4IOAL

Crystal structure of compound 4e bound to large ribosomal subunit (50s) from deinococcus radiodurans
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
104
structure length
104
Chain Sequence
RRKLRTRRKVRTTTAASGRLRLSVYRSSKHIYAQIIDDSRGQTLAAASSAALKSGNKTDTAAAVGKALAAAAAEKGIKQVVFDRGSYKYHGRVKALADAAREGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Novel 3-O-carbamoyl erythromycin A derivatives (carbamolides) with activity against resistant staphylococcal and streptococcal isolates.
pubmed doi rcsb
molecule tags Ribosome/ribosome inhibitor
molecule keywords 23S ribosomal RNA
total genus 16
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2013-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00861 Ribosomal_L18p Ribosomal L18 of archaea, bacteria, mitoch. and chloroplast
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.100 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4ioaL01
4UY8O 1VQKN 1VQ5N 5JVHL 1Q81O 3CXCM 1W2BM 3CCMN 1JJ2M 1K8AO 1M90O 1ILYA 1S72N 1YJ9N 4WFBL 3DLLL 5GADP 3CMAN 1Q86O 4IO9L 5JVGL 2ZJPL 4WCEL 2QEXN 1N8RO 1KD1O 3I55N 3J7ZO 1QVGM 3CC4N 1QVFM 1YI2N 2OTJN 4WFAL 3CMEN 3CPWM 4IOCL 3PIPL 3CC7N 1K9MO 5GAHP 3CC2N 3CCQN 1YJWN 1Q7YO 1VQ7N 1VQ9N 3CCSN 1K73O 4U67L 1YITN 5H1SQ 1VQNN 3G6EN 3CCEN 3PIOL 1VQMN 5GAEP 2QA4N 5MLCQ 3CCVN 4WF9L 2OTLN 2ZJRL 3CCUN 3CCRN 3G4SN 3I56N 1VQ8N 3CD6N 1NJIO 1YIJN 1KC8O 1OVYA 5DM6L 3CF5L 1M1KO 1Q82O 1VQ4N 1VQPN 4IOAL 5HL7L 1YHQN 5DM7L 4WFNL 1VQON 1VQ6N 2ZJQL 3G71N 5GAGP 1YJNN 3CCLN 1VQLN 3OW2M 1KQSM 3CCJN
chains in the Genus database with same CATH superfamily
1WSEA 3ZT3A 1U47A 2GWKA 3R9PA 1TAUA 4YOWA 2RN2A 1D9DA 1OVQA 1QZ6A 1M90O 3CI5A 2HMIA 4M42A 4BG9A 3V9SA 5CE3A 3TTFA 4GW6A 1NGJA 3M8PA 4DR5K 1NGIA 2FSJA 1SAZA 5M1KA 1Q86O 4B9TA 4M3TA 2A5XA 3E01A 1RDAA 3OJSA 5HRPA 3DXMB 4LSNA 4Z4GA 1N8RO 4H03B 2E88A 2YKNA 3G25A 3ZX3A 3OTOK 1N32K 4Y1DA 3ULEA 3J7ZO 4FLWA 4DTUA 4CW7B 3OYFA 4CZFA 3RWUA 3V9XA 2RHKA 1QVFM 3RSEA 3IDHA 3J7AP 4V19S 3DJCA 3MK6A 2P9SA 1ASUA 3AO4A 3LWLA 3DRRA 4FLVA 3T3FA 2CGJA 4ZHRA 4BRGA 5DK5A 3CJ1A 3S3OA 1NOYA 3ULDA 4BC5A 1CXQA 4MFBA 1DTTA 4DFPA 4CJQA 2RKIA 3S3MA 4LF4K 3O9SA 1I39A 4H5VA 3I8BA 4KHSA 1SQKA 3H46O 4CBXA 3DLEA 2F96A 1L3SA 1JCEA 5C0YA 4JYAK 4JHDB 3CCUN 4IKFA 2D5RA 4BR5A 5AFUA 4I9QA 4JK9A 5HOOA 4LF8K 1EETA 3VEWA 1HNXK 3Q7BA 1KLMA 4JNEA 2IC3A 1RCHA 1KAZA 5C2FA 5HRSA 1XHXA 3WEEB 1RDCA 4ELUA 5TKYA 2Q0UA 4JS5A 4FJIA 3MN7A 2E4LA 4AHRA 4XH4A 1T7PA 4I6MB 4IOAL 3VGKA 5FROA 4CBWA 2EHGA 3VETA 3WXLA 3SUOA 4FJJA 1O1WA 2IIRA 4DSLA 4O5FA 3JAMO 3ZLJA 1GLCG 4DFMA 3O9TA 3QFPA 4YDUA 4C23A 1Z26A 1B92A 3OBWA 5J2QA 4FK4A 3NBPA 3TU5A 5AQOA 3FR0A 1KVAA 3HVTA 4FWMA 1HLUA 1JJ2M 1NGDA 1HPMA 4LF7K 1S1XA 2KHOA 4IG0A 3O8MA 4PL8A 4MLHA 3I33A 3L2VA 1X9JA 1EKEA 3C0BA 3IMXA 5KTQA 4EP5A 1JCGA 4RW9A 3O4WA 3ENHA 1KD1O 4AHSA 3EZWA 4FWQA 4J2EA 4PWDA 4H0VB 4DSKA 4BR7A 4CZKA 1VSJA 3P4IA 4EIAA 3UIQA 2KFNA 2HF3A 4IFEA 1RDWX 2IGIA 1WAJA 1T03A 1RDBA 4XH5A 3PUFA 3O9UA 1NGBA 3P5JA 4CFDA 1HRHA 2FBXA 1TYQB 1KFSA 2QK9A 4GVEA 2JWLA 4LF6K 4M3YA 3K0SA 4LH5A 1BA0A 3CJ9A 3O9QA 3OYEA 1YT3A 1HJOA 3F73A 2FBYA 1RT6A 5AZJA 4OPKA 3QDKA 2QWOA 4DFKA 4KFBA 3ENBA 1MA9B 1IO2A 2CH5A 4U67L 3QEIA 4LH4A 1WB9A 4B1VA 2OANA 3SJHA 4H5TA 1V4TA 3AVMA 4L8RB 4CD3A 4KAZA 4FZZA 5BPNA 3SUQA 4CJ3A 1KRPA 2D0AA 3D2FA 3K9KA 2WUSA 3SMSA 2YJFA 2UYTA 3CM5A 4FJ8A 1CXUA 5HRRA 4DHYA 1ITGA 3U9DA 3R6MA 4EZ6A 5GIOA 5HL7L 5BPLA 1RBUA 2IVNA 3THWA 5DMRA 3SAHA 3K5LA 4YOUA 5GAGP 5C10A 2ZGZA 1K8KB 4NCBA 4JHDA 3M1FA 2ZWHA 2UXDK 2NRXA 3CCLN 1GLFO 2F9WA 4GV9A 3CCJN 4RW8A 4M41A 1UA0A 3I0RA 4OX9K 3CJCA 4A2AA 4BRKA 2YHWA 3L4IA 5AQTA 3EN9A 3LM9A 3TAFA 3GE1A 4F3OA 4FYDA 3B6PA 4BACA 1SL2A 3VQ8A 5AFUH 3H08A 3FZFA 3DLLL 4B9VA 5GADP 4DF8A 1N6QA 2KZZA 2IVOA 4O5BA 4YHHK 4IG3A 4BRFA 1BOTO 5CZ1A 2JLEA 4E1NA 4B8AB 3A5NC 1TKDA 1RFQA 2P9KB 5AQFA 3HYFA 5J2NA 1NK4A 4PKHA 1A5XA 3L4QA 1G15A 2PBDA 4J8FA 5ADXH 1BDGA 2FF3B 2WOMA 3T1YK 2P9KA 4G9ZA 3OY9A 1VAZA 3ALYA 3LDSA 3P83D 3A2FA 4B1WB 4UQGA 1LW0A 1LAWA 4F4KA 3PSFA 4Z4FA 3RR8A 2LSNA 1LWFA 2E1YA 3KHYA 4KTZA 1XMQK 2O8DB 5FPMA 2YHAA 3CJ7A 4DLEA 4DB3A 5KI6A 1HYZA 1FKOA 2X6SA 3T7ZA 2OPQA 3ATVA 2QWQA 3DAWA 3AVGA 4RWTA 3OS0A 2D4WA 4BR9A 1HNZK 2YI1A 1YVNA 3MCPA 3MCAB 3AAPA 5SWMA 4PKGA 4AHUA 1S1TA 1KC8O 4KHPK 4DTRA 4DQRA 3L2RA 1UWBA 3QBWA 3HPOA 1VQON 5HBMA 2Z1GA 3NDKA 5CYMA 1YJNN 1BIUA 4KB1A 3ZSVA 5AQGA 3TWHA 4JV5K 3G0ZA 5AQRA 5IT9O 5FLXO 3D2FB 4RW4A 4F2RA 4JLHA 4CHYA 3L8BA 3KLGA 1Q81O 1IBMK 4CGHA 1HJRA 3EE9A 3P38A 2HHXA 1JKHA 3HBTA 3VGLA 5BR9A 4XEIA 3OJUA 3AVIA 3AAQA 3AVFA 2D0OA 3CMAN 4CJRA 4IZ9A 2IAJA 4MQ3A 1S22A 2G8UA 3FZLA 3A8YA 1UOCA 4E7JA 3AVLA 4EZ9A 1NGFA 3FE1A 5JICA 3BUZB 4FWNA 4MDBA 4FLXA 3LDPA 3LPUA 4BVOA 3AVCA 2V7YA 2HOEA 3E9LA 2JGUA 4NLCA 4DV0K 3UE5A 2YNHA 1DKGD 3C7NB 4KO0A 4B9NA 3WUHA 4CF0A 1ATNA 1NK5A 4LY7A 4LFBK 1NK9A 3QFUA 1Q7YO 4FW1A 4OJRA 2OCEA 4KB0A 2D1KA 4CHZA 1DT9A 4DTSA 3EE8A 4JKAA 3B8AX 1HMVA 3QEXA 4HUEA 3PIOL 4JI0K 5GAEP 1GLAG 3OYAA 2HVIA 3KJVA 1HKBA 3CCRN 3AA5X 1QSSA 4JS4A 3VQQA 3DLRA 4M7XA 1QQNA 3VEOA 4E7LA 1ZBHA 4NCGA 1P8ZA 5GIPA 3IRXA 3SZ2A 1YIJN 4OLAA 5DM6L 4JK7A 1D8YA 3O80A 2A1SA 1SS6A 4BRQA 5HRNA 4BVPA 3ZEUA 4JEPA 3WNEA 2RF2A 3G71N 3V9ZA 2BANA 4CJ5A 3G10A 4ZTJA 5JS2A 4OGEA 2UUAK 3SPYA 1NJZA 4FJNA 3ZYYX 1A5WA 1C0GA 5BRHA 4FVMA 3SLCA 1C0MA 2CGLA 3J81O 4O44A 2KFZA 3DYAA 3VERA 4IXCA 2NNWA 4BE2A 4BG8A 3RMBA 3SV3A 5GINA 3D7EO 1TVRA 1LAVA 1S3XA 4G1QA 4KTWA 4B08A 2G8WA 3MEGA 3VA0A 1L5UA 3IG1A 3TTCA 3BZKA 2UXCK 3DMJA 5KRTA 3M5RA 4CBUA 4GMJB 2P9IA 5HROA 3O5BA 4CZEA 1BCMA 5LJVA 3WQTA 2VG7A 1QHTA 3MN9A 2GX9A 1HR0K 3KD5E 3P39A 2OPPA 1S1VA 3EO3A 3HRGA 2OA8A 4NXNK 4PY5A 1J54A 3THXB 4YY3K 5LMNK 3ZX0A 4DV7K 4KHQA 4IOCL 5FDLA 1TUUA 1IBKK 3VEZA 1QQOA 3DLBA 1NKEA 2E5LK 1NOZA 4N56A 3WEEA 4DR2K 4IEEA 3VF4A 4DQ8A 1X9MA 1KTQA 3QLHA 3UKRA 3SAGA 1VQ9N 4CD1A 4FLZA 4HWIA 2P9LB 1YITN 3LDNA 3ZT1A 1B9DA 1H1VA 1XC3A 2HVHA 4O8KA 5AQJA 3FZMA 3VOVA 5HP1A 4OPAA 3WQUA 4DCHA 5FRNA 3WXIA 2W41A 4CESA 4FPAA 3IAYA 3PX0A 1WSIA 1XHZA 1IKWA 4DTOA 1NJIO 3KKRA 1YUWA 3NGZA 2HHSA 4GY2B 4JI7K 1BIZA 1W0HA 5M1NA 4BE0A 2P9SB 3NH0A 2NRHA 1WSFA 2A42A 4F3TA 2ZJQL 3VQ4A 3K58A 4BRPA 4W5QA 1JLAA 1L3TA 1ATSA 1XUPO 2FBVA 2WBNA 1WLJA 1VQKN 4DU1A 1ATRA 4BRHA 3D0PA 1IKVA 4JI3K 2F8TA 1EWRA 3CERA 3T1HK 3TSQA 1W2BM 3VQ9A 2VCPA 2X6NA 2E2PA 3OYGA 3C95A 1J5EK 2O8CB 3MX5A 4CZMA 4RG8A 4KHNA 4CJFA 5M1QA 3BDPA 2ASOA 2O8FA 4HCBA 2F8SA 2IVPA 2W42A 3Q7CA 4JKHA 4K8XA 1EP4A 1NWKA 2D0CA 3C94A 4JI6K 3M6GA 3SK3A 1GOCA 4JI5K 4OLBA 3O4QA 5I3UA 2HNDA 4E1MA 1T44A 4NXMK 5KGWA 2G8HA 3ATUA 3F9MA 3PIPL 2H3GX 4FZXC 4FWPA 2A40A 5GAHP 3H3OB 3TSPA 1RTHA 3ZT0A 3KWGA 3AVKA 3CG7A 3HL8A 4X66K 3P31A 4QS9A 4IDHA 2I7PA 2NUBA 3H1QA 1Z05A 4M3RA 4BRDA 3RR7A 1VQNN 4KRFA 3QBXA 3KLIA 4BQLA 1VQMN 3CCVN 4J2BA 4DV6K 4B1UB 4F8RA 2BTFA 1KVCA 4FJ9A 1ZBSA 2E1ZA 4BC2A 1W7AA 4C8NA 1S6QA 4CFCA 1XWLA 1P90A 3O4NA 3SBTA 2P1JA 3THYB 1ZXOA 1RTJA 5AQIA 3CYMA 3VQ6A 1QS4A 3P1GA 3SJJA 1NNEA 1BGXT 3BF1A 2BGGA 4WQ5C 4MLEA 5DM7L 1TK0A 4JKEA 3WXMB 4LFCK 2P9LA 3QEVA 1SKWA 5F2RA 2VGNA 4DR7K 5ELZA 1IBLK 3UKUB 4QAGA 2I7NA 3HSTB 4UY8O 3N4QA 3RVCA 1V4SA 1ZC6A 2PZSA 1SUQA 4B3SK 4FLUA 2NRTA 4E7KA 1TKTA 3VPZA 3V9WA 2QWRA 1HYSA 4GKJK 3PX4A 1YJ9N 2QXFA 4I7FA 4DLGA 2DY4A 3SUPA 3K9JA 2YNGA 3E9PA 4CEAA 4CE9A 3H45C 1S6PA 1NJYA 3VQ5A 4Q5VA 1HUXA 1TK8A 4DTNA 3W0LA 4IOXA 3NH2A 5EOYA 3PX6A 5F0XA 4H8KA 3KKSA 1RILA 3QICA 4KV8A 3CQ8A 1TL1A 1BUPA 5EY4A 1C1BA 4IJAA 4M3WA 3MX2A 3GDQA 1KSPA 1T3VA 1L3VA 5FPNA 5C15A 4DS5A 5BREA 1E3MA 1U2VA 3KK7A 4BRAA 1N34K 2HHHK 4K0KK 2YJEA 3ULEB 1VSEA 2HF4A 2YKMA 4ILGB 5MLCQ 4OPHA 4CK3A 4N41A 3ENOA 4ISGA 3FZHA 2FF6A 4CHOA 1VQ8N 1TKXA 1T6DA 3KK2A 3WXKA 3ZSQA 3F2KA 1HNWK 4B3TK 2HBKA 1C0TA 1U4BA 4CF9A 1M1KO 2G8FA 4FWLA 3V1RA 4IFVA 3AVAA 3WNHA 3NF8A 1J53A 3LWMA 2FSKA 5AQWA 1HKCA 4A61A 1CZ9A 3DOKA 3IS9A 2VWJA 1R0AA 2PYLA 1QSYA 2E6MA 2HSTA 1BQNA 1E4GT 2EX3A 4DUYK 1SZ2A 3MEEA 2HMPA 1FJGK 3SI6A 1IJJA 4H5RA 4O8UA 3KLFA 3LP1A 5JVHL 2DPNA 4BRLA 4B9QA 1BI4A 4K41A 2AJQA 4CZLA 4MO4A 3MWPA 4FJ5A 1QE1A 1WOQA 3BGRA 3GBTA 2HHQA 1SL0A 4CJWA 3K57A 2W6KA 3N4PA 3FFKB 1NMDA 2VQEK 4IJNA 3ZSYA 1VSMA 2FC0A 3L2QA 4F2SA 3QIOA 4MO5A 4WCEL 2YNFA 3AARA 3GG4A 1C1AA 4BWMA 4C1NK 1BQMA 2G8KA 5EVZA 2X74A 4DQPA 1MU2A 3VEXA 2VWKA 1QVGM 4CK1A 3EYZA 1X9SA 1EWQA 3BP8A 3KIOA 5FRMA 2DFEA 4CEQA 4JAXA 4O0IA 4BE1A 3A5LC 4DSJA 3UKRB 1RT5A 5AQYA 2V52B 4H0XB 5AQQA 2O8CA 1C0FA 4RTFD 5A2QO 4JKBA 3EY1A 2F4VK 4CECA 3WNGA 4FJXA 4M3XA 4DV5K 1N5YA 2NLXA 3MAQA 2B4JA 1R59O 4H4MA 4HTUA 4BC4A 3OS2A 4GVMA 4H5NA 3LP2A 4C8LA 2WONA 3U3YA 3PV8A 3WNFA 1S1WA 1UAXA 4OVLA 3S41A 4DF4A 3L2WA 4KREA 1NGCA 4CJKA 1NK6A 2HHVA 4YDUC 3QERA 2HHTA 1T8EA 4KPYA 1A5VA 1XI1A 1JLBA 4DSFA 2PAVA 1K8KA 4PQUA 3DI6A 4L3QA 2D0BA 5B8HA 1LWCA 3NF7A 3VEYA 4CF2A 3DWLA 3LZIA 3THWB 1MWKA 3SPZA 4Z4IA 3CM6A 3QESA 2Y1JA 2Q0RA 2DFHA 1RBSA 4N76A 2IS3A 3FZKA 1RT2A 1IG8A 3L3VA 3CHWA 3JSMA 4K25A 1K8AO 3KD1E 3HXMA 1HQEA 2IOCA 3VN5A 2NRRA 4KI4A 4Z4EA 2GEMA 4LC9B 4DG1A 4NO7A 4QOZB 5JVGL 4H0OA 5J2PA 4CI6A 3THYA 1VSKA 4ILHA 2E2NA 5AQNA 4NYNA 3H6EA 2BE2A 3LDQA 2DFFA 1VRUA 1J9AA 3NVKA 1U45A 1JLEA 4YORA 2VQFK 1IKYA 1BG3A 3RSEB 1KAYA 4RW6A 4AHCA 1YI2N 3O3HA 1RBVA 2O8EA 1BI4B 1VRTA 1DEJA 4ISFA 4QCLA 4CJ7A 1S1UA 1X3MA 4FM2A 5FPEA 3AY9A 3D45A 5C12A 4CJPA 1ZBFA 3DLGA 4EHUA 3C7NA 1YTAA 1K73O 1ASVA 2QTDA 3U4LA 4HVJA 3NF9A 1SKSA 1D4XA 4QS8A 3O9RA 4CJ4A 2Z1HA 4CZHA 4FPBA 5SZTA 3KWIA 1NKCA 2Q31A 1KXPA 3WT0A 2ASMA 1RT3A 3OBYA 1WBBA 3DRSA 4AM6A 3J80O 3OYBA 4FJLA 4A57A 3HK2A 2QW9A 1QHAA 4QS7A 4OPJA 1L3UA 1Z25A 2QWMA 3E9OA 1U48A 3LANA 5C24A 4CHQA 4EFHA 3MXMA 5D3GA 3HO1A 1QQCA 1U2VB 3MMVA 4DUZK 1BHLA 1WSHA 5AQVA 3ISNC 2VYPA 4OO1J 4CZIA 4CJEA 1RGIA 3U8XA 4B3MK 1C1CA 2FBTA 3KK3A 2WC9A 5KRSA 4XIUA 3O3FA 1EXQA 3UB5A 4CZGA 1SV5A 3CCMN 3VQPA 4GV3A 4RW7A 2B6AA 4CIFA 4YNQA 4N5SA 4CEEA 2AP1A 4CCHA 2B5JA 3TABA 4HUGA 3L6QA 3H1VX 2KZMA 2QXLA 4JD2B 3HOSA 1XQSC 4AHVA 5BR8K 1CLQA 4W5TA 4BRNA 1NMNA 3S3NA 3HPGA 4AILC 3OYDA 4CHPA 2RE2A 2Q2RA 2GBZA 3B6OA 1NGAA 2I5JA 1U04A 2OTJN 3AGKA 3CFOA 1JLGA 2F7TA 4E1JA 5KPZA 3U9ZA 3LAKA 2O4IA 4DWIA 4WQ4A 1K9MO 4FJHA 4EP4A 1FK9A 4BDPA 2Z1JA 3HP9A 3CCQN 4DQIA 1VK0A 3IFRA 1HQUA 3DLKA 4BROA 1LOTB 4JKCA 3RRGA 3CCEN 4NB4A 4DR1K 3QB0A 2ZJRL 4M63C 1UA1A 4W5OA 2HNYA 3CD6N 1F21A 4CGDA 4KBOA 2XY6A 2HW3A 3ZX2A 2XHBA 4H4OA 5KGXA 3C6UA 4IBNA 3CJBA 4DTJA 4M7YA 3K5OA 2P5OA 3M8SA 3DXKA 4FOIA 1HPZA 4CEZA 1KFDA 4HTLA 3TARA 1N36K 5E41A 4Z0UA 2BH1A 3PY8A 4BR4A 5AQPA 5ADXA 5JLHA 2P51A 4CEOA 2ITMA 1BL3A 4DS4A 1Q9YA 4CZJA 2NZTA 2WTUA 1GOBA 4FOEA 4LF9K 4BWJA 2G8VA 5AR0A 3LL3A 1OKJA 3EEQA 3E1YA 3T69A 4DR4K 2P9UA 4IWVA 1C0UA 1BWFO 3ZT2A 4CJSA 3SQ0A 1ILYA 3C6HA 5AQKA 3CFRA 1S72N 1GOAA 3LZJA 4DSIA 4DFJA 4X65K 3U3GA 2PYJA 3JYTA 4H0PA 3HP6A 2P5GA 3LALA 3C6TA 3RMCA 2A41A 4Y0WA 3THVA 2BUPA 1SKRA 4WYBA 3CC4N 1N33K 5TKWA 2P9PB 2P9PA 1T05A 3CQYA 4DU3A 4B1XB 3TTDA 3NCIA 1Y97A 2P9IB 3V4IA 1BO5O 4B9SA 3FGUA 4H5WA 1I94K 1IKXA 1IV0A 1JCFA 4NYFA 5AQUA 1VQ7N 1HYVA 3OA9A 3ZSWA 3CCSN 1C6VA 4AH9A 2W6LA 3TI0A 2QWNA 3SQ1A 3ZEUB 3SV4A 3SQ4A 3JXUA 2Q3SA 4PA1A 2QKBA 4X62K 1Z6RA 4FO0A 1GLBG 4M45A 2A6AA 4CJUA 4E89A 3ZSZA 4DQSA 1NJXA 1LW2A 4EHTA 1CZAN 1S9EA 2PFUA 4O4GA 4Z94A 1JLQA 2O8EB 5BRDA 1Q82O 4BDYA 2R7YA 2UU9K 3CFPA 4JI1K 5EX5A 3C6AA 1LCUA 1QZ5A 2JWKA 2OZSA 1G99A 1TUYA 2AA4A 1ZBUA 3E66A 4J2DA 4E3SA 1OH8A 2NRVA 2Q36A 3GL1A 2E20A 3VF2A 1IH7A 1JXBA 2RPIA 1ZBIA 1XMOK 2HHWA 4Z4CA 4CJTA 3AA2A 3EL2A 4FJMA 3CXCM 4A59A 4BGBA 4DV3K 1O13A 4R79A 1DLOA 2KKZA 5AQHA 4ISEA 5EU7A 2PY5A 2ASPA 4ILJA 3MN5A 5J1EA 4KTQA 2ZJPL 1FW6A 4JN4A 3HZ6A 5BPMA 4FK2A 1WUAA 4DV4K 4HUFA 3VTIA 2GUPA 4I9LA 1YAGA 3VESA 4DR3K 1RTIA 1NG9A 2NRWA 4KH6A 3AA3A 3CMEN 3IKMA 2O8FB 4TSXA 3VENA 3SBGA 3CC7N 2OYQA 3I0SA 4GNIA 1JLFA 3LP0A 1Q18A 1S9GA 2XY8A 1X9WA 1K6YA 3TAPA 1HNIA 4BRIA 1WBDA 1VSDA 2XRIA 3C65A 2HNZA 4W5RA 2ZF5O 1RT1A 3KLEA 3NGIA 1XNRK 1RBTA 4FJKA 4BY9C 3R1XA 3OS1A 3MEDA 4BC3A 2OTLN 3ID8A 3MXIA 5CYQA 3O08A 3G4SN 3VA3A 3I56N 4K42A 1X1PA 3CQXA 3J8AA 2YNIA 4CEBA 2CH6A 3SYZA 4E0DA 3VMFB 3OYNA 2F9TA 1DTQA 3OHRA 3DLHA 1Q9XA 4K8ZA 4CGGA 3K59A 2QM1A 3PO4A 3HI0A 5AQSA 3CJAA 3PO5A 1VQ6N 4OKEA 3OYJA 1JL2A 1NGHA 4HCCA 4E7HA 2DTUA 5CR4A 4I2PA 4ICLA 3OYMA 4CGFA 3PSIA 2QWLA 2ZE2A 1NU0A 3HM9A 4CF8A 4KH5A 2HBMA 3KVGA 5JS1A 2VG6A 4X64K 3M8RA 1KAXA 3NMUA 4PUOA 3HTVA 3W3DA 1KLNA 1MWMA 3CIPA 2ZQBA 4BRMA 1YF5L 1HKGA 4EAHD 3LDOA 3AVJA 4M3UA 4IO9L 2J4RA 4KI6A 2O8BB 4ELTA 3THXA 4C8OA 3NGYA 1BU6O 3AO3A 3KTQA 2EWSA 4FVUA 3BEXA 4ID1A 4Q0BA 5J2MA 3A5MC 3TSUA 4U7BA 4CIEA 4JRPA 2V7ZA 4WQ4C 1ZYQA 5BN8A 4CFBA 3TANA 2E6LA 4H0TB 5AZIB 1LWEA 2Q97A 3RMAA 2VG5A 2GUIA 5AZJB 2NRZA 4C8MA 1VSLA 4E7IA 1VSFA 1ZBLA 4JI4K 1VSIA 3TPQA 2A3ZA 1WAFA 5EXWA 4DTXA 1VHXA 1GLDG 3G6EN 3NHGA 5C2DA 2UUBK 1OH6A 4AF1A 3VQDA 2QA4N 2W40A 4WF9L 4YOXA 1Y64A 4FXDA 4E19A 5LMUK 3AVNA 4N47A 5M1PA 4MDAA 2WFBA 1JL1A 4CK2A 3SUNA 3MDQA 3RMDA 4B9MA 4DTPA 3HT3A 3L2UA 3EKUA 3CF5L 3LPTA 3LDLA 4DSEA 3D6RA 3M8QA 2Z1IA 1YHQN 3HPHA 1OH5A 1W97L 3SQ2A 3AO2A 5AQZA 3NF6A 3L0QA 1D5AA 2KQ2A 1S5JA 3RRHA 2X78A 3NH1A 3OW2M 1KQSM 1W9HA 1U49A 3KK1A 4CF1A 4FLTA 4IDKA 4RCHA 4M3ZA 1RDDA 2GV9A 1TYQA 4CHNA 3O6WA 3VEVA 4DMNA 4FM0A 4CVNE 3ZETB 4A5BA 4KHWA 4GV6A 2FLOA 1CZBA 2FXUA 2D0PA 3PLAA 3DM2A 4B3OA 4AHTA 2KW4A 1RT7A 1TV6A 2XO7A 3QINA 4YFUA 1NLVA 3TAQA 5BN9A 5E26A 4R5PA 4FJGA 2P9UB 3BZCA 4DQQA 3F9KA 5C25A 3O1BA 4W5NA 2E2QA 3ZT4A 1Q8IA 4I2QA 2Y1IA 4FLYA 1WSGA 4B9UA 3K2PA 1EX4A 3V1OA 3ASMA 3K5NA 4HHTA 4AQYK 1QSLA 4FM1A 3JS6A 1TK5A 1NK8A 4CJVA 3ZSRA 2O8DA 3K5MA 2OZMA 5H1SQ 2ZD1A 3HJFA 1GLJO 4CEDA 3LM2A 5JLFA 5CY4A 3SAFA 4DR6K 3QO9A 4IO8A 2O8BA 2GTDA 2ZGYA 3V6DA 2HBJA 4I6MA 1DGKN 3A5OC 4DU4A 2P9NB 3QMLA 4B1YB 2QKKA 3AO5A 4DTMA 3LP3A 5KPRA 5M1OA 3OYIA 1KVBA 1NM1A 1U6ZA 3HSCA 5KQDA 4CGJA 1VQPN 3TAMA 2VGMA 4LF5K 4PL7A 5KQ8A 3VQEA 4CIGA 4WFNL 1T6CA 3DXMA 2YCHA 3ID6A 3L3UA 4C8KA 3EKSA 5CZ2A 4FZYA 3VQCA 5M1FA 3DOLA 1ESVA 4FWSA 1NGGA 2ZM6K 3WXJA 3MN6A 2Q1NA 4ELVA 4BQZA 4AM7A 4F9OA 4LD0A 4KHUA 2YV0X 1BA1A 3A0IX 1E4FT 3FFIA 4JI2K 3QIPA 3R3LA 1HNVA 4JKFA 4JD2A 2YHXA 4WFBL 2E2OA 3KZBA 1JXEA 3DRPA 4YOYA 2O4GA 3ZETA 3RTVA 4LSLA 2OPSA 3FLCO 3QNOA 5I42A 3QEWA 5LY3A 3GOIA 2QEXN 3OVNA 2G8IA 1FXXA 3I55N 3MWTA 4BRCA 2KTQA 1VSHA 2P9NA 1D9FA 4BR0A 2HB5A 3V81A 3HVRA 1I3AA 4B1ZA 4OKJA 2QWPA 4WFAL 3MXJA 3KLHA 3CETA 5T7BA 4CERA 4OKKA 2FSNA 5K14A 4JRQA 1NBWA 4O55A 1YVUA 4CEFA 5JMVA 1GLLO 3TAEA 2VWBA 1HX1A 4FW2A 1RBRA 5C42A 3NAEA 4ID5A 5IWAK 3AO1A 3ZSXA 1IG9A 4DKWA 2A1RA 1NKBA 4FWKA 5KPTA 1J5OA 1SL1A 4PHTX 3AGRA 3O1WA 3ZSOA 1TAQA 3NE6A 2UXBK 3SMPA 5AJ3K 3QNNA 1XNQK 3OYLA 4DV1K 3D2EA 1OVYA 4A2BA 3VF6A 3NFAA 2BDPA 3V9UA 1EQYA 4DV2K 1QTMA 4Y1CA 3M3ZA 3V1QA 1KCFA 5E84A 3U6FA 3SCXA 1VQLN 4WQ5A 4BGAA 4CGIA 1VQ5N 4FSVA 1NGEA 3CPEA 4K43A 4FWOA 4LFAK 1RNHA 1EO1A 1WSJA 3BF3A 4IFYA 1YXQA 1MDUB 2GELA 3IUCA 3OYCA 4FJ7A 2OPRA 3VQBA 4B3RK 4BR2A 3ZCMA 5F1XA 4FK0A 1B9FA 3J7YP 3VQAA 3LAMA 1BISA 4JKGB 5LL6Z 4J2AA 3VTHA 5I9EB 4H0YB 4B9LA 2GWJA 1NJWA 1GLEG 2E8AA 4JKGA 1X3NA 3T1AA 3OYHA 2ETJA 2ITGA 3VQ7A 4OGCA 3D2EB 1TGOA 3OYKA 3AVHA 4BDZA 3BY5A 5AQLA 3HOTA 4NCAA 3AV9A 5LJWA 3AA4A 3MECA 3CPWM 4YOTA 5HLFA 4O0JA 1REVA 1RDUA 1YTUA 3I8DA 1LV5A 4GKKK 4ZTFA 5AQMA 3S9HA 2KLAA 3CC2N 1FKPA 3DXKB 1YJWN 4JKDA 2HBLA 1WNSA 1WN7A 1RT4A 5AZIA 3QETA 4IEIA 3QEPA 3H3NO 2ATQA 3VGMA 2XY7A 4A62A 2YX6A 1QQMA 2V51B 2XY5A 5AQXA 1NK0A 2QI2A 4CFAA 1ASWA 1XC9A 4PKIA 1OH7A 4NLBA 2HHUA 1JLCA 3R8EA 2CGKA 2YHYA 3AVBA 4A5AA 3TR8A 4JI8K 1RTDA 4KHYA 4FL9A 1NK7A 2IDOA 3EZ5A 5BRFA 4XH1A 4Z4HA 4FCYA 1VQ4N 4B8CA 1BCOA 4CJLA 4BREA 3NVMA 5FPDA 4JK8A 3UKUA 4WE1A 4C1NI 2UUCK 4KKOA 3F5TA 1J6ZA 3O3GA 1TL3A 3HM8A 1TKZA 4YOVA 3SNNA 4FWRA 3T19A 2YHBA 3ITHA 5CHIA 4KH4A 3TAGA
chains in the Genus database with same CATH topology
2CGLA 2QWLA 3VERA 4KH5A 2Q0RA 2HBMA 3KVGA 4IXCA 2NNWA 2GWKA 3R9PA 4BG8A 1KAXA 4YOWA 3FZKA 3NMUA 1IG8A 1QZ6A 3HTVA 3D7EO 5GINA 3W3DA 3CHWA 4K25A 1MWMA 1K8AO 1S3XA 3CIPA 1M90O 4BRMA 1YF5L 1HKGA 2NRRA 4EAHD 3CI5A 3LDOA 2GEMA 3TTCA 4BG9A 5CE3A 3TTFA 1NGJA 4LC9B 1NGIA 2FSJA 1SAZA 3M5RA 4NO7A 5M1KA 4IO9L 2J4RA 4CBUA 5JVGL 4H0OA 2P9IA 2A5XA 3O5BA 4CI6A 4CZEA 5LJVA 4ILHA 2E2NA 3WQTA 3DXMB 5AQNA 1N8RO 4H03B 2E88A 3MN9A 3H6EA 3LDQA 2GX9A 1BU6O 3G25A 3ZX3A 2EWSA 3P39A 4FVUA 3ULEA 3J7ZO 3BEXA 3NVKA 3EO3A 3HRGA 3A5MC 4CZFA 4YORA 3TSUA 1BG3A 2RHKA 4U7BA 3RSEA 3IDHA 1QVFM 3RSEB 1KAYA 1YI2N 2V7ZA 3DJCA 3MK6A 2P9SA 4WQ4C 3ZX0A 4IOCL 2CGJA 5BN8A 1TUUA 4H0TB 5AZIB 4BRGA 3VEZA 1DEJA 1QQOA 4ISFA 2Q97A 3CJ1A 4CJ7A 1X3MA 3WEEA 5AZJB 5FPEA 3AY9A 2NRZA 4BC5A 5C12A 4IEEA 3VF4A 4DQ8A 4EHUA 3C7NA 3UKRA 3SAGA 1VQ9N 3TPQA 4CD1A 2A3ZA 4HWIA 2P9LB 1K73O 1YITN 2QTDA 3LDNA 3U4LA 5EXWA 3O9SA 4H5VA 3I8BA 1GLDG 3G6EN 1SQKA 1H1VA 1XC3A 5C2DA 3H46O 4O8KA 5AQJA 4AF1A 4CBXA 2QA4N 2W40A 1D4XA 4WF9L 3FZMA 3VOVA 1Y64A 4YOXA 4OPAA 1JCEA 3O9RA 4QS8A 5C0YA 4JHDB 3CCUN 4CZHA 4BR5A 5AFUA 4FPBA 4JK9A 5M1PA 3WQUA 5HOOA 3KWIA 4MDAA 3VEWA 4DCHA 3Q7BA 2WFBA 4JNEA 3WXIA 2W41A 2Q31A 1KAZA 4FPAA 5C2FA 1KXPA 3WT0A 2ASMA 3MDQA 3OBYA 3WEEB 4AM6A 1NJIO 5TKYA 2Q0UA 3MN7A 1YUWA 3EKUA 4A57A 3CF5L 4GY2B 4XH4A 3LDLA 2QW9A 4I6MB 1QHAA 3D6RA 4QS7A 5M1NA 3VGKA 4IOAL 4CBWA 2P9SB 2NRHA 1YHQN 3VETA 2QWMA 3E9OA 1W97L 2A42A 2ZJQL 3WXLA 5AQZA 2IIRA 4O5FA 4BRPA 3L0QA 4EFHA 1GLCG 1ATSA 1XUPO 1U2VB 3O9TA 3OW2M 3QFPA 4YDUA 1KQSM 2WBNA 4C23A 3MMVA 1VQKN 3OBWA 5AQVA 2VYPA 4RCHA 4OO1J 1ATRA 3SLCA 4BRHA 4CZIA 1RGIA 1TYQA 3U8XA 3O6WA 3CERA 3TSQA 2WC9A 3VEVA 3TU5A 1W2BM 3UB5A 4CZGA 5AQOA 3FR0A 4FWMA 3CCMN 1HLUA 2VCPA 2E2PA 1JJ2M 4GV3A 1NGDA 1HPMA 3MX5A 3ZETB 4A5BA 4CZMA 4GV6A 2FLOA 2AP1A 2KHOA 2FXUA 3O8MA 2D0PA 4PL8A 4MLHA 3PLAA 5M1QA 3I33A 2ASOA 3L6QA 3H1VX 1X9JA 3C0BA 2QXLA 3IMXA 4JD2B 1NLVA 3HOSA 1XQSC 1JCGA 2IVPA 5E26A 5BN9A 3Q7CA 3O4WA 2P9UB 4JKHA 3ENHA 1KD1O 4BRNA 3EZWA 4FWQA 1NWKA 4H0VB 4BR7A 4CZKA 3O1BA 2E2QA 3P4IA 3M6GA 3SK3A 4EIAA 2RE2A 2Q2RA 2HF3A 4IFEA 1RDWX 1NGAA 2OTJN 4XH5A 1T44A 1NGBA 3O9UA 3AGKA 2F7TA 4E1JA 5KPZA 3ATUA 1TYQB 3U9ZA 3F9MA 3PIPL 4GVEA 2H3GX 2JWLA 4FWPA 4WQ4A 1K9MO 2A40A 1BA0A 5GAHP 3CJ9A 3H3OB 3O9QA 3TSPA 1HJOA 3JS6A 3KWGA 5AZJA 3QDKA 3CCQN 2QWOA 3P31A 4QS9A 4IDHA 3IFRA 3ENBA 1MA9B 2I7PA 2CH5A 1Z05A 3H1QA 4BRDA 4U67L 5H1SQ 1GLJO 4BROA 1LOTB 1VQNN 4JKCA 4B1VA 2OANA 3QBXA 3LM2A 3SJHA 3CCEN 5JLFA 4H5TA 1V4TA 4BQLA 4IO8A 3SAFA 1VQMN 4NB4A 3CCVN 3QB0A 2GTDA 2ZGYA 4B1UB 2HBJA 2BTFA 4I6MA 1DGKN 3A5OC 4CD3A 2ZJRL 1ZBSA 4M63C 2P9NB 2E1ZA 5BPNA 3QMLA 4B1YB 4BC2A 3D2FA 3K9KA 2WUSA 5M1OA 3SMSA 5KPRA 1P90A 2YJFA 4KBOA 3SBTA 3CD6N 2UYTA 1NM1A 1U6ZA 3HSCA 1ZXOA 3ZX2A 5AQIA 5KQDA 4DHYA 3U9DA 3R6MA 1VQPN 3CJBA 3BF1A 5GIOA 5HL7L 5BPLA 2VGMA 4M7YA 4WQ5C 4PL7A 5KQ8A 4MLEA 5DM7L 3DXKA 4FOIA 1T6CA 2IVNA 3DXMA 4HTLA 4JKEA 3WXMB 3SAHA 4WFNL 4YOUA 2BH1A 2YCHA 3ID6A 5GAGP 2P9LA 4BR4A 5C10A 2ZGZA 3EKSA 1K8KB 5F2RA 2VGNA 4JHDA 5AQPA 3M1FA 5ELZA 5ADXA 5JLHA 5M1FA 2ZWHA 1ESVA 2NRXA 3CCLN 1GLFO 2F9WA 4FWSA 1NGGA 2ITMA 2I7NA 3UKUB 3MN6A 2Q1NA 3WXJA 3CCJN 4GV9A 4BQZA 4UY8O 3N4QA 3RVCA 4AM7A 4F9OA 3CJCA 2NZTA 4A2AA 4CZJA 4FOEA 4BRKA 1V4SA 1ZC6A 1BA1A 2YHWA 3L4IA 3A0IX 1E4FT 3LL3A 5AQTA 5AR0A 3EN9A 1OKJA 3LM9A 3GE1A 2NRTA 3E1YA 3T69A 2P9UA 3VPZA 2QWRA 4IWVA 3R3LA 1BWFO 4JKFA 4JD2A 5AFUH 1ILYA 2YHXA 3C6HA 3FZFA 5AQKA 1S72N 1YJ9N 4WFBL 3DLLL 2E2OA 3KZBA 5GADP 3K9JA 3E9PA 4YOYA 2IVOA 3H45C 3ZETA 3FLCO 4BRFA 5LY3A 1BOTO 3GOIA 2QEXN 1HUXA 4H0PA 3I55N 3MWTA 4BRCA 2A41A 3A5NC 4IOXA 4Y0WA 3W0LA 2P9NA 1RFQA 2P9KB 2BUPA 4BR0A 5AQFA 4WYBA 3CC4N 4PKHA 5EOYA 5TKWA 5F0XA 2P9PB 2P9PA 3L4QA 3CQYA 2PBDA 4J8FA 4B1XB 3TTDA 4B1ZA 3QICA 2P9IB 2QWPA 1BDGA 5ADXH 2FF3B 4WFAL 1BO5O 2P9KA 3CETA 4G9ZA 3FGUA 2FSNA 1VAZA 4H5WA 1BUPA 5EY4A 4IJAA 3MX2A 1NBWA 3GDQA 1T3VA 1JCFA 5FPNA 4B1WB 5C15A 5BREA 5JMVA 5AQUA 1GLLO 1U2VA 3KK7A 4BRAA 1VQ7N 3OA9A 3CCSN 3KHYA 2E1YA 2QWNA 2VWBA 1HX1A 5FPMA 2YJEA 3CJ7A 3ULEB 4DB3A 3ZEUB 2HF4A 4ILGB 3JXUA 5MLCQ 3T7ZA 4OPHA 4DKWA 3ATVA 1Z6RA 4FO0A 1GLBG 2QWQA 3DAWA 3ENOA 4FWKA 4ISGA 5KPTA 4RWTA 2A6AA 2D4WA 3FZHA 2FF6A 4PHTX 1VQ8N 3AGRA 3O1WA 4BR9A 2YI1A 4EHTA 1YVNA 1CZAN 1T6DA 3MCPA 3MCAB 3SMPA 2PFUA 3AAPA 4PKGA 3WXKA 3F2KA 4Z94A 1KC8O 3D2EA 1OVYA 2HBKA 4A2BA 5BRDA 1Q82O 4FWLA 1M1KO 3VF6A 5EX5A 3C6AA 1LCUA 1QZ5A 2JWKA 1EQYA 1G99A 1TUYA 3QBWA 1VQON 2AA4A 2FSKA 5AQWA 1HKCA 3E66A 4A61A 1YJNN 2NRVA 3M3ZA 5AQGA 2Q36A 3GL1A 2HSTA 5E84A 1E4GT 5AQRA 2E20A 1SZ2A 1VQLN 2HMPA 3VF2A 4WQ5A 4BGAA 3D2FB 1IJJA 4H5RA 4O8UA 1VQ5N 4FSVA 1NGEA 3CPEA 4K43A 4FWOA 5JVHL 2DPNA 1Q81O 4BRLA 3EL2A 3EE9A 3P38A 4K41A 4A59A 4B9QA 3CXCM 3HBTA 3VGLA 1EO1A 3BF3A 5BR9A 4BGBA 1YXQA 4CZLA 4XEIA 1MDUB 2GELA 4MO4A 3MWPA 3IUCA 1WOQA 3GBTA 1O13A 3AAQA 4R79A 4BR2A 5F1XA 2KKZA 5AQHA 3N4PA 2D0OA 4ISEA 3FFKB 2ASPA 3CMAN 4JKGB 1NMDA 4ILJA 3MN5A 4IJNA 4IZ9A 3VTHA 5I9EB 4H0YB 1S22A 4MO5A 3FZLA 4WCEL 2ZJPL 3A8YA 3AARA 3GG4A 4JN4A 2GWJA 3HZ6A 4C1NK 5EVZA 1GLEG 2E8AA 4JKGA 1NGFA 1X3NA 3FE1A 5BPMA 5JICA 1WUAA 3VEXA 1QVGM 3BUZB 3VTIA 4FWNA 4MDBA 2GUPA 3LDPA 1YAGA 3VESA 3D2EB 4BVOA 3BP8A 5AQLA 3HOTA 2V7YA 2HOEA 2NRWA 4KH6A 5LJWA 3E9LA 3IKMA 3CMEN 3CPWM 4NLCA 4JAXA 4YOTA 3UE5A 3VENA 3A5LC 1DKGD 3C7NB 3SBGA 3UKRB 3CC7N 1RDUA 4GNIA 5AQYA 1Q86O 2V52B 3WUHA 4H0XB 1Q18A 5AQMA 1ATNA 5AQQA 2KLAA 3CC2N 3DXKB 1C0FA 4RTFD 4BRIA 3QFUA 1YJWN 4JKDA 2HBLA 3C65A 4JKBA 1Q7YO 5AZIA 2ZF5O 4IEIA 3H3NO 2D1KA 1DT9A 3EE8A 4JKAA 3VGMA 4BY9C 3B8AX 3R1XA 2NLXA 2YX6A 4A62A 3PIOL 5GAEP 1QQMA 1GLAG 2V51B 5AQXA 1R59O 2QI2A 4BC3A 4BC4A 2OTLN 3ID8A 4PKIA 4H5NA 4NLBA 3R8EA 1HKBA 3CCRN 2CGKA 3O08A 2YHYA 3G4SN 3I56N 4A5AA 4K42A 3CQXA 3J8AA 4FL9A 2CH6A 4M7XA 1QQNA 3S41A 3VEOA 3VMFB 2F9TA 3OHRA 1P8ZA 5GIPA 1NGCA 1YIJN 5BRFA 5DM6L 4XH1A 1VQ4N 4JK7A 3O80A 1SS6A 4BREA 2QM1A 4BRQA 4YDUC 3HI0A 5AQSA 3NVMA 4BVPA 5FPDA 4JK8A 3CJAA 3ZEUA 4JEPA 3UKUA 1VQ6N 4C1NI 3G71N 3F5TA 1J6ZA 2PAVA 1K8KA 1NGHA 3HM8A 4YOVA 4FWRA 4L3QA 5CR4A 5B8HA 3ZYYX 1C0GA 3VEYA 5BRHA 3DWLA 5CHIA 1MWKA 4KH4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UY8 O;  1VQK N;  1VQ5 N;  5JVH L;  1Q81 O;  3CXC M;  1W2B M;  3CCM N;  1JJ2 M;  1K8A O;  1M90 O;  1ILY A;  1S72 N;  1YJ9 N;  4WFB L;  3DLL L;  5GAD P;  3CMA N;  1Q86 O;  4IO9 L;  5JVG L;  2ZJP L;  4WCE L;  2QEX N;  1N8R O;  1KD1 O;  3I55 N;  3J7Z O;  1QVG M;  3CC4 N;  1QVF M;  1YI2 N;  2OTJ N;  4WFA L;  3CME N;  3CPW M;  4IOC L;  3PIP L;  3CC7 N;  1K9M O;  5GAH P;  3CC2 N;  3CCQ N;  1YJW N;  1Q7Y O;  1VQ7 N;  1VQ9 N;  3CCS N;  1K73 O;  4U67 L;  1YIT N;  5H1S Q;  1VQN N;  3G6E N;  3CCE N;  3PIO L;  1VQM N;  5GAE P;  2QA4 N;  5MLC Q;  3CCV N;  4WF9 L;  2OTL N;  2ZJR L;  3CCU N;  3CCR N;  3G4S N;  3I56 N;  1VQ8 N;  3CD6 N;  1NJI O;  1YIJ N;  1KC8 O;  1OVY A;  5DM6 L;  3CF5 L;  1M1K O;  1Q82 O;  1VQ4 N;  1VQP N;  4IOA L;  5HL7 L;  1YHQ N;  5DM7 L;  4WFN L;  1VQO N;  1VQ6 N;  2ZJQ L;  3G71 N;  5GAG P;  1YJN N;  3CCL N;  1VQL N;  3OW2 M;  1KQS M;  3CCJ N; 
#chains in the Genus database with same CATH topology
 1WSE A;  3ZT3 A;  1U47 A;  2GWK A;  3R9P A;  1TAU A;  4YOW A;  2RN2 A;  1D9D A;  1OVQ A;  1QZ6 A;  1M90 O;  3CI5 A;  2HMI A;  4M42 A;  4BG9 A;  3V9S A;  5CE3 A;  3TTF A;  4GW6 A;  1NGJ A;  3M8P A;  4DR5 K;  1NGI A;  2FSJ A;  1SAZ A;  5M1K A;  1Q86 O;  4B9T A;  4M3T A;  2A5X A;  3E01 A;  1RDA A;  3OJS A;  5HRP A;  3DXM B;  4LSN A;  4Z4G A;  1N8R O;  4H03 B;  2E88 A;  2YKN A;  3G25 A;  3ZX3 A;  3OTO K;  1N32 K;  4Y1D A;  3ULE A;  3J7Z O;  4FLW A;  4DTU A;  4CW7 B;  3OYF A;  4CZF A;  3RWU A;  3V9X A;  2RHK A;  1QVF M;  3RSE A;  3IDH A;  3J7A P;  4V19 S;  3DJC A;  3MK6 A;  2P9S A;  1ASU A;  3AO4 A;  3LWL A;  3DRR A;  4FLV A;  3T3F A;  2CGJ A;  4ZHR A;  4BRG A;  5DK5 A;  3CJ1 A;  3S3O A;  1NOY A;  3ULD A;  4BC5 A;  1CXQ A;  4MFB A;  1DTT A;  4DFP A;  4CJQ A;  2RKI A;  3S3M A;  4LF4 K;  3O9S A;  1I39 A;  4H5V A;  3I8B A;  4KHS A;  1SQK A;  3H46 O;  4CBX A;  3DLE A;  2F96 A;  1L3S A;  1JCE A;  5C0Y A;  4JYA K;  4JHD B;  3CCU N;  4IKF A;  2D5R A;  4BR5 A;  5AFU A;  4I9Q A;  4JK9 A;  5HOO A;  4LF8 K;  1EET A;  3VEW A;  1HNX K;  3Q7B A;  1KLM A;  4JNE A;  2IC3 A;  1RCH A;  1KAZ A;  5C2F A;  5HRS A;  1XHX A;  3WEE B;  1RDC A;  4ELU A;  5TKY A;  2Q0U A;  4JS5 A;  4FJI A;  3MN7 A;  2E4L A;  4AHR A;  4XH4 A;  1T7P A;  4I6M B;  4IOA L;  3VGK A;  5FRO A;  4CBW A;  2EHG A;  3VET A;  3WXL A;  3SUO A;  4FJJ A;  1O1W A;  2IIR A;  4DSL A;  4O5F A;  3JAM O;  3ZLJ A;  1GLC G;  4DFM A;  3O9T A;  3QFP A;  4YDU A;  4C23 A;  1Z26 A;  1B92 A;  3OBW A;  5J2Q A;  4FK4 A;  3NBP A;  3TU5 A;  5AQO A;  3FR0 A;  1KVA A;  3HVT A;  4FWM A;  1HLU A;  1JJ2 M;  1NGD A;  1HPM A;  4LF7 K;  1S1X A;  2KHO A;  4IG0 A;  3O8M A;  4PL8 A;  4MLH A;  3I33 A;  3L2V A;  1X9J A;  1EKE A;  3C0B A;  3IMX A;  5KTQ A;  4EP5 A;  1JCG A;  4RW9 A;  3O4W A;  3ENH A;  1KD1 O;  4AHS A;  3EZW A;  4FWQ A;  4J2E A;  4PWD A;  4H0V B;  4DSK A;  4BR7 A;  4CZK A;  1VSJ A;  3P4I A;  4EIA A;  3UIQ A;  2KFN A;  2HF3 A;  4IFE A;  1RDW X;  2IGI A;  1WAJ A;  1T03 A;  1RDB A;  4XH5 A;  3PUF A;  3O9U A;  1NGB A;  3P5J A;  4CFD A;  1HRH A;  2FBX A;  1TYQ B;  1KFS A;  2QK9 A;  4GVE A;  2JWL A;  4LF6 K;  4M3Y A;  3K0S A;  4LH5 A;  1BA0 A;  3CJ9 A;  3O9Q A;  3OYE A;  1YT3 A;  1HJO A;  3F73 A;  2FBY A;  1RT6 A;  5AZJ A;  4OPK A;  3QDK A;  2QWO A;  4DFK A;  4KFB A;  3ENB A;  1MA9 B;  1IO2 A;  2CH5 A;  4U67 L;  3QEI A;  4LH4 A;  1WB9 A;  4B1V A;  2OAN A;  3SJH A;  4H5T A;  1V4T A;  3AVM A;  4L8R B;  4CD3 A;  4KAZ A;  4FZZ A;  5BPN A;  3SUQ A;  4CJ3 A;  1KRP A;  2D0A A;  3D2F A;  3K9K A;  2WUS A;  3SMS A;  2YJF A;  2UYT A;  3CM5 A;  4FJ8 A;  1CXU A;  5HRR A;  4DHY A;  1ITG A;  3U9D A;  3R6M A;  4EZ6 A;  5GIO A;  5HL7 L;  5BPL A;  1RBU A;  2IVN A;  3THW A;  5DMR A;  3SAH A;  3K5L A;  4YOU A;  5GAG P;  5C10 A;  2ZGZ A;  1K8K B;  4NCB A;  4JHD A;  3M1F A;  2ZWH A;  2UXD K;  2NRX A;  3CCL N;  1GLF O;  2F9W A;  4GV9 A;  3CCJ N;  4RW8 A;  4M41 A;  1UA0 A;  3I0R A;  4OX9 K;  3CJC A;  4A2A A;  4BRK A;  2YHW A;  3L4I A;  5AQT A;  3EN9 A;  3LM9 A;  3TAF A;  3GE1 A;  4F3O A;  4FYD A;  3B6P A;  4BAC A;  1SL2 A;  3VQ8 A;  5AFU H;  3H08 A;  3FZF A;  3DLL L;  4B9V A;  5GAD P;  4DF8 A;  1N6Q A;  2KZZ A;  2IVO A;  4O5B A;  4YHH K;  4IG3 A;  4BRF A;  1BOT O;  5CZ1 A;  2JLE A;  4E1N A;  4B8A B;  3A5N C;  1TKD A;  1RFQ A;  2P9K B;  5AQF A;  3HYF A;  5J2N A;  1NK4 A;  4PKH A;  1A5X A;  3L4Q A;  1G15 A;  2PBD A;  4J8F A;  5ADX H;  1BDG A;  2FF3 B;  2WOM A;  3T1Y K;  2P9K A;  4G9Z A;  3OY9 A;  1VAZ A;  3ALY A;  3LDS A;  3P83 D;  3A2F A;  4B1W B;  4UQG A;  1LW0 A;  1LAW A;  4F4K A;  3PSF A;  4Z4F A;  3RR8 A;  2LSN A;  1LWF A;  2E1Y A;  3KHY A;  4KTZ A;  1XMQ K;  2O8D B;  5FPM A;  2YHA A;  3CJ7 A;  4DLE A;  4DB3 A;  5KI6 A;  1HYZ A;  1FKO A;  2X6S A;  3T7Z A;  2OPQ A;  3ATV A;  2QWQ A;  3DAW A;  3AVG A;  4RWT A;  3OS0 A;  2D4W A;  4BR9 A;  1HNZ K;  2YI1 A;  1YVN A;  3MCP A;  3MCA B;  3AAP A;  5SWM A;  4PKG A;  4AHU A;  1S1T A;  1KC8 O;  4KHP K;  4DTR A;  4DQR A;  3L2R A;  1UWB A;  3QBW A;  3HPO A;  1VQO N;  5HBM A;  2Z1G A;  3NDK A;  5CYM A;  1YJN N;  1BIU A;  4KB1 A;  3ZSV A;  5AQG A;  3TWH A;  4JV5 K;  3G0Z A;  5AQR A;  5IT9 O;  5FLX O;  3D2F B;  4RW4 A;  4F2R A;  4JLH A;  4CHY A;  3L8B A;  3KLG A;  1Q81 O;  1IBM K;  4CGH A;  1HJR A;  3EE9 A;  3P38 A;  2HHX A;  1JKH A;  3HBT A;  3VGL A;  5BR9 A;  4XEI A;  3OJU A;  3AVI A;  3AAQ A;  3AVF A;  2D0O A;  3CMA N;  4CJR A;  4IZ9 A;  2IAJ A;  4MQ3 A;  1S22 A;  2G8U A;  3FZL A;  3A8Y A;  1UOC A;  4E7J A;  3AVL A;  4EZ9 A;  1NGF A;  3FE1 A;  5JIC A;  3BUZ B;  4FWN A;  4MDB A;  4FLX A;  3LDP A;  3LPU A;  4BVO A;  3AVC A;  2V7Y A;  2HOE A;  3E9L A;  2JGU A;  4NLC A;  4DV0 K;  3UE5 A;  2YNH A;  1DKG D;  3C7N B;  4KO0 A;  4B9N A;  3WUH A;  4CF0 A;  1ATN A;  1NK5 A;  4LY7 A;  4LFB K;  1NK9 A;  3QFU A;  1Q7Y O;  4FW1 A;  4OJR A;  2OCE A;  4KB0 A;  2D1K A;  4CHZ A;  1DT9 A;  4DTS A;  3EE8 A;  4JKA A;  3B8A X;  1HMV A;  3QEX A;  4HUE A;  3PIO L;  4JI0 K;  5GAE P;  1GLA G;  3OYA A;  2HVI A;  3KJV A;  1HKB A;  3CCR N;  3AA5 X;  1QSS A;  4JS4 A;  3VQQ A;  3DLR A;  4M7X A;  1QQN A;  3VEO A;  4E7L A;  1ZBH A;  4NCG A;  1P8Z A;  5GIP A;  3IRX A;  3SZ2 A;  1YIJ N;  4OLA A;  5DM6 L;  4JK7 A;  1D8Y A;  3O80 A;  2A1S A;  1SS6 A;  4BRQ A;  5HRN A;  4BVP A;  3ZEU A;  4JEP A;  3WNE A;  2RF2 A;  3G71 N;  3V9Z A;  2BAN A;  4CJ5 A;  3G10 A;  4ZTJ A;  5JS2 A;  4OGE A;  2UUA K;  3SPY A;  1NJZ A;  4FJN A;  3ZYY X;  1A5W A;  1C0G A;  5BRH A;  4FVM A;  3SLC A;  1C0M A;  2CGL A;  3J81 O;  4O44 A;  2KFZ A;  3DYA A;  3VER A;  4IXC A;  2NNW A;  4BE2 A;  4BG8 A;  3RMB A;  3SV3 A;  5GIN A;  3D7E O;  1TVR A;  1LAV A;  1S3X A;  4G1Q A;  4KTW A;  4B08 A;  2G8W A;  3MEG A;  3VA0 A;  1L5U A;  3IG1 A;  3TTC A;  3BZK A;  2UXC K;  3DMJ A;  5KRT A;  3M5R A;  4CBU A;  4GMJ B;  2P9I A;  5HRO A;  3O5B A;  4CZE A;  1BCM A;  5LJV A;  3WQT A;  2VG7 A;  1QHT A;  3MN9 A;  2GX9 A;  1HR0 K;  3KD5 E;  3P39 A;  2OPP A;  1S1V A;  3EO3 A;  3HRG A;  2OA8 A;  4NXN K;  4PY5 A;  1J54 A;  3THX B;  4YY3 K;  5LMN K;  3ZX0 A;  4DV7 K;  4KHQ A;  4IOC L;  5FDL A;  1TUU A;  1IBK K;  3VEZ A;  1QQO A;  3DLB A;  1NKE A;  2E5L K;  1NOZ A;  4N56 A;  3WEE A;  4DR2 K;  4IEE A;  3VF4 A;  4DQ8 A;  1X9M A;  1KTQ A;  3QLH A;  3UKR A;  3SAG A;  1VQ9 N;  4CD1 A;  4FLZ A;  4HWI A;  2P9L B;  1YIT N;  3LDN A;  3ZT1 A;  1B9D A;  1H1V A;  1XC3 A;  2HVH A;  4O8K A;  5AQJ A;  3FZM A;  3VOV A;  5HP1 A;  4OPA A;  3WQU A;  4DCH A;  5FRN A;  3WXI A;  2W41 A;  4CES A;  4FPA A;  3IAY A;  3PX0 A;  1WSI A;  1XHZ A;  1IKW A;  4DTO A;  1NJI O;  3KKR A;  1YUW A;  3NGZ A;  2HHS A;  4GY2 B;  4JI7 K;  1BIZ A;  1W0H A;  5M1N A;  4BE0 A;  2P9S B;  3NH0 A;  2NRH A;  1WSF A;  2A42 A;  4F3T A;  2ZJQ L;  3VQ4 A;  3K58 A;  4BRP A;  4W5Q A;  1JLA A;  1L3T A;  1ATS A;  1XUP O;  2FBV A;  2WBN A;  1WLJ A;  1VQK N;  4DU1 A;  1ATR A;  4BRH A;  3D0P A;  1IKV A;  4JI3 K;  2F8T A;  1EWR A;  3CER A;  3T1H K;  3TSQ A;  1W2B M;  3VQ9 A;  2VCP A;  2X6N A;  2E2P A;  3OYG A;  3C95 A;  1J5E K;  2O8C B;  3MX5 A;  4CZM A;  4RG8 A;  4KHN A;  4CJF A;  5M1Q A;  3BDP A;  2ASO A;  2O8F A;  4HCB A;  2F8S A;  2IVP A;  2W42 A;  3Q7C A;  4JKH A;  4K8X A;  1EP4 A;  1NWK A;  2D0C A;  3C94 A;  4JI6 K;  3M6G A;  3SK3 A;  1GOC A;  4JI5 K;  4OLB A;  3O4Q A;  5I3U A;  2HND A;  4E1M A;  1T44 A;  4NXM K;  5KGW A;  2G8H A;  3ATU A;  3F9M A;  3PIP L;  2H3G X;  4FZX C;  4FWP A;  2A40 A;  5GAH P;  3H3O B;  3TSP A;  1RTH A;  3ZT0 A;  3KWG A;  3AVK A;  3CG7 A;  3HL8 A;  4X66 K;  3P31 A;  4QS9 A;  4IDH A;  2I7P A;  2NUB A;  3H1Q A;  1Z05 A;  4M3R A;  4BRD A;  3RR7 A;  1VQN N;  4KRF A;  3QBX A;  3KLI A;  4BQL A;  1VQM N;  3CCV N;  4J2B A;  4DV6 K;  4B1U B;  4F8R A;  2BTF A;  1KVC A;  4FJ9 A;  1ZBS A;  2E1Z A;  4BC2 A;  1W7A A;  4C8N A;  1S6Q A;  4CFC A;  1XWL A;  1P90 A;  3O4N A;  3SBT A;  2P1J A;  3THY B;  1ZXO A;  1RTJ A;  5AQI A;  3CYM A;  3VQ6 A;  1QS4 A;  3P1G A;  3SJJ A;  1NNE A;  1BGX T;  3BF1 A;  2BGG A;  4WQ5 C;  4MLE A;  5DM7 L;  1TK0 A;  4JKE A;  3WXM B;  4LFC K;  2P9L A;  3QEV A;  1SKW A;  5F2R A;  2VGN A;  4DR7 K;  5ELZ A;  1IBL K;  3UKU B;  4QAG A;  2I7N A;  3HST B;  4UY8 O;  3N4Q A;  3RVC A;  1V4S A;  1ZC6 A;  2PZS A;  1SUQ A;  4B3S K;  4FLU A;  2NRT A;  4E7K A;  1TKT A;  3VPZ A;  3V9W A;  2QWR A;  1HYS A;  4GKJ K;  3PX4 A;  1YJ9 N;  2QXF A;  4I7F A;  4DLG A;  2DY4 A;  3SUP A;  3K9J A;  2YNG A;  3E9P A;  4CEA A;  4CE9 A;  3H45 C;  1S6P A;  1NJY A;  3VQ5 A;  4Q5V A;  1HUX A;  1TK8 A;  4DTN A;  3W0L A;  4IOX A;  3NH2 A;  5EOY A;  3PX6 A;  5F0X A;  4H8K A;  3KKS A;  1RIL A;  3QIC A;  4KV8 A;  3CQ8 A;  1TL1 A;  1BUP A;  5EY4 A;  1C1B A;  4IJA A;  4M3W A;  3MX2 A;  3GDQ A;  1KSP A;  1T3V A;  1L3V A;  5FPN A;  5C15 A;  4DS5 A;  5BRE A;  1E3M A;  1U2V A;  3KK7 A;  4BRA A;  1N34 K;  2HHH K;  4K0K K;  2YJE A;  3ULE B;  1VSE A;  2HF4 A;  2YKM A;  4ILG B;  5MLC Q;  4OPH A;  4CK3 A;  4N41 A;  3ENO A;  4ISG A;  3FZH A;  2FF6 A;  4CHO A;  1VQ8 N;  1TKX A;  1T6D A;  3KK2 A;  3WXK A;  3ZSQ A;  3F2K A;  1HNW K;  4B3T K;  2HBK A;  1C0T A;  1U4B A;  4CF9 A;  1M1K O;  2G8F A;  4FWL A;  3V1R A;  4IFV A;  3AVA A;  3WNH A;  3NF8 A;  1J53 A;  3LWM A;  2FSK A;  5AQW A;  1HKC A;  4A61 A;  1CZ9 A;  3DOK A;  3IS9 A;  2VWJ A;  1R0A A;  2PYL A;  1QSY A;  2E6M A;  2HST A;  1BQN A;  1E4G T;  2EX3 A;  4DUY K;  1SZ2 A;  3MEE A;  2HMP A;  1FJG K;  3SI6 A;  1IJJ A;  4H5R A;  4O8U A;  3KLF A;  3LP1 A;  5JVH L;  2DPN A;  4BRL A;  4B9Q A;  1BI4 A;  4K41 A;  2AJQ A;  4CZL A;  4MO4 A;  3MWP A;  4FJ5 A;  1QE1 A;  1WOQ A;  3BGR A;  3GBT A;  2HHQ A;  1SL0 A;  4CJW A;  3K57 A;  2W6K A;  3N4P A;  3FFK B;  1NMD A;  2VQE K;  4IJN A;  3ZSY A;  1VSM A;  2FC0 A;  3L2Q A;  4F2S A;  3QIO A;  4MO5 A;  4WCE L;  2YNF A;  3AAR A;  3GG4 A;  1C1A A;  4BWM A;  4C1N K;  1BQM A;  2G8K A;  5EVZ A;  2X74 A;  4DQP A;  1MU2 A;  3VEX A;  2VWK A;  1QVG M;  4CK1 A;  3EYZ A;  1X9S A;  1EWQ A;  3BP8 A;  3KIO A;  5FRM A;  2DFE A;  4CEQ A;  4JAX A;  4O0I A;  4BE1 A;  3A5L C;  4DSJ A;  3UKR B;  1RT5 A;  5AQY A;  2V52 B;  4H0X B;  5AQQ A;  2O8C A;  1C0F A;  4RTF D;  5A2Q O;  4JKB A;  3EY1 A;  2F4V K;  4CEC A;  3WNG A;  4FJX A;  4M3X A;  4DV5 K;  1N5Y A;  2NLX A;  3MAQ A;  2B4J A;  1R59 O;  4H4M A;  4HTU A;  4BC4 A;  3OS2 A;  4GVM A;  4H5N A;  3LP2 A;  4C8L A;  2WON A;  3U3Y A;  3PV8 A;  3WNF A;  1S1W A;  1UAX A;  4OVL A;  3S41 A;  4DF4 A;  3L2W A;  4KRE A;  1NGC A;  4CJK A;  1NK6 A;  2HHV A;  4YDU C;  3QER A;  2HHT A;  1T8E A;  4KPY A;  1A5V A;  1XI1 A;  1JLB A;  4DSF A;  2PAV A;  1K8K A;  4PQU A;  3DI6 A;  4L3Q A;  2D0B A;  5B8H A;  1LWC A;  3NF7 A;  3VEY A;  4CF2 A;  3DWL A;  3LZI A;  3THW B;  1MWK A;  3SPZ A;  4Z4I A;  3CM6 A;  3QES A;  2Y1J A;  2Q0R A;  2DFH A;  1RBS A;  4N76 A;  2IS3 A;  3FZK A;  1RT2 A;  1IG8 A;  3L3V A;  3CHW A;  3JSM A;  4K25 A;  1K8A O;  3KD1 E;  3HXM A;  1HQE A;  2IOC A;  3VN5 A;  2NRR A;  4KI4 A;  4Z4E A;  2GEM A;  4LC9 B;  4DG1 A;  4NO7 A;  4QOZ B;  5JVG L;  4H0O A;  5J2P A;  4CI6 A;  3THY A;  1VSK A;  4ILH A;  2E2N A;  5AQN A;  4NYN A;  3H6E A;  2BE2 A;  3LDQ A;  2DFF A;  1VRU A;  1J9A A;  3NVK A;  1U45 A;  1JLE A;  4YOR A;  2VQF K;  1IKY A;  1BG3 A;  3RSE B;  1KAY A;  4RW6 A;  4AHC A;  1YI2 N;  3O3H A;  1RBV A;  2O8E A;  1BI4 B;  1VRT A;  1DEJ A;  4ISF A;  4QCL A;  4CJ7 A;  1S1U A;  1X3M A;  4FM2 A;  5FPE A;  3AY9 A;  3D45 A;  5C12 A;  4CJP A;  1ZBF A;  3DLG A;  4EHU A;  3C7N A;  1YTA A;  1K73 O;  1ASV A;  2QTD A;  3U4L A;  4HVJ A;  3NF9 A;  1SKS A;  1D4X A;  4QS8 A;  3O9R A;  4CJ4 A;  2Z1H A;  4CZH A;  4FPB A;  5SZT A;  3KWI A;  1NKC A;  2Q31 A;  1KXP A;  3WT0 A;  2ASM A;  1RT3 A;  3OBY A;  1WBB A;  3DRS A;  4AM6 A;  3J80 O;  3OYB A;  4FJL A;  4A57 A;  3HK2 A;  2QW9 A;  1QHA A;  4QS7 A;  4OPJ A;  1L3U A;  1Z25 A;  2QWM A;  3E9O A;  1U48 A;  3LAN A;  5C24 A;  4CHQ A;  4EFH A;  3MXM A;  5D3G A;  3HO1 A;  1QQC A;  1U2V B;  3MMV A;  4DUZ K;  1BHL A;  1WSH A;  5AQV A;  3ISN C;  2VYP A;  4OO1 J;  4CZI A;  4CJE A;  1RGI A;  3U8X A;  4B3M K;  1C1C A;  2FBT A;  3KK3 A;  2WC9 A;  5KRS A;  4XIU A;  3O3F A;  1EXQ A;  3UB5 A;  4CZG A;  1SV5 A;  3CCM N;  3VQP A;  4GV3 A;  4RW7 A;  2B6A A;  4CIF A;  4YNQ A;  4N5S A;  4CEE A;  2AP1 A;  4CCH A;  2B5J A;  3TAB A;  4HUG A;  3L6Q A;  3H1V X;  2KZM A;  2QXL A;  4JD2 B;  3HOS A;  1XQS C;  4AHV A;  5BR8 K;  1CLQ A;  4W5T A;  4BRN A;  1NMN A;  3S3N A;  3HPG A;  4AIL C;  3OYD A;  4CHP A;  2RE2 A;  2Q2R A;  2GBZ A;  3B6O A;  1NGA A;  2I5J A;  1U04 A;  2OTJ N;  3AGK A;  3CFO A;  1JLG A;  2F7T A;  4E1J A;  5KPZ A;  3U9Z A;  3LAK A;  2O4I A;  4DWI A;  4WQ4 A;  1K9M O;  4FJH A;  4EP4 A;  1FK9 A;  4BDP A;  2Z1J A;  3HP9 A;  3CCQ N;  4DQI A;  1VK0 A;  3IFR A;  1HQU A;  3DLK A;  4BRO A;  1LOT B;  4JKC A;  3RRG A;  3CCE N;  4NB4 A;  4DR1 K;  3QB0 A;  2ZJR L;  4M63 C;  1UA1 A;  4W5O A;  2HNY A;  3CD6 N;  1F21 A;  4CGD A;  4KBO A;  2XY6 A;  2HW3 A;  3ZX2 A;  2XHB A;  4H4O A;  5KGX A;  3C6U A;  4IBN A;  3CJB A;  4DTJ A;  4M7Y A;  3K5O A;  2P5O A;  3M8S A;  3DXK A;  4FOI A;  1HPZ A;  4CEZ A;  1KFD A;  4HTL A;  3TAR A;  1N36 K;  5E41 A;  4Z0U A;  2BH1 A;  3PY8 A;  4BR4 A;  5AQP A;  5ADX A;  5JLH A;  2P51 A;  4CEO A;  2ITM A;  1BL3 A;  4DS4 A;  1Q9Y A;  4CZJ A;  2NZT A;  2WTU A;  1GOB A;  4FOE A;  4LF9 K;  4BWJ A;  2G8V A;  5AR0 A;  3LL3 A;  1OKJ A;  3EEQ A;  3E1Y A;  3T69 A;  4DR4 K;  2P9U A;  4IWV A;  1C0U A;  1BWF O;  3ZT2 A;  4CJS A;  3SQ0 A;  1ILY A;  3C6H A;  5AQK A;  3CFR A;  1S72 N;  1GOA A;  3LZJ A;  4DSI A;  4DFJ A;  4X65 K;  3U3G A;  2PYJ A;  3JYT A;  4H0P A;  3HP6 A;  2P5G A;  3LAL A;  3C6T A;  3RMC A;  2A41 A;  4Y0W A;  3THV A;  2BUP A;  1SKR A;  4WYB A;  3CC4 N;  1N33 K;  5TKW A;  2P9P B;  2P9P A;  1T05 A;  3CQY A;  4DU3 A;  4B1X B;  3TTD A;  3NCI A;  1Y97 A;  2P9I B;  3V4I A;  1BO5 O;  4B9S A;  3FGU A;  4H5W A;  1I94 K;  1IKX A;  1IV0 A;  1JCF A;  4NYF A;  5AQU A;  1VQ7 N;  1HYV A;  3OA9 A;  3ZSW A;  3CCS N;  1C6V A;  4AH9 A;  2W6L A;  3TI0 A;  2QWN A;  3SQ1 A;  3ZEU B;  3SV4 A;  3SQ4 A;  3JXU A;  2Q3S A;  4PA1 A;  2QKB A;  4X62 K;  1Z6R A;  4FO0 A;  1GLB G;  4M45 A;  2A6A A;  4CJU A;  4E89 A;  3ZSZ A;  4DQS A;  1NJX A;  1LW2 A;  4EHT A;  1CZA N;  1S9E A;  2PFU A;  4O4G A;  4Z94 A;  1JLQ A;  2O8E B;  5BRD A;  1Q82 O;  4BDY A;  2R7Y A;  2UU9 K;  3CFP A;  4JI1 K;  5EX5 A;  3C6A A;  1LCU A;  1QZ5 A;  2JWK A;  2OZS A;  1G99 A;  1TUY A;  2AA4 A;  1ZBU A;  3E66 A;  4J2D A;  4E3S A;  1OH8 A;  2NRV A;  2Q36 A;  3GL1 A;  2E20 A;  3VF2 A;  1IH7 A;  1JXB A;  2RPI A;  1ZBI A;  1XMO K;  2HHW A;  4Z4C A;  4CJT A;  3AA2 A;  3EL2 A;  4FJM A;  3CXC M;  4A59 A;  4BGB A;  4DV3 K;  1O13 A;  4R79 A;  1DLO A;  2KKZ A;  5AQH A;  4ISE A;  5EU7 A;  2PY5 A;  2ASP A;  4ILJ A;  3MN5 A;  5J1E A;  4KTQ A;  2ZJP L;  1FW6 A;  4JN4 A;  3HZ6 A;  5BPM A;  4FK2 A;  1WUA A;  4DV4 K;  4HUF A;  3VTI A;  2GUP A;  4I9L A;  1YAG A;  3VES A;  4DR3 K;  1RTI A;  1NG9 A;  2NRW A;  4KH6 A;  3AA3 A;  3CME N;  3IKM A;  2O8F B;  4TSX A;  3VEN A;  3SBG A;  3CC7 N;  2OYQ A;  3I0S A;  4GNI A;  1JLF A;  3LP0 A;  1Q18 A;  1S9G A;  2XY8 A;  1X9W A;  1K6Y A;  3TAP A;  1HNI A;  4BRI A;  1WBD A;  1VSD A;  2XRI A;  3C65 A;  2HNZ A;  4W5R A;  2ZF5 O;  1RT1 A;  3KLE A;  3NGI A;  1XNR K;  1RBT A;  4FJK A;  4BY9 C;  3R1X A;  3OS1 A;  3MED A;  4BC3 A;  2OTL N;  3ID8 A;  3MXI A;  5CYQ A;  3O08 A;  3G4S N;  3VA3 A;  3I56 N;  4K42 A;  1X1P A;  3CQX A;  3J8A A;  2YNI A;  4CEB A;  2CH6 A;  3SYZ A;  4E0D A;  3VMF B;  3OYN A;  2F9T A;  1DTQ A;  3OHR A;  3DLH A;  1Q9X A;  4K8Z A;  4CGG A;  3K59 A;  2QM1 A;  3PO4 A;  3HI0 A;  5AQS A;  3CJA A;  3PO5 A;  1VQ6 N;  4OKE A;  3OYJ A;  1JL2 A;  1NGH A;  4HCC A;  4E7H A;  2DTU A;  5CR4 A;  4I2P A;  4ICL A;  3OYM A;  4CGF A;  3PSI A;  2QWL A;  2ZE2 A;  1NU0 A;  3HM9 A;  4CF8 A;  4KH5 A;  2HBM A;  3KVG A;  5JS1 A;  2VG6 A;  4X64 K;  3M8R A;  1KAX A;  3NMU A;  4PUO A;  3HTV A;  3W3D A;  1KLN A;  1MWM A;  3CIP A;  2ZQB A;  4BRM A;  1YF5 L;  1HKG A;  4EAH D;  3LDO A;  3AVJ A;  4M3U A;  4IO9 L;  2J4R A;  4KI6 A;  2O8B B;  4ELT A;  3THX A;  4C8O A;  3NGY A;  1BU6 O;  3AO3 A;  3KTQ A;  2EWS A;  4FVU A;  3BEX A;  4ID1 A;  4Q0B A;  5J2M A;  3A5M C;  3TSU A;  4U7B A;  4CIE A;  4JRP A;  2V7Z A;  4WQ4 C;  1ZYQ A;  5BN8 A;  4CFB A;  3TAN A;  2E6L A;  4H0T B;  5AZI B;  1LWE A;  2Q97 A;  3RMA A;  2VG5 A;  2GUI A;  5AZJ B;  2NRZ A;  4C8M A;  1VSL A;  4E7I A;  1VSF A;  1ZBL A;  4JI4 K;  1VSI A;  3TPQ A;  2A3Z A;  1WAF A;  5EXW A;  4DTX A;  1VHX A;  1GLD G;  3G6E N;  3NHG A;  5C2D A;  2UUB K;  1OH6 A;  4AF1 A;  3VQD A;  2QA4 N;  2W40 A;  4WF9 L;  4YOX A;  1Y64 A;  4FXD A;  4E19 A;  5LMU K;  3AVN A;  4N47 A;  5M1P A;  4MDA A;  2WFB A;  1JL1 A;  4CK2 A;  3SUN A;  3MDQ A;  3RMD A;  4B9M A;  4DTP A;  3HT3 A;  3L2U A;  3EKU A;  3CF5 L;  3LPT A;  3LDL A;  4DSE A;  3D6R A;  3M8Q A;  2Z1I A;  1YHQ N;  3HPH A;  1OH5 A;  1W97 L;  3SQ2 A;  3AO2 A;  5AQZ A;  3NF6 A;  3L0Q A;  1D5A A;  2KQ2 A;  1S5J A;  3RRH A;  2X78 A;  3NH1 A;  3OW2 M;  1KQS M;  1W9H A;  1U49 A;  3KK1 A;  4CF1 A;  4FLT A;  4IDK A;  4RCH A;  4M3Z A;  1RDD A;  2GV9 A;  1TYQ A;  4CHN A;  3O6W A;  3VEV A;  4DMN A;  4FM0 A;  4CVN E;  3ZET B;  4A5B A;  4KHW A;  4GV6 A;  2FLO A;  1CZB A;  2FXU A;  2D0P A;  3PLA A;  3DM2 A;  4B3O A;  4AHT A;  2KW4 A;  1RT7 A;  1TV6 A;  2XO7 A;  3QIN A;  4YFU A;  1NLV A;  3TAQ A;  5BN9 A;  5E26 A;  4R5P A;  4FJG A;  2P9U B;  3BZC A;  4DQQ A;  3F9K A;  5C25 A;  3O1B A;  4W5N A;  2E2Q A;  3ZT4 A;  1Q8I A;  4I2Q A;  2Y1I A;  4FLY A;  1WSG A;  4B9U A;  3K2P A;  1EX4 A;  3V1O A;  3ASM A;  3K5N A;  4HHT A;  4AQY K;  1QSL A;  4FM1 A;  3JS6 A;  1TK5 A;  1NK8 A;  4CJV A;  3ZSR A;  2O8D A;  3K5M A;  2OZM A;  5H1S Q;  2ZD1 A;  3HJF A;  1GLJ O;  4CED A;  3LM2 A;  5JLF A;  5CY4 A;  3SAF A;  4DR6 K;  3QO9 A;  4IO8 A;  2O8B A;  2GTD A;  2ZGY A;  3V6D A;  2HBJ A;  4I6M A;  1DGK N;  3A5O C;  4DU4 A;  2P9N B;  3QML A;  4B1Y B;  2QKK A;  3AO5 A;  4DTM A;  3LP3 A;  5KPR A;  5M1O A;  3OYI A;  1KVB A;  1NM1 A;  1U6Z A;  3HSC A;  5KQD A;  4CGJ A;  1VQP N;  3TAM A;  2VGM A;  4LF5 K;  4PL7 A;  5KQ8 A;  3VQE A;  4CIG A;  4WFN L;  1T6C A;  3DXM A;  2YCH A;  3ID6 A;  3L3U A;  4C8K A;  3EKS A;  5CZ2 A;  4FZY A;  3VQC A;  5M1F A;  3DOL A;  1ESV A;  4FWS A;  1NGG A;  2ZM6 K;  3WXJ A;  3MN6 A;  2Q1N A;  4ELV A;  4BQZ A;  4AM7 A;  4F9O A;  4LD0 A;  4KHU A;  2YV0 X;  1BA1 A;  3A0I X;  1E4F T;  3FFI A;  4JI2 K;  3QIP A;  3R3L A;  1HNV A;  4JKF A;  4JD2 A;  2YHX A;  4WFB L;  2E2O A;  3KZB A;  1JXE A;  3DRP A;  4YOY A;  2O4G A;  3ZET A;  3RTV A;  4LSL A;  2OPS A;  3FLC O;  3QNO A;  5I42 A;  3QEW A;  5LY3 A;  3GOI A;  2QEX N;  3OVN A;  2G8I A;  1FXX A;  3I55 N;  3MWT A;  4BRC A;  2KTQ A;  1VSH A;  2P9N A;  1D9F A;  4BR0 A;  2HB5 A;  3V81 A;  3HVR A;  1I3A A;  4B1Z A;  4OKJ A;  2QWP A;  4WFA L;  3MXJ A;  3KLH A;  3CET A;  5T7B A;  4CER A;  4OKK A;  2FSN A;  5K14 A;  4JRQ A;  1NBW A;  4O55 A;  1YVU A;  4CEF A;  5JMV A;  1GLL O;  3TAE A;  2VWB A;  1HX1 A;  4FW2 A;  1RBR A;  5C42 A;  3NAE A;  4ID5 A;  5IWA K;  3AO1 A;  3ZSX A;  1IG9 A;  4DKW A;  2A1R A;  1NKB A;  4FWK A;  5KPT A;  1J5O A;  1SL1 A;  4PHT X;  3AGR A;  3O1W A;  3ZSO A;  1TAQ A;  3NE6 A;  2UXB K;  3SMP A;  5AJ3 K;  3QNN A;  1XNQ K;  3OYL A;  4DV1 K;  3D2E A;  1OVY A;  4A2B A;  3VF6 A;  3NFA A;  2BDP A;  3V9U A;  1EQY A;  4DV2 K;  1QTM A;  4Y1C A;  3M3Z A;  3V1Q A;  1KCF A;  5E84 A;  3U6F A;  3SCX A;  1VQL N;  4WQ5 A;  4BGA A;  4CGI A;  1VQ5 N;  4FSV A;  1NGE A;  3CPE A;  4K43 A;  4FWO A;  4LFA K;  1RNH A;  1EO1 A;  1WSJ A;  3BF3 A;  4IFY A;  1YXQ A;  1MDU B;  2GEL A;  3IUC A;  3OYC A;  4FJ7 A;  2OPR A;  3VQB A;  4B3R K;  4BR2 A;  3ZCM A;  5F1X A;  4FK0 A;  1B9F A;  3J7Y P;  3VQA A;  3LAM A;  1BIS A;  4JKG B;  5LL6 Z;  4J2A A;  3VTH A;  5I9E B;  4H0Y B;  4B9L A;  2GWJ A;  1NJW A;  1GLE G;  2E8A A;  4JKG A;  1X3N A;  3T1A A;  3OYH A;  2ETJ A;  2ITG A;  3VQ7 A;  4OGC A;  3D2E B;  1TGO A;  3OYK A;  3AVH A;  4BDZ A;  3BY5 A;  5AQL A;  3HOT A;  4NCA A;  3AV9 A;  5LJW A;  3AA4 A;  3MEC A;  3CPW M;  4YOT A;  5HLF A;  4O0J A;  1REV A;  1RDU A;  1YTU A;  3I8D A;  1LV5 A;  4GKK K;  4ZTF A;  5AQM A;  3S9H A;  2KLA A;  3CC2 N;  1FKP A;  3DXK B;  1YJW N;  4JKD A;  2HBL A;  1WNS A;  1WN7 A;  1RT4 A;  5AZI A;  3QET A;  4IEI A;  3QEP A;  3H3N O;  2ATQ A;  3VGM A;  2XY7 A;  4A62 A;  2YX6 A;  1QQM A;  2V51 B;  2XY5 A;  5AQX A;  1NK0 A;  2QI2 A;  4CFA A;  1ASW A;  1XC9 A;  4PKI A;  1OH7 A;  4NLB A;  2HHU A;  1JLC A;  3R8E A;  2CGK A;  2YHY A;  3AVB A;  4A5A A;  3TR8 A;  4JI8 K;  1RTD A;  4KHY A;  4FL9 A;  1NK7 A;  2IDO A;  3EZ5 A;  5BRF A;  4XH1 A;  4Z4H A;  4FCY A;  1VQ4 N;  4B8C A;  1BCO A;  4CJL A;  4BRE A;  3NVM A;  5FPD A;  4JK8 A;  3UKU A;  4WE1 A;  4C1N I;  2UUC K;  4KKO A;  3F5T A;  1J6Z A;  3O3G A;  1TL3 A;  3HM8 A;  1TKZ A;  4YOV A;  3SNN A;  4FWR A;  3T19 A;  2YHB A;  3ITH A;  5CHI A;  4KH4 A;  3TAG A; 
#chains in the Genus database with same CATH homology
 2CGL A;  2QWL A;  3VER A;  4KH5 A;  2Q0R A;  2HBM A;  3KVG A;  4IXC A;  2NNW A;  2GWK A;  3R9P A;  4BG8 A;  1KAX A;  4YOW A;  3FZK A;  3NMU A;  1IG8 A;  1QZ6 A;  3HTV A;  3D7E O;  5GIN A;  3W3D A;  3CHW A;  4K25 A;  1MWM A;  1K8A O;  1S3X A;  3CIP A;  1M90 O;  4BRM A;  1YF5 L;  1HKG A;  2NRR A;  4EAH D;  3CI5 A;  3LDO A;  2GEM A;  3TTC A;  4BG9 A;  5CE3 A;  3TTF A;  1NGJ A;  4LC9 B;  1NGI A;  2FSJ A;  1SAZ A;  3M5R A;  4NO7 A;  5M1K A;  4IO9 L;  2J4R A;  4CBU A;  5JVG L;  4H0O A;  2P9I A;  2A5X A;  3O5B A;  4CI6 A;  4CZE A;  5LJV A;  4ILH A;  2E2N A;  3WQT A;  3DXM B;  5AQN A;  1N8R O;  4H03 B;  2E88 A;  3MN9 A;  3H6E A;  3LDQ A;  2GX9 A;  1BU6 O;  3G25 A;  3ZX3 A;  2EWS A;  3P39 A;  4FVU A;  3ULE A;  3J7Z O;  3BEX A;  3NVK A;  3EO3 A;  3HRG A;  3A5M C;  4CZF A;  4YOR A;  3TSU A;  1BG3 A;  2RHK A;  4U7B A;  3RSE A;  3IDH A;  1QVF M;  3RSE B;  1KAY A;  1YI2 N;  2V7Z A;  3DJC A;  3MK6 A;  2P9S A;  4WQ4 C;  3ZX0 A;  4IOC L;  2CGJ A;  5BN8 A;  1TUU A;  4H0T B;  5AZI B;  4BRG A;  3VEZ A;  1DEJ A;  1QQO A;  4ISF A;  2Q97 A;  3CJ1 A;  4CJ7 A;  1X3M A;  3WEE A;  5AZJ B;  5FPE A;  3AY9 A;  2NRZ A;  4BC5 A;  5C12 A;  4IEE A;  3VF4 A;  4DQ8 A;  4EHU A;  3C7N A;  3UKR A;  3SAG A;  1VQ9 N;  3TPQ A;  4CD1 A;  2A3Z A;  4HWI A;  2P9L B;  1K73 O;  1YIT N;  2QTD A;  3LDN A;  3U4L A;  5EXW A;  3O9S A;  4H5V A;  3I8B A;  1GLD G;  3G6E N;  1SQK A;  1H1V A;  1XC3 A;  5C2D A;  3H46 O;  4O8K A;  5AQJ A;  4AF1 A;  4CBX A;  2QA4 N;  2W40 A;  1D4X A;  4WF9 L;  3FZM A;  3VOV A;  1Y64 A;  4YOX A;  4OPA A;  1JCE A;  3O9R A;  4QS8 A;  5C0Y A;  4JHD B;  3CCU N;  4CZH A;  4BR5 A;  5AFU A;  4FPB A;  4JK9 A;  5M1P A;  3WQU A;  5HOO A;  3KWI A;  4MDA A;  3VEW A;  4DCH A;  3Q7B A;  2WFB A;  4JNE A;  3WXI A;  2W41 A;  2Q31 A;  1KAZ A;  4FPA A;  5C2F A;  1KXP A;  3WT0 A;  2ASM A;  3MDQ A;  3OBY A;  3WEE B;  4AM6 A;  1NJI O;  5TKY A;  2Q0U A;  3MN7 A;  1YUW A;  3EKU A;  4A57 A;  3CF5 L;  4GY2 B;  4XH4 A;  3LDL A;  2QW9 A;  4I6M B;  1QHA A;  3D6R A;  4QS7 A;  5M1N A;  3VGK A;  4IOA L;  4CBW A;  2P9S B;  2NRH A;  1YHQ N;  3VET A;  2QWM A;  3E9O A;  1W97 L;  2A42 A;  2ZJQ L;  3WXL A;  5AQZ A;  2IIR A;  4O5F A;  4BRP A;  3L0Q A;  4EFH A;  1GLC G;  1ATS A;  1XUP O;  1U2V B;  3O9T A;  3OW2 M;  3QFP A;  4YDU A;  1KQS M;  2WBN A;  4C23 A;  3MMV A;  1VQK N;  3OBW A;  5AQV A;  2VYP A;  4RCH A;  4OO1 J;  1ATR A;  3SLC A;  4BRH A;  4CZI A;  1RGI A;  1TYQ A;  3U8X A;  3O6W A;  3CER A;  3TSQ A;  2WC9 A;  3VEV A;  3TU5 A;  1W2B M;  3UB5 A;  4CZG A;  5AQO A;  3FR0 A;  4FWM A;  3CCM N;  1HLU A;  2VCP A;  2E2P A;  1JJ2 M;  4GV3 A;  1NGD A;  1HPM A;  3MX5 A;  3ZET B;  4A5B A;  4CZM A;  4GV6 A;  2FLO A;  2AP1 A;  2KHO A;  2FXU A;  3O8M A;  2D0P A;  4PL8 A;  4MLH A;  3PLA A;  5M1Q A;  3I33 A;  2ASO A;  3L6Q A;  3H1V X;  1X9J A;  3C0B A;  2QXL A;  3IMX A;  4JD2 B;  1NLV A;  3HOS A;  1XQS C;  1JCG A;  2IVP A;  5E26 A;  5BN9 A;  3Q7C A;  3O4W A;  2P9U B;  4JKH A;  3ENH A;  1KD1 O;  4BRN A;  3EZW A;  4FWQ A;  1NWK A;  4H0V B;  4BR7 A;  4CZK A;  3O1B A;  2E2Q A;  3P4I A;  3M6G A;  3SK3 A;  4EIA A;  2RE2 A;  2Q2R A;  2HF3 A;  4IFE A;  1RDW X;  1NGA A;  2OTJ N;  4XH5 A;  1T44 A;  1NGB A;  3O9U A;  3AGK A;  2F7T A;  4E1J A;  5KPZ A;  3ATU A;  1TYQ B;  3U9Z A;  3F9M A;  3PIP L;  4GVE A;  2H3G X;  2JWL A;  4FWP A;  4WQ4 A;  1K9M O;  2A40 A;  1BA0 A;  5GAH P;  3CJ9 A;  3H3O B;  3O9Q A;  3TSP A;  1HJO A;  3JS6 A;  3KWG A;  5AZJ A;  3QDK A;  3CCQ N;  2QWO A;  3P31 A;  4QS9 A;  4IDH A;  3IFR A;  3ENB A;  1MA9 B;  2I7P A;  2CH5 A;  1Z05 A;  3H1Q A;  4BRD A;  4U67 L;  5H1S Q;  1GLJ O;  4BRO A;  1LOT B;  1VQN N;  4JKC A;  4B1V A;  2OAN A;  3QBX A;  3LM2 A;  3SJH A;  3CCE N;  5JLF A;  4H5T A;  1V4T A;  4BQL A;  4IO8 A;  3SAF A;  1VQM N;  4NB4 A;  3CCV N;  3QB0 A;  2GTD A;  2ZGY A;  4B1U B;  2HBJ A;  2BTF A;  4I6M A;  1DGK N;  3A5O C;  4CD3 A;  2ZJR L;  1ZBS A;  4M63 C;  2P9N B;  2E1Z A;  5BPN A;  3QML A;  4B1Y B;  4BC2 A;  3D2F A;  3K9K A;  2WUS A;  5M1O A;  3SMS A;  5KPR A;  1P90 A;  2YJF A;  4KBO A;  3SBT A;  3CD6 N;  2UYT A;  1NM1 A;  1U6Z A;  3HSC A;  1ZXO A;  3ZX2 A;  5AQI A;  5KQD A;  4DHY A;  3U9D A;  3R6M A;  1VQP N;  3CJB A;  3BF1 A;  5GIO A;  5HL7 L;  5BPL A;  2VGM A;  4M7Y A;  4WQ5 C;  4PL7 A;  5KQ8 A;  4MLE A;  5DM7 L;  3DXK A;  4FOI A;  1T6C A;  2IVN A;  3DXM A;  4HTL A;  4JKE A;  3WXM B;  3SAH A;  4WFN L;  4YOU A;  2BH1 A;  2YCH A;  3ID6 A;  5GAG P;  2P9L A;  4BR4 A;  5C10 A;  2ZGZ A;  3EKS A;  1K8K B;  5F2R A;  2VGN A;  4JHD A;  5AQP A;  3M1F A;  5ELZ A;  5ADX A;  5JLH A;  5M1F A;  2ZWH A;  1ESV A;  2NRX A;  3CCL N;  1GLF O;  2F9W A;  4FWS A;  1NGG A;  2ITM A;  2I7N A;  3UKU B;  3MN6 A;  2Q1N A;  3WXJ A;  3CCJ N;  4GV9 A;  4BQZ A;  4UY8 O;  3N4Q A;  3RVC A;  4AM7 A;  4F9O A;  3CJC A;  2NZT A;  4A2A A;  4CZJ A;  4FOE A;  4BRK A;  1V4S A;  1ZC6 A;  1BA1 A;  2YHW A;  3L4I A;  3A0I X;  1E4F T;  3LL3 A;  5AQT A;  5AR0 A;  3EN9 A;  1OKJ A;  3LM9 A;  3GE1 A;  2NRT A;  3E1Y A;  3T69 A;  2P9U A;  3VPZ A;  2QWR A;  4IWV A;  3R3L A;  1BWF O;  4JKF A;  4JD2 A;  5AFU H;  1ILY A;  2YHX A;  3C6H A;  3FZF A;  5AQK A;  1S72 N;  1YJ9 N;  4WFB L;  3DLL L;  2E2O A;  3KZB A;  5GAD P;  3K9J A;  3E9P A;  4YOY A;  2IVO A;  3H45 C;  3ZET A;  3FLC O;  4BRF A;  5LY3 A;  1BOT O;  3GOI A;  2QEX N;  1HUX A;  4H0P A;  3I55 N;  3MWT A;  4BRC A;  2A41 A;  3A5N C;  4IOX A;  4Y0W A;  3W0L A;  2P9N A;  1RFQ A;  2P9K B;  2BUP A;  4BR0 A;  5AQF A;  4WYB A;  3CC4 N;  4PKH A;  5EOY A;  5TKW A;  5F0X A;  2P9P B;  2P9P A;  3L4Q A;  3CQY A;  2PBD A;  4J8F A;  4B1X B;  3TTD A;  4B1Z A;  3QIC A;  2P9I B;  2QWP A;  1BDG A;  5ADX H;  2FF3 B;  4WFA L;  1BO5 O;  2P9K A;  3CET A;  4G9Z A;  3FGU A;  2FSN A;  1VAZ A;  4H5W A;  1BUP A;  5EY4 A;  4IJA A;  3MX2 A;  1NBW A;  3GDQ A;  1T3V A;  1JCF A;  5FPN A;  4B1W B;  5C15 A;  5BRE A;  5JMV A;  5AQU A;  1GLL O;  1U2V A;  3KK7 A;  4BRA A;  1VQ7 N;  3OA9 A;  3CCS N;  3KHY A;  2E1Y A;  2QWN A;  2VWB A;  1HX1 A;  5FPM A;  2YJE A;  3CJ7 A;  3ULE B;  4DB3 A;  3ZEU B;  2HF4 A;  4ILG B;  3JXU A;  5MLC Q;  3T7Z A;  4OPH A;  4DKW A;  3ATV A;  1Z6R A;  4FO0 A;  1GLB G;  2QWQ A;  3DAW A;  3ENO A;  4FWK A;  4ISG A;  5KPT A;  4RWT A;  2A6A A;  2D4W A;  3FZH A;  2FF6 A;  4PHT X;  1VQ8 N;  3AGR A;  3O1W A;  4BR9 A;  2YI1 A;  4EHT A;  1YVN A;  1CZA N;  1T6D A;  3MCP A;  3MCA B;  3SMP A;  2PFU A;  3AAP A;  4PKG A;  3WXK A;  3F2K A;  4Z94 A;  1KC8 O;  3D2E A;  1OVY A;  2HBK A;  4A2B A;  5BRD A;  1Q82 O;  4FWL A;  1M1K O;  3VF6 A;  5EX5 A;  3C6A A;  1LCU A;  1QZ5 A;  2JWK A;  1EQY A;  1G99 A;  1TUY A;  3QBW A;  1VQO N;  2AA4 A;  2FSK A;  5AQW A;  1HKC A;  3E66 A;  4A61 A;  1YJN N;  2NRV A;  3M3Z A;  5AQG A;  2Q36 A;  3GL1 A;  2HST A;  5E84 A;  1E4G T;  5AQR A;  2E20 A;  1SZ2 A;  1VQL N;  2HMP A;  3VF2 A;  4WQ5 A;  4BGA A;  3D2F B;  1IJJ A;  4H5R A;  4O8U A;  1VQ5 N;  4FSV A;  1NGE A;  3CPE A;  4K43 A;  4FWO A;  5JVH L;  2DPN A;  1Q81 O;  4BRL A;  3EL2 A;  3EE9 A;  3P38 A;  4K41 A;  4A59 A;  4B9Q A;  3CXC M;  3HBT A;  3VGL A;  1EO1 A;  3BF3 A;  5BR9 A;  4BGB A;  1YXQ A;  4CZL A;  4XEI A;  1MDU B;  2GEL A;  4MO4 A;  3MWP A;  3IUC A;  1WOQ A;  3GBT A;  1O13 A;  3AAQ A;  4R79 A;  4BR2 A;  5F1X A;  2KKZ A;  5AQH A;  3N4P A;  2D0O A;  4ISE A;  3FFK B;  2ASP A;  3CMA N;  4JKG B;  1NMD A;  4ILJ A;  3MN5 A;  4IJN A;  4IZ9 A;  3VTH A;  5I9E B;  4H0Y B;  1S22 A;  4MO5 A;  3FZL A;  4WCE L;  2ZJP L;  3A8Y A;  3AAR A;  3GG4 A;  4JN4 A;  2GWJ A;  3HZ6 A;  4C1N K;  5EVZ A;  1GLE G;  2E8A A;  4JKG A;  1NGF A;  1X3N A;  3FE1 A;  5BPM A;  5JIC A;  1WUA A;  3VEX A;  1QVG M;  3BUZ B;  3VTI A;  4FWN A;  4MDB A;  2GUP A;  3LDP A;  1YAG A;  3VES A;  3D2E B;  4BVO A;  3BP8 A;  5AQL A;  3HOT A;  2V7Y A;  2HOE A;  2NRW A;  4KH6 A;  5LJW A;  3E9L A;  3IKM A;  3CME N;  3CPW M;  4NLC A;  4JAX A;  4YOT A;  3UE5 A;  3VEN A;  3A5L C;  1DKG D;  3C7N B;  3SBG A;  3UKR B;  3CC7 N;  1RDU A;  4GNI A;  5AQY A;  1Q86 O;  2V52 B;  3WUH A;  4H0X B;  1Q18 A;  5AQM A;  1ATN A;  5AQQ A;  2KLA A;  3CC2 N;  3DXK B;  1C0F A;  4RTF D;  4BRI A;  3QFU A;  1YJW N;  4JKD A;  2HBL A;  3C65 A;  4JKB A;  1Q7Y O;  5AZI A;  2ZF5 O;  4IEI A;  3H3N O;  2D1K A;  1DT9 A;  3EE8 A;  4JKA A;  3VGM A;  4BY9 C;  3B8A X;  3R1X A;  2NLX A;  2YX6 A;  4A62 A;  3PIO L;  5GAE P;  1QQM A;  1GLA G;  2V51 B;  5AQX A;  1R59 O;  2QI2 A;  4BC3 A;  4BC4 A;  2OTL N;  3ID8 A;  4PKI A;  4H5N A;  4NLB A;  3R8E A;  1HKB A;  3CCR N;  2CGK A;  3O08 A;  2YHY A;  3G4S N;  3I56 N;  4A5A A;  4K42 A;  3CQX A;  3J8A A;  4FL9 A;  2CH6 A;  4M7X A;  1QQN A;  3S41 A;  3VEO A;  3VMF B;  2F9T A;  3OHR A;  1P8Z A;  5GIP A;  1NGC A;  1YIJ N;  5BRF A;  5DM6 L;  4XH1 A;  1VQ4 N;  4JK7 A;  3O80 A;  1SS6 A;  4BRE A;  2QM1 A;  4BRQ A;  4YDU C;  3HI0 A;  5AQS A;  3NVM A;  4BVP A;  5FPD A;  4JK8 A;  3CJA A;  3ZEU A;  4JEP A;  3UKU A;  1VQ6 N;  4C1N I;  3G71 N;  3F5T A;  1J6Z A;  2PAV A;  1K8K A;  1NGH A;  3HM8 A;  4YOV A;  4FWR A;  4L3Q A;  5CR4 A;  5B8H A;  3ZYY X;  1C0G A;  3VEY A;  5BRH A;  3DWL A;  5CHI A;  1MWK A;  4KH4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...