4IOAW

Crystal structure of compound 4e bound to large ribosomal subunit (50s) from deinococcus radiodurans
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
55
structure length
55
Chain Sequence
MKIKLVRSVIGRPGNQVKTVQALGLRKIGDSREVSDTPAVRGMVKTVKHLLEVQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Novel 3-O-carbamoyl erythromycin A derivatives (carbamolides) with activity against resistant staphylococcal and streptococcal isolates.
pubmed doi rcsb
molecule tags Ribosome/ribosome inhibitor
molecule keywords 23S ribosomal RNA
total genus 13
structure length 55
sequence length 55
ec nomenclature
pdb deposition date 2013-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
W PF00327 Ribosomal_L30 Ribosomal protein L30p/L7e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1390.20 Alpha Beta 2-Layer Sandwich Ribosomal Protein L30; Chain: A, Ribosomal protein L30, ferredoxin-like fold domain 4ioaW00
1YJWW 3CCRW 1Q81X 3CF5W 3G4SW 4WFBW 4IOAW 1K9MX 4IOCW 4IO9W 1KQSV 1M90X 5JVGW 1YJNW 3CCQW 1VQOW 1VQ5W 3CMAW 3J7ZZ 1M1KX 4WCEW 5GAHa 3PIOW 4U67W 2ZJQW 3CC7W 5DM7W 1YI2W 1VQMW 1S72W 1Q82X 1YITW 3CCSW 3DLLW 3CCUW 1YJ9W 5JVHW 3CXCV 3PIPW 2OTLW 1VQNW 2QA4W 3CCJW 1VQ6W 4WFAW 1BXYA 1VQ7W 1JJ2V 1VQKW 2ZJPW 4UY8Z 3OW2V 1VQ8W 2QEXW 3CC4W 3CMEW 4WFNW 1QVFV 3I56W 5HL7W 1Q86X 1NJIX 1VQ4W 1N8RX 1KD1X 5GADa 3CCMW 3CPWV 1QVGV 5GAGa 3CCVW 5GAEa 3CCLW 2ZJRW 1YIJW 1K8AX 2OTJW 4WF9W 3G71W 3CCEW 1KC8X 3I55W 1VQ9W 3CD6W 1VQLW 3CC2W 5DM6W 1VQPW 1Q7YX 1K73X 3G6EW 1YHQW 1W2BV
chains in the Genus database with same CATH superfamily
1R6QC 5M18A 1YJWW 3CCRW 1Q81X 3CF5W 3G4SW 4WFBW 5M19A 4IOAW 1K9MX 4IOCW 1RQSA 4IO9W 3G1BA 1MWUA 5M1AA 1KQSV 3ZFZA 3W7SA 1M90X 5JVGW 1YJNW 3CCQW 4BL3A 1VQOW 1RQUA 1VQ5W 3W7XA 3CMAW 3J7ZZ 1MBXC 1M1KX 1CTFA 4WCEW 5GAHa 3D3IA 4DKIA 1MWRA 3PIOW 4U67W 2ZJQW 3CC7W 5DM7W 1YI2W 3DNJA 3G19A 1VQMW 1S72W 1Q82X 1YITW 3GQ1A 1R6OC 3CCSW 2WA9A 3O1FB 3DLLW 3CCUW 3W7TA 1YJ9W 5JVHW 3ZG0A 3CXCV 3ZG5A 4BL2A 3PIPW 3O1FA 2OTLW 1VQNW 2QA4W 3CCJW 1VQ6W 4WFAW 1BXYA 1VQ7W 4CPKA 1JJ2V 2W9RA 1VQKW 2ZJPW 4UY8Z 1MWTA 3O2HA 3OW2V 1VQ8W 1MBVB 4YJMA 2QEXW 3CC4W 3CMEW 4WFNW 4CJNA 1QVFV 3I56W 1MWSA 5HL7W 1Q86X 3GQ0A 1NJIX 1VQ4W 1N8RX 2WA8A 1KD1X 5GADa 3CCMW 1MBUC 3CPWV 1QVGV 1VQQA 5GAGa 3GW1A 3CCVW 5GAEa 1DD4A 2ZJRW 3W7WA 3CCLW 1YIJW 1K8AX 1MG9A 2OTJW 4WF9W 3G71W 3CCEW 1KC8X 4YKAA 4YJXA 3I55W 3O2BA 3G3PA 3W7UA 1VQ9W 3CD6W 1VQLW 3CC2W 5DM6W 1VQPW 1Q7YX 1K73X 1RQVA 3G6EW 1LZWA 5CA3A 1YHQW 3O2OA 1DD3A 1W2BV 5GW7A
chains in the Genus database with same CATH topology
1YJWW 3CCRW 1Q81X 3CF5W 3G4SW 4WFBW 4IOAW 1K9MX 4IOCW 4IO9W 1KQSV 1M90X 5JVGW 1YJNW 3CCQW 1VQOW 1VQ5W 3CMAW 3J7ZZ 1M1KX 4WCEW 5GAHa 3PIOW 4U67W 2ZJQW 3CC7W 5DM7W 1YI2W 1VQMW 1S72W 1Q82X 1YITW 3CCSW 3DLLW 3CCUW 1YJ9W 5JVHW 3CXCV 3PIPW 2OTLW 1VQNW 2QA4W 3CCJW 1VQ6W 4WFAW 1BXYA 1VQ7W 1JJ2V 1VQKW 2ZJPW 4UY8Z 3OW2V 1VQ8W 2QEXW 3CC4W 3CMEW 4WFNW 1QVFV 3I56W 5HL7W 1Q86X 1NJIX 1VQ4W 1N8RX 1KD1X 5GADa 3CCMW 3CPWV 1QVGV 5GAGa 3CCVW 5GAEa 3CCLW 2ZJRW 1YIJW 1K8AX 2OTJW 4WF9W 3G71W 3CCEW 1KC8X 3I55W 1VQ9W 3CD6W 1VQLW 3CC2W 5DM6W 1VQPW 1Q7YX 1K73X 3G6EW 1YHQW 1W2BV
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YJW W;  3CCR W;  1Q81 X;  3CF5 W;  3G4S W;  4WFB W;  4IOA W;  1K9M X;  4IOC W;  4IO9 W;  1KQS V;  1M90 X;  5JVG W;  1YJN W;  3CCQ W;  1VQO W;  1VQ5 W;  3CMA W;  3J7Z Z;  1M1K X;  4WCE W;  5GAH a;  3PIO W;  4U67 W;  2ZJQ W;  3CC7 W;  5DM7 W;  1YI2 W;  1VQM W;  1S72 W;  1Q82 X;  1YIT W;  3CCS W;  3DLL W;  3CCU W;  1YJ9 W;  5JVH W;  3CXC V;  3PIP W;  2OTL W;  1VQN W;  2QA4 W;  3CCJ W;  1VQ6 W;  4WFA W;  1BXY A;  1VQ7 W;  1JJ2 V;  1VQK W;  2ZJP W;  4UY8 Z;  3OW2 V;  1VQ8 W;  2QEX W;  3CC4 W;  3CME W;  4WFN W;  1QVF V;  3I56 W;  5HL7 W;  1Q86 X;  1NJI X;  1VQ4 W;  1N8R X;  1KD1 X;  5GAD a;  3CCM W;  3CPW V;  1QVG V;  5GAG a;  3CCV W;  5GAE a;  3CCL W;  2ZJR W;  1YIJ W;  1K8A X;  2OTJ W;  4WF9 W;  3G71 W;  3CCE W;  1KC8 X;  3I55 W;  1VQ9 W;  3CD6 W;  1VQL W;  3CC2 W;  5DM6 W;  1VQP W;  1Q7Y X;  1K73 X;  3G6E W;  1YHQ W;  1W2B V; 
#chains in the Genus database with same CATH topology
 1R6Q C;  5M18 A;  1YJW W;  3CCR W;  1Q81 X;  3CF5 W;  3G4S W;  4WFB W;  5M19 A;  4IOA W;  1K9M X;  4IOC W;  1RQS A;  4IO9 W;  3G1B A;  1MWU A;  5M1A A;  1KQS V;  3ZFZ A;  3W7S A;  1M90 X;  5JVG W;  1YJN W;  3CCQ W;  4BL3 A;  1VQO W;  1RQU A;  1VQ5 W;  3W7X A;  3CMA W;  3J7Z Z;  1MBX C;  1M1K X;  1CTF A;  4WCE W;  5GAH a;  3D3I A;  4DKI A;  1MWR A;  3PIO W;  4U67 W;  2ZJQ W;  3CC7 W;  5DM7 W;  1YI2 W;  3DNJ A;  3G19 A;  1VQM W;  1S72 W;  1Q82 X;  1YIT W;  3GQ1 A;  1R6O C;  3CCS W;  2WA9 A;  3O1F B;  3DLL W;  3CCU W;  3W7T A;  1YJ9 W;  5JVH W;  3ZG0 A;  3CXC V;  3ZG5 A;  4BL2 A;  3PIP W;  3O1F A;  2OTL W;  1VQN W;  2QA4 W;  3CCJ W;  1VQ6 W;  4WFA W;  1BXY A;  1VQ7 W;  4CPK A;  1JJ2 V;  2W9R A;  1VQK W;  2ZJP W;  4UY8 Z;  1MWT A;  3O2H A;  3OW2 V;  1VQ8 W;  1MBV B;  4YJM A;  2QEX W;  3CC4 W;  3CME W;  4WFN W;  4CJN A;  1QVF V;  3I56 W;  1MWS A;  5HL7 W;  1Q86 X;  3GQ0 A;  1NJI X;  1VQ4 W;  1N8R X;  2WA8 A;  1KD1 X;  5GAD a;  3CCM W;  1MBU C;  3CPW V;  1QVG V;  1VQQ A;  5GAG a;  3GW1 A;  3CCV W;  5GAE a;  1DD4 A;  2ZJR W;  3W7W A;  3CCL W;  1YIJ W;  1K8A X;  1MG9 A;  2OTJ W;  4WF9 W;  3G71 W;  3CCE W;  1KC8 X;  4YKA A;  4YJX A;  3I55 W;  3O2B A;  3G3P A;  3W7U A;  1VQ9 W;  3CD6 W;  1VQL W;  3CC2 W;  5DM6 W;  1VQP W;  1Q7Y X;  1K73 X;  1RQV A;  3G6E W;  1LZW A;  5CA3 A;  1YHQ W;  3O2O A;  1DD3 A;  1W2B V;  5GW7 A; 
#chains in the Genus database with same CATH homology
 1YJW W;  3CCR W;  1Q81 X;  3CF5 W;  3G4S W;  4WFB W;  4IOA W;  1K9M X;  4IOC W;  4IO9 W;  1KQS V;  1M90 X;  5JVG W;  1YJN W;  3CCQ W;  1VQO W;  1VQ5 W;  3CMA W;  3J7Z Z;  1M1K X;  4WCE W;  5GAH a;  3PIO W;  4U67 W;  2ZJQ W;  3CC7 W;  5DM7 W;  1YI2 W;  1VQM W;  1S72 W;  1Q82 X;  1YIT W;  3CCS W;  3DLL W;  3CCU W;  1YJ9 W;  5JVH W;  3CXC V;  3PIP W;  2OTL W;  1VQN W;  2QA4 W;  3CCJ W;  1VQ6 W;  4WFA W;  1BXY A;  1VQ7 W;  1JJ2 V;  1VQK W;  2ZJP W;  4UY8 Z;  3OW2 V;  1VQ8 W;  2QEX W;  3CC4 W;  3CME W;  4WFN W;  1QVF V;  3I56 W;  5HL7 W;  1Q86 X;  1NJI X;  1VQ4 W;  1N8R X;  1KD1 X;  5GAD a;  3CCM W;  3CPW V;  1QVG V;  5GAG a;  3CCV W;  5GAE a;  3CCL W;  2ZJR W;  1YIJ W;  1K8A X;  2OTJ W;  4WF9 W;  3G71 W;  3CCE W;  1KC8 X;  3I55 W;  1VQ9 W;  3CD6 W;  1VQL W;  3CC2 W;  5DM6 W;  1VQP W;  1Q7Y X;  1K73 X;  3G6E W;  1YHQ W;  1W2B V; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...