4IOAS

Crystal structure of compound 4e bound to large ribosomal subunit (50s) from deinococcus radiodurans
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
175
structure length
175
Chain Sequence
MELTAKPRTPKQKLDESMIAAVAYNKENNVSFALDRKAFDRAFRQQSTTGLFDITVEGGETFPALVKAVQMDKRKRAPIHVDFYMVTYGEPVEVSVPVHTTGRSQGEVQGGLVDIVVHNLQIVAPGPRRIPQELVVDVTKMNIGDHITAGDIKLPEGCTLAADPELTVVSVLPPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Novel 3-O-carbamoyl erythromycin A derivatives (carbamolides) with activity against resistant staphylococcal and streptococcal isolates.
pubmed doi rcsb
molecule tags Ribosome/ribosome inhibitor
molecule keywords 23S ribosomal RNA
total genus 25
structure length 175
sequence length 175
ec nomenclature
pdb deposition date 2013-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF01386 Ribosomal_L25p Ribosomal L25p family
S PF14693 Ribosomal_TL5_C Ribosomal protein TL5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.240.10 Mainly Beta Beta Barrel Ribosomal Protein L25; Chain P Ribosomal Protein L25; Chain P 4ioaS01
2.170.120.20 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 Ribosomal protein L25, beta domain 4ioaS02
4JXXA 5DM6S 5BNZA 3PIPS 1EXDA 4WF9S 5GADW 5GAEW 2ZJPS 4IOAS 2ZJQS 4WFNS 4IOCS 4WFBS 3DLLS 1ZJWA 1EUYA 5GAGW 1QTQA 5DM7S 1GTRA 3AIIA 2HZ7A 2ZJRS 1QRUA 1QRTA 5IZNA 3J7ZV 5JVHS 4U67S 5GAHW 3CF5S 1O0BA 2RE8A 1GTSA 1FEUA 2RD2A 1QRSA 1B75A 4IO9S 4UY88 3PIOS 1NYLA 5HL7S 4JYZA 4P2BA 4WCES 4WFAS 1D6KA 4JXZA 4H3SA 1O0CA 1EUQA 5JVGS 1DFUP
chains in the Genus database with same CATH superfamily
3CZBA 5BNZA 3PIPS 4WF9S 1IW7A 5C4JC 3GTJC 4J3CA 2ZJPS 4YFKA 2KPUA 4OIOA 3HKZD 1R9TC 2KQ1A 5TMCA 4A3MC 4NOIA 4Y7NC 1QTQA 5GAGW 1UDXA 4OIPA 1GTRA 3X1LB 2HZ7A 2BE5A 2YU9C 2PI8A 3RZOC 4C3JC 2R92C 5JVHS 5D4DA 5GAHW 2R93C 2RE8A 4XSZA 1I50C 4G7OA 4H4KA 2Z0YA 2CW0A 3W2WB 4Q4ZA 1QRSA 3H0GC 4LLGA 2CX8A 4E8BA 3CQZC 3S1QC 3W2VB 2B63C 3S1MC 2AE0X 5FLMC 2PNWA 4A3IC 4KN7A 4A3EC 1Y1WC 4WFAS 4LJZA 4BBRC 5IYCC 2A6EA 3S17C 4GZYA 2EGWA 4L69A 3GTKC 4JK1A 3S16C 5JVGS 4MEYA 4BBSC 1EXDA 2A68A 2JA7C 5GADW 3HOUC 2Y0SD 2G6GA 3S1RC 3PO2C 2A6HA 1Z85A 2L5NA 3LYWA 1ZJWA 3PO3C 2G5DA 5DM7S 4A3GC 1ZYRA 3GTLC 4IOAS 1QRTA 5IZNA 1FEUA 4U67S 3HOZC 4BXXC 1GTSA 4XLNA 1K83C 1SMYA 5C3EC 2PJJA 1Y1VC 4Q5SA 2JA5C 2NVTC 2JA6C 3GTOC 4C3IC 3H3VD 5IYBC 1NYLA 3PIOS 2VUMC 4OINA 4JYZA 2WB1D 3S15C 2GAEA 3HOYC 3DXJA 2E2JC 3RZDC 4LK1A 3KW2A 1O0CA 1TWGC 4OIQA 1EUQA 5IP7C 3GTGC 4BY7C 5C44C 4MQ9A 4OIRA 2R7ZC 2O5JA 3M3YC 2O5IA 2ZJQS 4WFNS 4IOCS 1V6ZA 4AYBD 2PICA 1WCMC 4YFNA 1I3QC 4QJVA 4G7ZA 4G7HA 2NVXC 4A3BC 4A3DC 4KMUA 4X6AC 3AIIA 1YNNA 4Y52C 2PMZD 3J7ZV 3S14C 3HOWC 3S2DC 3GTPC 1BDFA 4V194 1YNJA 4YG2A 3M4OC 4A3JC 2KXYA 4IO9S 5IYDC 4XLPA 4YFXA 2NVYC 1TWCC 3GTMC 4JXZA 2E2HC 2E2IC 4H3SA 3FKIC 1TWAC 4LK0A 4C3HC 2NWAA 4JXXA 3S1NC 5DM6S 1I6HC 5C4XC 5GAEW 4QIWD 4XSXA 4A3LC 2WAQD 2NVQC 3I4NC 4WFBS 4A3FC 3HOVC 2L3UA 4KN4A 3DLLS 5TMFA 1EUYA 1VHYA 2ZJRS 1QRUA 5IP9C 3I4MC 3HOXC 3CF5S 1O0BA 4A93C 4A3CC 1SFOC 4MEXA 5HQHA 3GTQC 2RD2A 2JA8C 1NXZA 4UY88 1TWHC 2PA8D 4A3KC 1TWFC 4BY1C 5HL7S 3K7AC 4ZH4A 3WODA 4P2BA 4WCES 1I6VA 3EQLA 4C2MC 2PPBA 1D6KA 2EGVA 1HQMA 3S2HC 1VHKA 1B75A 2A69A 1DFUP
chains in the Genus database with same CATH topology
4JXXA 5DM6S 5BNZA 3PIPS 1EXDA 4WF9S 5GADW 5GAEW 2ZJPS 4IOAS 2ZJQS 4WFNS 4IOCS 4WFBS 3DLLS 1ZJWA 1EUYA 5GAGW 1UDXA 5DM7S 1GTRA 1QTQA 3AIIA 2HZ7A 2ZJRS 1QRUA 3X1LB 1QRTA 5IZNA 3J7ZV 5JVHS 4U67S 5GAHW 3CF5S 1O0BA 2RE8A 1GTSA 1FEUA 4H4KA 4V194 3W2WB 2RD2A 1QRSA 1B75A 4IO9S 4UY88 3W2VB 1NYLA 3PIOS 5HL7S 4JYZA 4P2BA 4WCES 4WFAS 1D6KA 4JXZA 4H3SA 1O0CA 1EUQA 5JVGS 1DFUP
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JXX A;  5DM6 S;  5BNZ A;  3PIP S;  1EXD A;  4WF9 S;  5GAD W;  5GAE W;  2ZJP S;  4IOA S;  2ZJQ S;  4WFN S;  4IOC S;  4WFB S;  3DLL S;  1ZJW A;  1EUY A;  5GAG W;  1QTQ A;  5DM7 S;  1GTR A;  3AII A;  2HZ7 A;  2ZJR S;  1QRU A;  1QRT A;  5IZN A;  3J7Z V;  5JVH S;  4U67 S;  5GAH W;  3CF5 S;  1O0B A;  2RE8 A;  1GTS A;  1FEU A;  2RD2 A;  1QRS A;  1B75 A;  4IO9 S;  4UY8 8;  3PIO S;  1NYL A;  5HL7 S;  4JYZ A;  4P2B A;  4WCE S;  4WFA S;  1D6K A;  4JXZ A;  4H3S A;  1O0C A;  1EUQ A;  5JVG S;  1DFU P; 
#chains in the Genus database with same CATH topology
 3CZB A;  5BNZ A;  3PIP S;  4WF9 S;  1IW7 A;  5C4J C;  3GTJ C;  4J3C A;  2ZJP S;  4YFK A;  2KPU A;  4OIO A;  3HKZ D;  1R9T C;  2KQ1 A;  5TMC A;  4A3M C;  4NOI A;  4Y7N C;  1QTQ A;  5GAG W;  1UDX A;  4OIP A;  1GTR A;  3X1L B;  2HZ7 A;  2BE5 A;  2YU9 C;  2PI8 A;  3RZO C;  4C3J C;  2R92 C;  5JVH S;  5D4D A;  5GAH W;  2R93 C;  2RE8 A;  4XSZ A;  1I50 C;  4G7O A;  4H4K A;  2Z0Y A;  2CW0 A;  3W2W B;  4Q4Z A;  1QRS A;  3H0G C;  4LLG A;  2CX8 A;  4E8B A;  3CQZ C;  3S1Q C;  3W2V B;  2B63 C;  3S1M C;  2AE0 X;  5FLM C;  2PNW A;  4A3I C;  4KN7 A;  4A3E C;  1Y1W C;  4WFA S;  4LJZ A;  4BBR C;  5IYC C;  2A6E A;  3S17 C;  4GZY A;  2EGW A;  4L69 A;  3GTK C;  4JK1 A;  3S16 C;  5JVG S;  4MEY A;  4BBS C;  1EXD A;  2A68 A;  2JA7 C;  5GAD W;  3HOU C;  2Y0S D;  2G6G A;  3S1R C;  3PO2 C;  2A6H A;  1Z85 A;  2L5N A;  3LYW A;  1ZJW A;  3PO3 C;  2G5D A;  5DM7 S;  4A3G C;  1ZYR A;  3GTL C;  4IOA S;  1QRT A;  5IZN A;  1FEU A;  4U67 S;  3HOZ C;  4BXX C;  1GTS A;  4XLN A;  1K83 C;  1SMY A;  5C3E C;  2PJJ A;  1Y1V C;  4Q5S A;  2JA5 C;  2NVT C;  2JA6 C;  3GTO C;  4C3I C;  3H3V D;  5IYB C;  1NYL A;  3PIO S;  2VUM C;  4OIN A;  4JYZ A;  2WB1 D;  3S15 C;  2GAE A;  3HOY C;  3DXJ A;  2E2J C;  3RZD C;  4LK1 A;  3KW2 A;  1O0C A;  1TWG C;  4OIQ A;  1EUQ A;  5IP7 C;  3GTG C;  4BY7 C;  5C44 C;  4MQ9 A;  4OIR A;  2R7Z C;  2O5J A;  3M3Y C;  2O5I A;  2ZJQ S;  4WFN S;  4IOC S;  1V6Z A;  4AYB D;  2PIC A;  1WCM C;  4YFN A;  1I3Q C;  4QJV A;  4G7Z A;  4G7H A;  2NVX C;  4A3B C;  4A3D C;  4KMU A;  4X6A C;  3AII A;  1YNN A;  4Y52 C;  2PMZ D;  3J7Z V;  3S14 C;  3HOW C;  3S2D C;  3GTP C;  1BDF A;  4V19 4;  1YNJ A;  4YG2 A;  3M4O C;  4A3J C;  2KXY A;  4IO9 S;  5IYD C;  4XLP A;  4YFX A;  2NVY C;  1TWC C;  3GTM C;  4JXZ A;  2E2H C;  2E2I C;  4H3S A;  3FKI C;  1TWA C;  4LK0 A;  4C3H C;  2NWA A;  4JXX A;  3S1N C;  5DM6 S;  1I6H C;  5C4X C;  5GAE W;  4QIW D;  4XSX A;  4A3L C;  2WAQ D;  2NVQ C;  3I4N C;  4WFB S;  4A3F C;  3HOV C;  2L3U A;  4KN4 A;  3DLL S;  5TMF A;  1EUY A;  1VHY A;  2ZJR S;  1QRU A;  5IP9 C;  3I4M C;  3HOX C;  3CF5 S;  1O0B A;  4A93 C;  4A3C C;  1SFO C;  4MEX A;  5HQH A;  3GTQ C;  2RD2 A;  2JA8 C;  1NXZ A;  4UY8 8;  1TWH C;  2PA8 D;  4A3K C;  1TWF C;  4BY1 C;  5HL7 S;  3K7A C;  4ZH4 A;  3WOD A;  4P2B A;  4WCE S;  1I6V A;  3EQL A;  4C2M C;  2PPB A;  1D6K A;  2EGV A;  1HQM A;  3S2H C;  1VHK A;  1B75 A;  2A69 A;  1DFU P; 
#chains in the Genus database with same CATH homology
 4JXX A;  5DM6 S;  5BNZ A;  3PIP S;  1EXD A;  4WF9 S;  5GAD W;  5GAE W;  2ZJP S;  4IOA S;  2ZJQ S;  4WFN S;  4IOC S;  4WFB S;  3DLL S;  1ZJW A;  1EUY A;  5GAG W;  1UDX A;  5DM7 S;  1GTR A;  1QTQ A;  3AII A;  2HZ7 A;  2ZJR S;  1QRU A;  3X1L B;  1QRT A;  5IZN A;  3J7Z V;  5JVH S;  4U67 S;  5GAH W;  3CF5 S;  1O0B A;  2RE8 A;  1GTS A;  1FEU A;  4H4K A;  4V19 4;  3W2W B;  2RD2 A;  1QRS A;  1B75 A;  4IO9 S;  4UY8 8;  3W2V B;  1NYL A;  3PIO S;  5HL7 S;  4JYZ A;  4P2B A;  4WCE S;  4WFA S;  1D6K A;  4JXZ A;  4H3S A;  1O0C A;  1EUQ A;  5JVG S;  1DFU P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...