C2FA 3GNNA 3G6EH 2QEXH 3CCVH 4USAA 4US8A 3CD6H 4YYYA 3CCEH 5DM7J 4UY8M 2WK6A 1SB3A 1QPOA 2WP4A 4WFAJ 3CCMH 5EY3A 3FC4A 1SIJA 1VQ9H 1YTKA 1S72H 2OTLH 3ETRC 5JVHJ 2W55B 4WFNJ 1KD1J 3WO1A 3AMZA 4IO9J 4LHMA 3G71H 3H5QA 4EADA 2B7PA 1QAPA 3C2RA 3C2VA 1NJIJ 1VQMH 4GA4A 4IOCJ 3G4SH 5AYYA 3NVWC 1QPQA 3CCUH 5HL7J
chains in the Genus database with same CATH topology
3DLLJ 3CF5J 5GAHN 1M1KJ 1VQNH 3CPWH 1VQ8H 2ZJPJ 1K73J 1YJ9H 1VQOH 1Q81J 1VQLH 3CC4H 3CCRH 1VQ7H 1Y69K 5H1SO 3J7ZM 1K8AJ 1JJ2H 2ZJQJ 3CC7H 4IOAJ 4WF9J 1Q82J 1YI2H 1W2BH 3CCQH 3I55H 4WCEJ 5JVGJ 3I56H 3CC2H 4WFBJ 5GADN 1M90J 1WKIA 1VQ5H 3PIOJ 3CMAH 5AN9F 1KQSH 3CMEH 2QA4H 3OW2H 1QVGH 5GAEN 1VQKH 1YJNH 1QVFH 3CXCH 4U67J 3CCJH 1VQPH 2OTJH 1K9MJ 1YIJH 1Q86J 5DM6J 1N8RJ 1KC8J 3CCSH 1VQ4H 5GAGN 2PA2A 3PIPJ 1Q7YJ 1VQ6H 1YHQH 5MLCO 1YJWH 3CCLH 1YITH 2ZJRJ 3G6EH 2QEXH 3CCVH 3CD6H 3CCEH 5DM7J 4UY8M 3CCMH 4WFAJ 1VQ9H 1S72H 2OTLH 5JVHJ 4WFNJ 1KD1J 4IO9J 3G71H 1NJIJ 1VQMH 4IOCJ 3G4SH 3CCUH 5HL7J
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DLL J;  3CF5 J;  5GAH N;  1M1K J;  1VQN H;  3CPW H;  1VQ8 H;  2ZJP J;  1K73 J;  1YJ9 H;  1VQO H;  1Q81 J;  1VQL H;  3CC4 H;  3CCR H;  1VQ7 H;  1Y69 K;  5H1S O;  3J7Z M;  1K8A J;  1JJ2 H;  2ZJQ J;  3CC7 H;  4IOA J;  4WF9 J;  1Q82 J;  1YI2 H;  1W2B H;  3CCQ H;  3I55 H;  4WCE J;  5JVG J;  3I56 H;  3CC2 H;  4WFB J;  5GAD N;  1M90 J;  1WKI A;  1VQ5 H;  3PIO J;  3CMA H;  5AN9 F;  1KQS H;  3CME H;  2QA4 H;  3OW2 H;  1QVG H;  5GAE N;  1VQK H;  1YJN H;  1QVF H;  3CXC H;  4U67 J;  3CCJ H;  1VQP H;  2OTJ H;  1K9M J;  1YIJ H;  1Q86 J;  5DM6 J;  1N8R J;  1KC8 J;  3CCS H;  1VQ4 H;  5GAG N;  2PA2 A;  3PIP J;  1Q7Y J;  1VQ6 H;  1YHQ H;  5MLC O;  1YJW H;  3CCL H;  1YIT H;  2ZJR J;  3G6E H;  2QEX H;  3CCV H;  3CD6 H;  3CCE H;  5DM7 J;  4UY8 M;  3CCM H;  4WFA J;  1VQ9 H;  1S72 H;  2OTL H;  5JVH J;  4WFN J;  1KD1 J;  4IO9 J;  3G71 H;  1NJI J;  1VQM H;  4IOC J;  3G4S H;  3CCU H;  5HL7 J; 
#chains in the Genus database with same CATH topology
 3C2O A;  3DLL J;  1JRO B;  3CF5 J;  3NS1 C;  1N63 B;  5GAH N;  1M1K J;  1VQN H;  1FMA E;  4C80 A;  3CPW H;  2J0F A;  1VQ8 H;  2DSJ A;  2ZJP J;  1K73 J;  1YJ9 H;  4ZOH A;  3WO0 A;  1N62 B;  4GA5 A;  2OMD A;  2QIE A;  1VQO H;  1YTE A;  5HUL A;  1OTP A;  1Q81 J;  1VQL H;  1N60 B;  3CC4 H;  4AP8 A;  3CCR H;  1VQ7 H;  1Y69 K;  5H1S O;  3AN1 A;  4KWW A;  2W3S B;  3J7Z M;  1K8A J;  2I14 A;  1YTD A;  1JJ2 H;  2W3R B;  2ZJQ J;  1VDV A;  3NVV C;  3CC7 H;  4IOA J;  4WF9 J;  1Q82 J;  5AYZ A;  1YI2 H;  1AZY A;  1W2B H;  3CCQ H;  3PAJ A;  3FAH A;  3I55 H;  2B7N A;  1O4U A;  1FIQ C;  1FFU B;  1QPN A;  4WCE J;  1NVJ A;  2E3T A;  5JVG J;  1VLB A;  5MPO C;  2B7Q A;  3I56 H;  3CC2 H;  4XR5 A;  2W54 B;  1ZXI B;  4WFB J;  3WNZ A;  5GAD N;  2I1O A;  3VMM A;  1DGJ A;  2WK5 A;  1M90 J;  1WKI A;  1VQ5 H;  1QPR A;  3L0G A;  4GA6 A;  1FM0 E;  3EUB 4;  3TQV A;  3PIO J;  3RPF A;  4EAF A;  3CMA H;  3C2E A;  3NRZ C;  5AYX A;  1FO4 A;  5AN9 F;  1KQS H;  4X46 A;  3CME H;  2QA4 H;  2JBM A;  1NVI E;  3B9J C;  5EP8 A;  5HUP A;  1V97 A;  1X1O A;  3OW2 H;  4C7Y A;  4C7Z A;  5GAE N;  1QVG H;  1UOU A;  3L4P A;  1N5W B;  1VQK H;  4YEK A;  1N5X A;  1YJN H;  4US9 A;  1QVF H;  1WYG A;  3AM9 A;  3CXC H;  4U67 J;  3NVZ C;  1N61 B;  3CCJ H;  4KWV A;  1VQP H;  3BII E;  1K9M J;  2OTJ H;  1YIJ H;  1Q86 J;  5DM6 J;  1N8R J;  1KC8 J;  3CCS H;  1VQ4 H;  1JRP B;  4I9A A;  5GAG N;  1BRW A;  3NVY C;  3SR6 C;  2PA2 A;  1FFV B;  2Q5W E;  1RM6 A;  2TPT A;  5HUO A;  3PIP J;  1Q7Y J;  1VQ6 H;  1YHQ H;  5MLC O;  1YJW H;  3CCL H;  1YIT H;  2ZJR J;  3C2F A;  3GNN A;  3G6E H;  2QEX H;  3CCV H;  4USA A;  4US8 A;  3CD6 H;  4YYY A;  3CCE H;  5DM7 J;  4UY8 M;  2WK6 A;  1SB3 A;  1QPO A;  2WP4 A;  4WFA J;  3CCM H;  5EY3 A;  3FC4 A;  1SIJ A;  1VQ9 H;  1YTK A;  1S72 H;  2OTL H;  3ETR C;  5JVH J;  2W55 B;  4WFN J;  1KD1 J;  3WO1 A;  3AMZ A;  4IO9 J;  4LHM A;  3G71 H;  3H5Q A;  4EAD A;  2B7P A;  1QAP A;  3C2R A;  3C2V A;  1NJI J;  1VQM H;  4GA4 A;  4IOC J;  3G4S H;  5AYY A;  3NVW C;  1QPQ A;  3CCU H;  5HL7 J; 
#chains in the Genus database with same CATH homology
 3DLL J;  3CF5 J;  5GAH N;  1M1K J;  1VQN H;  3CPW H;  1VQ8 H;  2ZJP J;  1K73 J;  1YJ9 H;  1VQO H;  1Q81 J;  1VQL H;  3CC4 H;  3CCR H;  1VQ7 H;  1Y69 K;  5H1S O;  3J7Z M;  1K8A J;  1JJ2 H;  2ZJQ J;  3CC7 H;  4IOA J;  4WF9 J;  1Q82 J;  1YI2 H;  1W2B H;  3CCQ H;  3I55 H;  4WCE J;  5JVG J;  3I56 H;  3CC2 H;  4WFB J;  5GAD N;  1M90 J;  1WKI A;  1VQ5 H;  3PIO J;  3CMA H;  5AN9 F;  1KQS H;  3CME H;  2QA4 H;  3OW2 H;  1QVG H;  5GAE N;  1VQK H;  1YJN H;  1QVF H;  3CXC H;  4U67 J;  3CCJ H;  1VQP H;  2OTJ H;  1K9M J;  1YIJ H;  1Q86 J;  5DM6 J;  1N8R J;  1KC8 J;  3CCS H;  1VQ4 H;  5GAG N;  2PA2 A;  3PIP J;  1Q7Y J;  1VQ6 H;  1YHQ H;  5MLC O;  1YJW H;  3CCL H;  1YIT H;  2ZJR J;  3G6E H;  2QEX H;  3CCV H;  3CD6 H;  3CCE H;  5DM7 J;  4UY8 M;  3CCM H;  4WFA J;  1VQ9 H;  1S72 H;  2OTL H;  5JVH J;  4WFN J;  1KD1 J;  4IO9 J;  3G71 H;  1NJI J;  1VQM H;  4IOC J;  3G4S H;  3CCU H;  5HL7 J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...