4IOCF

Crystal structure of compound 4f bound to large ribosomal subunit (50s) from deinococcus radiodurans
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
71
structure length
71
Chain Sequence
MSYLIRKAAGIGKGSSTPNKAKVGKLNWDQVLEIAKTKMPDLNAGSVEAAANTVAGTARSMGVTVEGGPNA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Novel 3-O-carbamoyl erythromycin A derivatives (carbamolides) with activity against resistant staphylococcal and streptococcal isolates.
pubmed doi rcsb
molecule tags Ribosome/ribosome inhibitor
molecule keywords 23S ribosomal RNA
total genus 6
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 2013-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
F PF03946 Ribosomal_L11_N Ribosomal protein L11, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 4iocF00
5GAEJ 2QA4I 1YJNI 2OTJI 4IOAF 2E34A 4IOCF 2ZJQF 1VQ5I 1VQLI 3PIPF 3CC4I 1VQPI 1FOWA 1VQOI 1YHQI 5GAGJ 1QA6A 3CCQI 3CCMI 3CMAI 1YIJI 1VQKI 4V19K 3G6EI 1FOXA 3G71I 2OTLI 1FOYA 1VQMI 2E35A 5GADJ 3CCRI 2NXNB 3CCLI 3PIOF 3CC2I 5DM6F 1S72I 1VQ6I 2H8WA 1Y39A 4IO9F 3CD6I 3I55I 1YITI 1MMSA 3CCSI 2E36A 3J7ZI 3G4SI 2QEXI 3CCJI 2ZJPF 3CMEI 3CCVI 1YI2I 1VQ7I 2JQ7A 1ACIA 1YJ9I 1VQ9I 4UY8I 3CJTB 5GAHJ 5DM7F 1YJWI 3CCEI 3CC7I 5JVGF 3CCUI 2FOWA 2K3FA 3J7YJ 1VQNI 2ZJRF 1VQ4I 1HC8A 3CF5F 3I56I 3DLLF 1VQ8I
chains in the Genus database with same CATH superfamily
1S9HA 3R4KA 4ZYDA 5DS9A 3QPSA 3L2UA 4IOCF 3V4GA 1JT6A 1G3WA 2H6BA 2MLKA 1RUOA 3GTMJ 4XKCA 2CMPA 1ODDA 1GV2A 2BY3A 5E3OA 2N8GA 3PIOF 5LHHA 2JVHA 2CO5A 1PUFA 5CLSA 4X6AJ 1LPQA 9ANTA 1FEXA 1NK2P 1XGOA 1D8KA 4J01A 2R7SA 1IC8A 1R4MB 3PSIA 3M9AA 1F5TA 2VPLA 5A2QZ 1DQUA 1P7IA 3GUDA 3ABTA 3U9GA 2XSDC 3VFZA 4B44A 3SJMA 1AKHB 1P92A 1B9NA 2KFDA 5EYRA 2CQQA 2NVXJ 3RDIA 1FBUA 2QENA 3A02A 2F6CA 4OOIA 3FXKA 1UCRA 4ZTFA 3IRRA 2Y2ZA 4RLQA 4XK4A 3FK7A 2AQEA 3T8RA 2IS2A 2QKMB 4HX7A 2DOFA 2GBYA 2WB1N 4UHTA 3DXJF 3CMEI 2ESHA 3RKQA 2QYOA 5J1YA 1VQ9I 1T38A 3KP7A 5C4JJ 1YG2A 3CCYA 2EZLA 2COMA 4BE2A 2IJLA 4QLCU 2ZXHA 2KRCA 3MVPA 2ZJQF 2Z9OA 5ICGA 1K79A 2L3DA 4P9FA 1IJWC 2EA4A 1QQIA 2IA2A 4YFNF 4IRIA 4A3BJ 2XKPA 4CZZA 4V2GA 4ASNA 4P55A 3SEQA 2LK2A 3ZXSA 1Y1VJ 3ZQ7A 4AC0A 3BTJA 1FT9A 3S1QJ 3WU1B 4OIQF 1XMXA 2O5RA 1XTAA 2FQ3A 2F4MB 3KPHA 5JFRA 4HV5A 4ITVA 3RIRA 2DFHA 2HDDA 3RZOJ 3KP6A 3DKWA 4XONA 4BQQA 5FLVA 1D0ZA 3AAFA 2NXNB 5GP9A 2VOOA 2GWRA 2OV7A 4BQNA 2CW8A 1IN6A 1LNWA 1SMTA 4GYGA 2NNYA 3OV8A 4RB0A 2VBXA 3F6VA 2LR8A 2K9QA 5KAFC 2R0QC 5F6FA 1FSHA 2PMZN 4GGGA 2GXGA 4CYCB 1LDJA 3QYEA 1WJBA 2DJIA 2E1OA 3VYTB 1TC3C 3PL8A 3HOZJ 1X3WB 4IHTA 4XR6A 2GXAA 1SFXA 2EFOA 5LHIA 3CP8A 3E6BA 3I4PA 5L3GA 3MKZA 4BNCA 1IRZA 1Z3XA 2K4JA 4A0YA 2JA7J 3ESWB 5M3MJ 4M6XA 4AIHA 1MBJA 2ZNYA 1U9NA 1J59A 1WKMA 3H9JA 2R7TA 2DPUA 3RKWA 1I1GA 1Y0NA 3HB9A 1X1AA 2CJJA 4Y15A 3TP3A 2NVUB 1IRFA 5FLMJ 5D5XB 5K5OA 1K78A 3ZQQA 2JVGA 4EJTA 5E17F 3CLQA 3M1EA 2Z5UA 2H1KA 3EDPA 2AXTC 4IHWA 1IUYA 4IVNA 2FD5A 3TBIA 2M8EA 1IXRC 1DGRM 1F1ZA 2Z1DA 3E6DA 3HYIA 3P9CA 3PFIA 1JT0A 1T6SA 4XM3A 4MO7A 2DTRA 2AXLA 2XIGA 1O3SA 1YI2I 1FMVA 2BEOA 3GCMA 1KYWA 3KYCB 1OFCX 3H92A 2L54A 1TW3A 3BT9A 3E6MA 4DZJA 3OSFA 2L0KA 2KISA 3QYFA 3D1NI 2DCEA 4OAYA 2G7HA 2OBPA 2W84A 4LLLA 2MG4A 2DA7A 4BHCA 2O7OA 4ANJA 2Y0SN 2X48A 1DP3A 4BJTA 5JLXA 1Z1DA 4BJ6C 4YEJA 2AHQA 3HTUA 2KIQA 4AUXA 3M7GA 2C6YA 4XRMA 2TDXA 1S7OA 3DTIA 5ILSA 3ULQB 1FLIA 4NNJA 2DA6A 3E3VA 1WI3A 2ZMEB 3HM5A 1OYYA 1U5TB 1G8XA 5IP6A 3BOQA 3PO2J 2VKHA 4FASD 1G2HA 3W6VA 2XHKA 4EM2A 2PLYA 4IZZA 5TRDA 4N4NB 5FKOA 2IA0A 3HUGB 4G8XA 4B3AA 3MKYB 1FPQA 1W7PB 3F8MA 1EH6A 2PQ8A 5FD6A 2X6YA 4AYBA 4E6KG 1WH7A 3E7LA 3VWBA 4YFKF 2NOJB 2Y30A 1P7JA 1CF7B 5D4SA 5BNGA 2EFWA 2XGEA 2HYGD 3SXYA 3QU3A 5IT9Z 3OIPA 1VFCA 5CJ9A 3HL2A 3FBIB 1X4PA 2FQ4A 1JKPC 3FISA 4DGWB 5LLQA 4BQAA 1P4XA 2JSPA 4I99C 5JR3A 2VJ5A 5L3BA 2A69F 2DFFA 5LGTA 3GFMA 3NAUA 4M9ZA 4UV9A 1MDMB 1QBJA 4BBSJ 4HF1A 1JJ6C 3J80K 2BXZA 2FNPA 3TKYA 4N0BA 3WE3A 2R7QA 4JBAA 1R36A 5LGUA 5EF6A 3GTOJ 3JAMK 3JRFA 2PBIA 4B4CA 4OIPF 1S3JA 3BG3A 5TISC 4HZFA 2Y31A 1E3OC 4O3MA 1SFKA 2HTSA 1HDPA 3BDDA 1JTYA 1OPCA 3LQRA 5J6XA 4II2A 4UUSA 3V7RA 5DEQA 3GFIA 1YITI 4HQMA 5F1RA 2STTA 4O6JA 4ZDOA 3GEZA 2BY2A 2L01A 2MFZA 3DFGA 1KU7A 1WQ2A 1R49A 4BY7J 4PJNA 2VASA 2LREA 4EJWA 1RKTA 1K61A 2LBFA 1WWXA 3S3MA 4CCLA 2Z99A 2HNHA 2VJIA 5LRRA 1QA6A 5IYBJ 2DT5A 3CMAI 1Z3YA 2XAFA 4XRSG 4YFXF 2E71A 3OYEA 3G6EI 1U8BA 3J7AY 5C44J 1G6NA 4G9YA 3CC2I 1T2KA 1H9GA 3TO9A 1B72A 2HPIA 2GIVA 2K9MA 1BIAA 2WWYA 3VOEA 1S7EA 1K6OA 3CCEI 4L9NA 3QRFF 1QVUA 4RLFA 2UXNA 2IPQX 1R58A 2F5DA 3L9FA 4PJJA 1V54H 1WCMJ 2M34A 2EIJH 3TL4X 4ZZDA 1AOYA 2ZXWH 4FT8A 2BZTA 4GO1A 4E4HA 3S2DJ 2EZIA 4QWQA 4AIKA 1IF1A 4MHGA 1XDUA 1KA8A 1OR7A 1Z6TA 2MD0A 1HSJA 5HDKA 1I50J 2R7VA 4FE7A 1V3FA 2FU4A 3A2KA 3A0BC 1ZK8A 1ETXA 1FNNA 4G12A 4MFEA 3JSPA 3AG3H 3DQVC 2M30A 4BEHA 2YR2A 4A69C 4UUVA 2WY8Q 4A93J 3C2HA 2HDWA 1FTTA 4OIRF 3BC8A 1Q1HA 1TZLA 3H0DA 5DDGA 3E6CC 1A5JA 2R7FA 4IHXA 3G1OA 1RC9A 2W00A 1JHHA 3TW7A 4BHPA 1DU0A 3BTLA 3GX4X 1MJAA 1A04A 5L3FA 2QQBA 1FOYA 2FX0A 2K9SA 4QIWN 3L2RA 2ZMEA 1U0JA 1XGNA 1N77A 4KT6A 1IXSB 4XIDA 1QRYA 3BWGA 1SAXA 2GLOA 4M73A 2ELHA 2OAZA 2QLZA 2XASA 2H09A 2A3SA 1ZN2A 5LHGA 4B1RA 4AVPA 1LEAA 1KGSA 1IGNA 1MIJA 1ZG3A 3G73A 4BHBA 3DKYA 3V7SA 2E5ZA 2WV1A 2W57A 1ZGWA 3K4LA 3EQLF 1E0EA 1T08B 1HQCA 1SD7A 1X3UA 2M0MA 4L18B 2B7EA 4XLHA 4RA2A 4EV0A 1Z91A 4ZJZA 3GWZA 3QPLA 4FHTA 2FUG2 3BY6A 3E97A 3H5RA 5M3FJ 2MGQA 3NARA 4HF2A 4UB8C 5FKLA 1H89C 1PUFB 3LNQA 3PM1A 4PGGA 2XAGA 2R5YB 1MMGA 2KDOA 1B1BA 4RGUA 4KIBA 5IOYA 1MNMC 3AL0C 2M7AA 1X1CA 4XOTA 2IRFG 1TNSA 1ITYA 2V9KA 1OYIA 2Z16A 1MNDA 2BE5F 4CCJA 3BPXA 2DO7A 2DTZA 4NB5A 5J4VA 1S72I 2H8WA 5EEAA 4A0XA 1FSEA 1WJAA 2ZJPF 2V26A 3FMRA 1WGXA 5GAHJ 5EZHA 2VT3A 1VTNC 5EJCA 1ZHFA 1O3QA 1LDKB 1UFMA 1WJFA 4JK1X 2CV2A 4GDFA 1R4NB 3OMYA 1JXSA 1B6AA 5BS6A 2ESNA 1L3LA 4IL6C 5KAIC 1WI9A 4I0BA 5E18F 2LC2A 3CCQI 3AL0B 1XCVA 3U21A 4EGYA 2Z33A 4S04A 3OYNA 1VZ0A 2CGPA 4NQWB 4MTDA 3CDIA 2NS0A 2Y9ZA 2QVOA 2CFXA 4L5IA 4XRFA 4OWRB 2HOTA 2IW5A 5FGMA 4JX5A 1GLNA 2P5VA 5K7HA 1LQ1A 3TGNA 4UVBA 4BGDA 2LY9A 3T1BA 5IOZA 4W1UA 4A0ZA 2ZXJA 3R0AA 2XF7A 2LFBA 3D0SA 3LFKA 3REOA 2EPFA 2EZKA 4XLPF 2EV6A 2NNNA 4D7MA 1DUXC 3K4KA 3HOYJ 1MJ9A 2GQQA 2F5FA 2BV6A 4RM2A 4YG2F 5HVQC 4L0ZB 1OISA 2D1VA 1ZRFA 1V4RA 4OINF 3J7ZI 2IAIA 2FE3A 4V2FA 3CMMA 2CQ7A 2KIUA 2OQRA 5F1JA 1MZBA 4MEYF 2L7MP 3S93A 1NH3A 3M8FA 4DZPA 3O8HA 4LLGF 1X1DA 2FSWA 2NOGA 1R1TA 2EINH 2V4JC 3C7JA 3DTEA 4IX7A 4A3JJ 4FX4A 1H0MA 4Y7NJ 1IW7F 2NRAC 3JTHA 4YIFA 2MABA 5LBQA 4ZYHA 4WK8F 2LH9A 2HKOA 4HV6A 1QVTA 2MH9A 4OU0A 5D5UB 4L0YB 4WXCA 2JJ7A 2F5CA 2R92J 2DMPA 2NAZA 5KK1A 4HRIA 3I0TA 4IRHA 3RI4A 3HHHA 1MSEC 1T0FC 4U87A 4AIJA 1T8IA 1MBHA 4XSZF 4J00A 2R7XA 3FDYA 3CC7I 1K78B 4F93B 2IEKA 2LDUA 3CJRB 2LYCA 2V1UA 3N05A 1YS6A 5HNHA 3HOXJ 4U0WA 3NQOA 4KT5C 4M9XA 1ETOA 1YW9A 1YHQI 2EV5A 1YRNA 2E1MB 1TW2A 2JSCA 2GAUA 3OWTA 2KQRA 2QBYB 2OCCH 3VYUB 5HS8A 1MH4A 2EB7A 1U78A 2O8KA 4LJZF 4NDLA 4XNFA 3WGIA 2WBMA 1KYZA 2XC7A 2HVRA 2JPBA 2M45A 3Q9SA 1X58A 5IYCJ 4ETSA 1Z21A 2L4MA 1E3PA 3FIWA 3MMYB 1RZ4A 2IA1A 5IYDJ 1H9TA 3BTCA 2CRGA 5EG0B 1Z9CA 3GVAA 3MQ0A 1JKRC 3QODA 3DEEA 2HYFA 2GZWA 5EGOA 4DNCA 3F22A 4CCMA 1J75A 5GPCA 2G7UA 4ABZA 1YQAA 1UJ8A 4JX4A 1FIAA 2LD5A 4DBRA 1QZZA 2CUJA 3WTXC 2D2WA 4JQFA 4XRSA 2PFBA 4IPAA 1PYVA 1HOMA 4WXHA 2LKSA 3BZ6A 4N4OB 1U6GA 1NHAA 4IEJA 3AFHA 2A6EF 4QTRA 1AA7A 3DPUA 2A6TA 3ZQLA 1RUNA 1WHUA 3OL3A 3CZ6A 2BW3B 2QWWA 3KP4A 4YRVA 2QZ8A 3IUOA 2YU3A 4FETA 3BR5A 3JRCA 3E0JB 4PJLA 2P5LC 1IUFA 1X2MA 5HS7A 5K5RA 1U5TA 3OS1A 3HKZA 3JSOA 1ACIA 1N75A 4W97A 3IWZA 1RIOH 3CDHA 2PJPA 2V6EA 1EH8A 5EDNA 3A4CA 3HHGA 3IH2A 2O6GE 4BKXA 3F8NA 4L9TA 3H9QA 3QPTA 3RQIA 2DT6A 1ULYA 5JHUA 4RB1A 3DF8A 1R71A 1QU3A 1S29A 3A0HC 3G71I 1LUJB 1YW8A 3O6BB 1ERDA 3LL7A 1ENHA 2E60A 5J8CA 4MFDA 2DDAA 4EJUA 3S14J 5LFAA 1D1BA 2W1OA 1C0WA 5E79C 3LA3A 1HBXG 3LMMA 2ZMEC 4Z6YA 2CSOA 2QQ8A 3CLOA 3EUAA 2VI6A 3RPUA 3K4CA 1XSDA 5H6RA 3M3YJ 1IDYA 4XKBA 3JREA 2ICWG 1HA8A 3LAPA 4AVZA 4D7NA 1BW5A 3R0JA 2PMHA 4F91B 2MH2A 5D5WB 4DOZA 3VEPA 3IRQA 4MIMA 1UELB 1FIPA 2HZDA 3GZNB 2WB1A 1T39A 4CA0A 1GXPA 2OA4A 3K1MA 5B66C 3TMOA 2KDZA 2M3AA 5CVVA 4BAYA 1DPRA 2KT0A 4AU7A 3EUHA 1S6LA 4PSXA 1W36C 3KE2A 1TNTA 1TQPA 4M3DA 3FK6A 2CS3A 1V5EA 4KUMA 2RKHA 1MJBA 1N25A 2P81A 5D5VB 3JAMZ 5L3EA 1DGWY 5LRSA 1VI0A 2BXYA 5L3DA 2K27A 4RGSA 3WG7H 1BR2A 2X6OA 5L3CA 4I02A 3KEYA 3M07A 4G7ZF 2COBA 2YX4A 1J7KA 5TGTA 2QM3A 3S1MJ 1J5YA 2IGMA 3IC7A 2W48A 4L5JA 4M9SA 4C3IJ 1YO5C 3DU6A 4ENMA 1B4AA 3FXRA 3DEUA 2LKXA 3BPVA 3L2QA 2ZJ2A 1BI3A 1HCRA 4B3XA 2GA1A 2BBYA 4E70A 4A3FJ 4KICA 2STWA 3W3CA 1SD6A 2IGKA 2DYRH 3CUQB 1JKQC 2A5WA 3U2RA 1E3HA 1MD0A 1FOKA 1ZELA 4LD5A 3HOSA 2CV0A 3K4NA 1FOXA 4FTHA 3B6AA 2XPUA 1P9QC 1EKEA 2F4IA 2KLOA 2D45A 4Y17A 1D0XA 3WGGA 1ZLJA 3BG5A 5LEKA 5EG0A 3D5RC 2XAUA 4DIQA 2HGCA 2M4KA 5BOXA 1YLFA 3GTQJ 2MC3A 5EEGA 5F0FA 4EM0B 2VKDA 3KETA 2MYSA 6PAXA 4R1HA 4J19A 4HDUA 5DUIA 2HXOA 4S0HB 3OOPA 5FFXA 2UUZA 1ZG1A 1Z77A 3FBNB 3K0LA 3ABMH 2D5VA 1JI8A 5E1XA 2B63J 3K4MA 3LSKA 3QAHA 3T8TA 1AU7A 5J47A 3E1SA 3CESA 1X2NA 1W5SA 3IL2A 1JHFA 1I3QJ 1OCRH 2M8GX 1YIOA 4E7ZA 3BG6A 4PGHA 1AWCA 4BDYA 1TP4A 2O9LA 3K7AJ 3K9TA 2HQ5A 3CC4I 5KHDA 2Q8KA 1B8IA 3R6SA 1X4OA 3CCMI 2GM4A 4U0VA 3IHUA 3P5JA 1QZYA 1S8NA 1MMDA 5LGNA 1D5VA 2TCTA 5HLIA 2EFPA 3H3VK 2DOAA 2DFEA 3BR3A 3RKXA 1BW6A 3RTRA 3A03A 2QQ9A 3NWSA 3FXMA 2XF5A 1D8JA 3BJOA 4MEXF 2VJJA 2LMDA 1LDDA 4A3EJ 3HUGA 3CUOA 1PJRA 3U1DA 2OC6A 1LFPA 1U8RA 4M74A 3Q0VA 3FHNA 4K2EA 1ZGAA 4A3LJ 4XICA 5GADJ 3KYLA 1Z67A 5ICFA 4LB6B 3FHZA 1XGMA 4PDKA 4A5NA 4LGWA 1X3ZB 1MSFC 3M4OJ 3RCOA 5F0CA 2D1HA 2Y0SA 5IY5H 4MNUA 3K2ZA 1MH3A 3FXLA 5E3NA 1B59A 3F21A 4ZDPA 4S05A 4IKFA 3K4BA 1KQ0A 2KP6A 2JA5J 2A05A 4MLOA 3K6GA 4XORA 4E7HA 1BOBA 2K4BA 3OR2C 3N4MA 3GZ5A 4HQEA 4KMUX 3FZVA 1SMYF 1UMQA 1YX5A 4HSRA 3WU0A 1LEBA 3IWFA 1XX5A 3I59A 4XLAA 4BBRJ 3I54A 2HOAA 2GXBA 2LBFB 2LLKA 2Y48A 2VKVA 3F8CA 3BQZA 2HVSA 3CJQB 2ELKA 3BJAA 2PJRA 1EF4A 2VJ4A 4II3A 1RESA 4E7KA 3C2GA 2K9NA 3J81Z 3DV8A 2XROA 1A31A 3MZ8A 2K5CA 2P4WA 2CUEA 3V7CA 1D5YA 2R4GA 1VQPI 1T95A 4L5EA 3WG9A 1BI1A 3DP7A 3KP3A 4ZDLA 4ZYAA 4OMYA 2JRMA 3WHCA 1BI2A 4O5VA 2JK3A 2M0CA 4PJMA 2VONA 2VC1A 3Q0UA 3I71A 3Q5FA 1JKOC 1IV6A 4Q5SF 2DU9A 4MGRA 2FNAA 4XLCA 2E7WA 1MBKA 2BOLA 3WTSC 1OKRA 3VYSB 2NVTJ 2WADA 2R7OA 1V55H 5CVUA 3IKTA 2JA6J 2ZBKA 5J3LA 5GTHC 3ZQCA 1ETYA 3I4MJ 5CYVA 3OYGA 4ESBA 2VXZA 3BLYA 4RAZA 5EEHA 1TQMA 1YX3A 2RQQA 1HKTA 4G6QA 1FZPB 4GFBA 2PMZA 1J2XA 4HNUA 3PQJA 2E35A 2MSYA 2HQNA 1UHMA 2ZCWA 1LFBA 5K7FA 5DCMA 1MMSA 2M1BA 2VBYA 3J7AO 5J4YA 1D1CA 2ZB9A 3OYKA 2EWNA 2FOWA 1VQNI 1FY7A 3EETA 4ENKA 3I5UA 4KISA 2L9VA 5ERIA 3VYRB 1PUEE 2HS5A 1ETKA 4GXOA 1XB4A 3TW6A 3RYPA 4RAFA 5D8LB 1PDNC 5LEJA 1DPUA 2X85A 4PJ0C 2EK5A 2HTJA 1A35A 2QBYA 2FMLA 4A6DA 2RNGA 2OZUA 3BR2A 3GTKJ 1QHHD 1DU6A 4UB6C 3TQNA 2ACJA 1OMIA 1O7LA 5IT9K 1NTCA 4CSWA 3MZHA 5J40A 1D0YA 2OUMA 1Y56A 3BTIA 1I3AA 2X1DA 3UNGC 2WAQA 4Q4ZF 2QSGX 2VUMJ 2XAHA 5E1ZB 2VBZA 1NG7A 3GTGJ 1UZCA 3FXUA 3LWFA 2XSJC 2KZVA 4LK0F 4DBQA 1R5GA 1ZTRA 4LG0A 2X9DA 3W6KB 2R5YA 4QPOA 4A3DJ 1FTZA 4MQ9F 2FBKA 4BS9A 3C1DA 2HQAA 2F48A 1MKMA 1IXCA 3ZMTA 4HEA2 2KMUA 1RR8C 3HOTA 3B6CA 4KMFA 1GXQA 1Z7LA 3P9IA 4KIGA 3ABUA 3ZRGA 5B1BH 3S16J 1U5TC 4KDPA 4C2MJ 3GXOA 2LY2A 4PUSA 3C18A 3KLNA 4XL9A 4F7ZA 3PO3J 3S1NJ 2HOSA 1IO2A 4N9IA 2L9SA 2OTLI 1U3EM 1K4SA 4I76A 2IS6A 1QPIA 4NC6A 3HKZN 1I1SA 3NWTA 3WU2C 4C3JJ 2DMQA 2XGXA 2ZFWA 2P0WA 5ED4A 3DPLC 2DQRA 2CH0A 3F8FA 4ENNA 4BL0B 3E5UA 3P7NA 1BJZA 1VNDA 3MCZA 5FKKA 1IAWA 4BE1A 2DN0A 3DTKA 2A5YB 5D6FA 5FB2A 1KU2A 2GIZA 2XGCA 3ISPA 1T56A 3Q9VA 4FE4A 3TOBA 2FMYA 2PMUA 5HNFA 1JGSA 2R7RA 1E2XA 2AQFA 5F08A 1TLHB 3DEWA 3HSRA 3H3UA 2WY7Q 1Y39A 2EFQA 2DQLA 1UAAA 2XPWA 3HG9A 3J80Z 3GYHX 5K1YA 2GA2A 1YYVA 5BPIA 2OQGA 1IZ1A 1SD4A 2AO9A 1W0TA 2LF7A 4KA4A 2X0LA 2MBFA 1BR1A 4OIOF 1XDSA 1YFHA 2DAOA 3UKGA 3ZMDA 1SD5A 5FLXZ 4CXFA 2F5VA 3ZN1A 4EJVA 5JI6A 3F72A 2HWVA 1MMAA 2HU9A 3EUHC 5IT3A 2IS4A 4EVIA 3ZMSA 4A3IJ 4B48A 1WZ2A 4LIUA 5FKNA 2L9NA 3CF5F 1JUSA 3K1NA 5ICCA 2LG4A 5AONA 3JW4A 2ZSHB 2QCOA 5DD4A 1JJ8C 5F64A 2ZJRF 1HKSA 2VB6A 5CPRB 4BDZA 3LAJA 2CQXA 4M3GA 1PP7U 1W0UA 3EPZA 3ZQHA 1FOWA 1SAUA 2RV8A 4RGRA 2UZKA 4CHUA 3PJRA 4V19K 2CUFA 2RN7A 3COAC 2ME0A 4EJOA 4G7OF 5E3MA 1SVMA 4JP0A 2XB0X 3GW2A 2H8RA 3ELKA 1ZGJA 3OYBA 1W5TA 4U88A 3QOEA 4PK4A 1UHWA 1XD7A 2V1DA 1XCBA 1KU9A 1IN7A 4IF4A 4R79A 3ZN0A 5DD8A 4A5MA 1B9MA 1J0RA 1IN8A 2IBDA 3JTGA 5TJJA 2J5PA 1Z7UA 3LFUA 4ZTJA 3WTYC 3WTVC 1RPWA 3HGGA 4EGZA 3FM5A 3QYBA 2Y0MA 4EEFG 5E8GA 1O7FA 4ESFA 3I4NJ 1XSVA 5BQTA 3CCRI 4N9HA 3KYDB 1D1AA 1N78A 4DW6A 2JZYA 1HW2A 5AIPA 3OS2A 4CICA 4RMNA 1K83J 5GTIC 3ASNH 3G1LA 1W7PD 1YOVB 2JA2A 3LA2A 4LG0B 2VBWA 4QPQA 3G2BA 4ZC3A 3U1KA 2E7XA 1T33A 2P6TA 1ZR4A 2VQLA 4CGZA 1JTXA 2NVYJ 1FP2A 2R5ZA 3V8KA 2B9SA 1R9TJ 2KPMA 3CUQC 2DI3A 3OYAA 4DYQA 4BEHB 1XPXA 4LITA 5H6QA 3PUFA 3SZTA 1WH5A 3AG2H 1EV7A 2QSHX 2AS5F 1U9OA 2CUZA 2ZC2A 1TWGJ 2DMTA 2LF8A 4CCOA 5LD2C 3LSIA 2RNJA 1I5ZA 4ESJA 5K7ZA 2PN6A 2LRDA 3ZQGA 1YRNB 1G4DA 5CVRA 2V9VA 1VQ8I 2RREA 3IKVA 3R60A 5H20A 1F36A 2K85A 3OL4A 3J81K 3L2VA 1MNEA 3H9GA 1WSUA 1SFUA 3FXQA 1TWAJ 3GLXA 2DW4A 3PNVA 1Y8QB 3JRIA 3GTPJ 4OAZA 3S17J 2L4AA 1ZARA 3F8BA 2P6SA 1RETA 1T98A 1SC7A 2EH3A 4XBFA 4EM1A 1IV8A 3SDGA 3CCJI 3S1RJ 1BC7C 1X1PA 2HR3A 1FWZA 1YJWI 3A01B 3WHBA 2YPRA 1S7AA 4M3EA 5M5WJ 1OCCH 4LMYA 3ZP5A 1HC8A 2VL8A 3NEUA 1GDTA 2X1EA 4BXFA 2H1LA 3F9KA 5F27A 2ECBA 1IDZA 2PJRB 3O8GA 3KFWX 5DCFA 2F5EA 1JE8A 1AHDP 1Y0UA 5J1RA 3HTSB 4Q47A 3G3ZA 3ML6A 3HPHA 5HS9A 2R93J 3OS0A 3BZKA 5BPDA 4NHJA 1APLC 2JQ7A 1UHSA 2CW7A 3IAM2 3AKZA 2LTPA 3CO7C 1GT0C 1R00A 2EILH 4A3KJ 3HRSA 4HLYA 1I39A 1O57A 3A1YA 2Y69H 1TT0A 2R7UA 3OYFA 1HLVA 2H27A 4B8XA 2TRTA 4CYDA 3H35A 3P9KA 4BU2A 4WF2A 2UXXA 1LE8A 1P6RA 2V9PA 1U2WA 3ABKH 3RPUD 1ETQA 3I53A 2EBIA 1SVLA 2P8TA 3DBLB 1R5HA 4PFPA 4KN7X 4F52A 4HG2A 2Z3YA 1CGPA 5E3LA 3HXLA 3HOUJ 2QSFX 2JUCA 4HOBA 3B73A 3S8PA 2IGOA 2XDVA 3MKWB 2BVMA 3F0CA 2LVSA 3GFJA 4HBLA 2VQCA 1ZRCA 3KCCA 5IP7J 4BQOA 1O3TA 1KQ9A 1ETWA 4JYKA 5ICEA 1MMNA 4CO8A 2YS9A 3FF5A 2YU9J 1GVJA 1X1BA 4YIRX 3CP2A 4AIDA 1Z05A 1BC8C 3ROUA 1FX7A 2O8XA 5EZGA 5JHFA 4RB3C 3FMQA 2YX7A 3HBLA 2E2JJ 3HGYA 3LQQA 3SYTA 3SQNA 2A61A 4HPQA 4FCYA 1EH7A 2HEOA 4BUPA 2HZTA 1A36A 2YSRA 3WTUC 3S15J 2X4HA 2XB5A 3V42A 3PNTA 2A07F 2VE8A 2QF7A 5DCMB 5FJ8J 2DBBA 3MAJA 5HDNA 3GFLA 1NK3P 1VQKI 1TWFJ 2JN6A 3OYIA 3JRHA 2BYVE 4RGXA 4I09A 5FKMA 1W36D 5DM6F 4BXXJ 4EMSA 2P7CB 2HYJA 3HIFA 2ZFUA 1G3YA 3JRAA 3LOCA 3Q0WA 1Z6RA 2QEXI 2E2HJ 2Q2EB 1FYMA 3CJTB 2DK5A 1KQ8A 1UB9A 2RAEA 1RKWA 4IQ4A 3ZQIA 4UVAA 3W2WA 2K9LA 4HAMA 3F23A 2PI0A 5D6EA 2XVCA 2K40A 2E1MC 2M4GA 3MZYA 1XS9A 2ZO4A 3JCUC 5CQGA 1K7AA 2M9HA 2L7ZA 2DOEA 2JUGA 3WODF 3HRMA 1H88C 1MGTA 2O03A 3H5NA 5DTDA 2LY1A 4XLNF 3HPGA 3IH3A 4I01A 2HPMA 1B8IB 1IG7A 5JVGF 3K10A 1FP1D 3DLAA 2HKXA 2KRHA 2E5NA 3TDUC 3LSPA 2E1CA 1LKXA 4X0GA 3OIQA 3IP4B 2XKOA 2F2EA 4GCVA 4E7SA 2EIKH 1TQIA 1HW5A 3MWMA 2NS8A 1TL8A 1HW1A 2DDBA 4NC7A 4RDUA 1MBFA 3VODA 4HDVA 4YIIA 2WAFA 3T0YA 5B3SH 2DYSH 4ENJA 2V1XA 1GUUA 1YE9A 4D0PA 2ADUA 4ZYEA 3OY9A 1MDMA 4AM3A 5KVRA 1XN7A 4D5FA 1HSTA 1K4TA 3BROA 3I64A 2BY0A 1Y6IA 3LSMA 4M3FA 4RAYA 3WGHA 5D4RA 4IHYA 1QPMA 4IRGA 2RC4A 2OZ6A 3JRBA 1BI0A 1R22A 2ECCA 2ME6A 3GTLJ 4P96A 2X6XA 3R61A 1X19A 5CKTA 4IQJA 1HKQA 4KIFA 1LVKA 1LE8B 3ZPLA 2CQNA 2DA1A 2DA4A 3BCBA 4B43A 1HF0A 3AG1H 4Y13A 2CG4A 4LFUA 3WE2A 2ZXIA 5FFZA 4UUSB 2IXSA 5J1UA 1ON2A 3W2VA 4Y4RA 5HLGA 3S2HJ 1SEUA 1A6QA 3O2PE 3I59B 5DV5A 1ZREA 1M1EB 4AD9A 2ZSIB 4PCQA 3EUKL 3ZMUA 2RDPA 3D5SC 2I5UA 3K4JA 3HRTA 4F3QA 5HLHA 3TEDA 1LFUP 2FXAA 4WWCA 3LSHA 4HX8A 1W4MA 1ZR2A 1ON1A 1F4KA 1QGPA 3DKXA 2ISZA 4Q48A 2CU7A 3HC7A 2X1CA 4TV7A 4R8HA 1SVOA 2OPTA 4NBQA 1VQLI 1UG0A 1O3RA 3ZCOA 3L1PA 4M6VA 4FQGA 4UNOA 3QOPA 3AG4H 3JRDA 4E7JA 2MD5A 3CCLI 1YS7A 2W25A 4Y3OA 4CYCA 2ISYA 2L7FP 3RZDJ 3KZZA 2FEZA 3IH4A 3W6JB 3MEXA 3HEFA 4PSWA 1NG6A 3TO6A 3CCUI 4WXDA 2HQRA 4PFOA 1BN5A 4EATA 3LSJA 2QA4I 3QWLA 2BVLA 3ZQFA 3KEQA 2XRNA 4D1QA 1WFXA 2LNBA 3L2WA 2L02A 3QP5A 3DBRB 3ERMA 3BCAA 4P5OA 3FX3A 3RKYA 5J8FA 1J09A 2XV4S 2Y75A 3ZMVA 3VSKA 3QQAA 3MFKA 4P9UA 2R5ZB 1IRXA 3OIOA 4UV8A 2JRTA 2W82A 3VSLA 4LLNA 2KJBA 1WJ5A 1UG2A 2DMUA 2FBHA 2P7VB 4M71A 4XN3A 2HFHA 1OR7C 4XN0A 2FA5A 5AIQA 3L09A 1R7JA 3CDLA 5B5EC 4F92B 1RI7A 2QQAA 2VN2A 3PIPF 3K70C 5GAGJ 1FYKA 3L00A 2FF4A 1HXDA 1W5CC 3O3KA 5FRMA 3I3LA 4CCNA 2FJ1A 2K86A 2JA8J 2I10A 4XKVA 2W7NA 4C2TA 1OCOH 2WV0A 4HX4A 1VF9A 2VIXA 4B47A 3CCVI 1ORKA 2DA5A 3CUQA 4HF0A 2M87A 1PVEA 2W4SA 1VQ4I 5FLXK 4G6TB 1ZYRF 1I27A 2OTJI 2O3FA 4BACA 2VPRA 4CZCA 2H94A 1W7PA 4XMYA 2XAJA 4FX0A 3A01A 1GHCA 4XKWA 4RBOA 1BA5A 3ERED 3N97A 2G9WA 4U7DA 4Z2YA 2QKLB 1BR4A 3HRUA 2I8DA 4BYYA 2ELJA 2MLGA 1OYWA 4I7HA 4F55A 3GO5A 1K6YA 4RAGA 4HNTA 2VOPA 1E17A 3KZYA 3OR1C 4I0AA 2CFOA 2LOOA 1A6IA 5F0HA 3OYLA 4A6EA 1R23A 1G3SA 3DU5A 2KIMA 3K1PA 3I56I 3VPRA 2VQHA 2IT0A 2BY1A 2EJRA 4NUBA 5ILUA 2A68F 2K02A 1LB2A 3KX2A 4L9JA 2IGNA 3ONQA 4QSHA 2FRHA 2WTEA 1JUMA 2CQKA 4HYEA 2CV1A 1WVRA 5H2FC 2BHYA 3GBGA 3IAS2 3EYYA 1FJLA 4RB2C 1V5GA 1CF7A 1HDDC 4XLEA 1P4WA 1TT5B 3HOVJ 4UY8I 5DM7F 3SEZA 5B1AH 4Y52J 2K3FA 2L2OA 3M8JA 5GAEJ 3L2CA 4CCKA 2KZGA 2JMWA 2P5KA 3FM3A 5IPAA 3K69A 3FWEA 4DQ2A 3H3ZA 2DPDA 3SFIA 2W85A 1L0OC 4G94A 1F9NA 2XGDA 3ZR8X 2OJED 1YIJI 2JPCA 4A12A 3K2AA 2DXIA 1XMAA 3FXOA 4RM3A 4KJZA 3VB2A 3OYMA 1DDNA 2IP2A 2JTVA 3RJPA 1JGGA 3QU6A 3IV5A 2R7WA 1XC5A 4E7LA 3CD6I 1G3TA 3E5QA 4IJAA 4M3BA 2K3PA 4FISA 3VDXA 1Y8RB 5KCMA 3SDBA 1YJ9I 2WA0A 1GV5A 4C30A 4BY1J 3X2QH 2O61A 4LIVA 3H1CA 1V5FA 3PQKA 1P2FA 2BHZA 3KP5A 1I6HJ 2V79A 3OYJA 1BL0A 1ZQ3P 3HSEA 3T5XA 3ZOBA 4BE0A 2J5OA 4U7BA 1D3YA 2JWTA 5CVIA 4C9YA 5GPAA 4A3CJ 4A3GJ 2E19A 3ASOH 4M72A 4DJAA 2M7BA 3QP6A 3QPHA 2ID3A 5E20A 2DODA 1Y1WJ 2CWEA 3PSFA 3I55I 1BJAA 2PG4A 5FD5A 2GOMA 2XPVA 1IRGA 4L9VA 5CVJA 2H6CA 1MW7A 3UR3C 3KZIC 4CUGA 3H0GJ 5E8IA 3DLLF 3JR9A 2E2IJ 2Q2EA 3BR6A 2NYXA 3F6OA 4HNVA 2IVMA 1FBSA 4UUTA 2UV1A 1KU3A 4DYRA 2IS1A 3F3XA 4E7IA 1S5LC 5K5QA 1R1VA 4H0EA 1EA3A 2EV0A 1VQMI 4LK1F 1O4XA 4ON0A 4A2UA 1FYLA 2FOKA 2ZKZA 4X1EA 1KONA 3ZGKA 4RS8A 2MA3A 2HDCA 1VQ7I 3MN2A 2VC0A 2V6CA 3HOWJ 2ZNZA 2HXIA 3BP8A 2MC4A 1REPC 3SZPA 4YELA 4WX9A 4BJ5C 2XAQA 3FXJA 2VLAA 1F43A 2XF6A 2VQGA 2XUBA 3S3OA 1CQTA 4XLFA 4NC8A 3S32A 4OMZA 2X51A 3H5AA 2LKPA 3OOUA 3EYIA 5FRNA 5JVTA 2DK8A 4D9JA 3GLLA 3CCSI 2E36A 2XRLA 1PP8F 1WJDA 3W2AA 4C2UA 4I2OA 1RRJA 3TP0A 3KP2A 4IHVA 2NVQJ 3HZJA 4IO9F 5HLTA 3DWLE 2DLLA 3CO6C 4I6ZA 1MBEA 5M5YJ 2OF7A 4IOAF 3D5LA 4ZYGA 1WJCA 1ZLKA 2HI3A 2QGUA 3Q3SA 1OLTA 1ZKGA 1TWHJ 1BBYA 4XOPA 3WTTC 4HLXA 1YW7A 2B0LA 1RNLA 3CQZJ 1H8AC 3L7WA 2M2EA 2V1NA 4JX6A 3BR1A 1TBXA 1FC3A 1IN4A 5M5XJ 3V8LA 2BW3A 2M5WA 1JUPA 1BIBA 3BR0A 4ZZLA 3M1CA 3I9V2 3GZ6A 3KIOA 1OJLA 1SFEA 3S3NA 1WRJA 2KL4A 2RVCA 3MKLA 4WCGA 4CDGA 1VQOI 1TWCJ 3GMEA 4GRIA 4AYBN 4HSTA 2KRFA 1QNTA 1RR7A 4I98B 4D5CA 2OU2A 3BQYA 1OCZH 1R1UA 2OCEA 4BH9A 4A3MJ 2RGVA 4IHSA 4CH7A 5C3EJ 3KEOA 3BG7A 3G4SI 2VKEA 1KZHA 2BGCA 3OYCA 2VT2A 1MBGA 4NQWA 3HDDA 2L5QA 2VXDA 2R7DA 1YJNI 2KHMA 5CQEA 1OCTC 3BG9A 3CJNA 1XSXA 5F04A 1XMKA 3LSGA 3CTAA 1YTYA 3BJ6A 4G6DA 1ZRDA 1XGSA 4IXAA 4ZH4F 2PX9A 5D8KB 2Z2SB 1BM9A 2YUSA 1AKHA 5IP9J 4UXNA 5HOOA 2V7FA 2R7ZJ 4H4KC 1W1WE 2KJCA 1ONVA 3K70D 2A6HF 3SZGA 4BXUA 1R6RA 3WTWC 2E1NA 5HDGA 3TO7A 4LB5A 3DPTA 3CMYA 2DFIA 1TTYA 3ABLH 3PUBA 3C2BA 3TOAA 2JT1A 5ILVA 2RQPA 5C4XJ 1IN5A 1WPKA 3M8EA 4AWXB 1LVAA 4U0YA 3V8JA 2G0EA 3E5XA 1ZAOA 2UWMA 1STZA 3MD2A 2DMNA 2LP0A 1QHGA 3RQ4A 2CW0F 4EQQA 5HODA 2HOEA 2Y9YA 3J7YJ 3GTJJ 3G1MA 2Q1ZB 4Y33A 3OYHA 1Z0XA 3DBHB 5FROA 3FMSA 2E34A 3DCFA 1BOAA 1P4AA 1R5ID 2GOXB 2W24A 1USTA 2WC2A 2DJNA 1WJEA 3CF2A 3JRGA 2K7LA 2DT7B 4GYIA 4HW0A 1VQ6I 1DP7P 4LOCA 2NS7A 3KLOA 2VODA 2VE9A 5FO5A 2EQRA 4B09A 4M6YA 2DA2A 4P1WA 1ZG5A 4XQFA 2ETHA 4XSXF 1FBQA 4KN4X 4KYWA 3OSGA 4DYCA 3LSTA 4MTEA 2FBIA 4KFCA 1I6XA 3RSNA 3OYDA 2L9RA 2X6WA 3C3WA 1QZEA 1T0FA 2QUFA 4MQVA 1POGA 1ZH5A 4HA8A 1GVDA 2OD5A 3FKIJ 1OQYA 1SFOJ 3HSFA 3ZMZA 2EFNA 2ID6A 2MW8A 4C3HJ 3NRVA 3SFZA 3FKJA 1SANA 2EA2A 2F4OB 3H36A 2L7KA 4JOMA 3BZCA 3PNYA 2EIMH 5EGOB 3LSRA 5BMZA 5E1WA 2LSOA 2CYYA 2EZHA 1ETVA 4UVCA 2KKOA 1USSA 5DYMA 1VQ5I 1G59A 4G7HF 1B72B 1J9IA 3GF2A 1Q1VA 1FMWA 3ECHA 2Q0OA 5A2QK 3I58A 3WTZA 4LG3A 3RYRA 1OCPA 2WAEA 1QO0D 4KNYA 2WAQN 2KIFA 5DUKA 4PZJA 2PEXA 2DA3A 3ECOA 3S2WA 3HJEA 3TDZC 5KNLA 3LA7A 2R3SA 2HVQA 3PFYA 1LJ9A 3RPQA 1EJ9A 1XG1A 3SHFA 4KITB 5JLWA 2O0YA 3B02A
chains in the Genus database with same CATH topology
5GAEJ 2QA4I 1YJNI 2OTJI 4IOAF 2E34A 4IOCF 2ZJQF 1VQ5I 1VQLI 3PIPF 3CC4I 1VQPI 1FOWA 1VQOI 1YHQI 5GAGJ 1QA6A 3CCQI 3CCMI 3CMAI 1YIJI 1VQKI 4V19K 3G6EI 1FOXA 3G71I 2OTLI 1FOYA 1VQMI 2E35A 5GADJ 3CCRI 2NXNB 3CCLI 3PIOF 3CC2I 5DM6F 1S72I 1VQ6I 2H8WA 1Y39A 4IO9F 3CD6I 3I55I 1YITI 1MMSA 3CCSI 2E36A 3J7ZI 3G4SI 2QEXI 3CCJI 2ZJPF 3CMEI 3CCVI 1YI2I 1VQ7I 2JQ7A 1ACIA 1YJ9I 1VQ9I 4UY8I 3CJTB 5GAHJ 5DM7F 1YJWI 3CCEI 3CC7I 5JVGF 3CCUI 2FOWA 2K3FA 3J7YJ 1VQNI 2ZJRF 1VQ4I 1HC8A 3CF5F 3I56I 3DLLF 1VQ8I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GAE J;  2QA4 I;  1YJN I;  2OTJ I;  4IOA F;  2E34 A;  4IOC F;  2ZJQ F;  1VQ5 I;  1VQL I;  3PIP F;  3CC4 I;  1VQP I;  1FOW A;  1VQO I;  1YHQ I;  5GAG J;  1QA6 A;  3CCQ I;  3CCM I;  3CMA I;  1YIJ I;  1VQK I;  4V19 K;  3G6E I;  1FOX A;  3G71 I;  2OTL I;  1FOY A;  1VQM I;  2E35 A;  5GAD J;  3CCR I;  2NXN B;  3CCL I;  3PIO F;  3CC2 I;  5DM6 F;  1S72 I;  1VQ6 I;  2H8W A;  1Y39 A;  4IO9 F;  3CD6 I;  3I55 I;  1YIT I;  1MMS A;  3CCS I;  2E36 A;  3J7Z I;  3G4S I;  2QEX I;  3CCJ I;  2ZJP F;  3CME I;  3CCV I;  1YI2 I;  1VQ7 I;  2JQ7 A;  1ACI A;  1YJ9 I;  1VQ9 I;  4UY8 I;  3CJT B;  5GAH J;  5DM7 F;  1YJW I;  3CCE I;  3CC7 I;  5JVG F;  3CCU I;  2FOW A;  2K3F A;  3J7Y J;  1VQN I;  2ZJR F;  1VQ4 I;  1HC8 A;  3CF5 F;  3I56 I;  3DLL F;  1VQ8 I; 
#chains in the Genus database with same CATH topology
 1S9H A;  3R4K A;  4ZYD A;  5DS9 A;  3QPS A;  3L2U A;  4IOC F;  3V4G A;  1JT6 A;  1G3W A;  2H6B A;  2MLK A;  1RUO A;  3GTM J;  4XKC A;  2CMP A;  1ODD A;  1GV2 A;  2BY3 A;  5E3O A;  2N8G A;  3PIO F;  5LHH A;  2JVH A;  2CO5 A;  1PUF A;  5CLS A;  4X6A J;  1LPQ A;  9ANT A;  1FEX A;  1NK2 P;  1XGO A;  1D8K A;  4J01 A;  2R7S A;  1IC8 A;  1R4M B;  3PSI A;  3M9A A;  1F5T A;  2VPL A;  5A2Q Z;  1DQU A;  1P7I A;  3GUD A;  3ABT A;  3U9G A;  2XSD C;  3VFZ A;  4B44 A;  3SJM A;  1AKH B;  1P92 A;  1B9N A;  2KFD A;  5EYR A;  2CQQ A;  2NVX J;  3RDI A;  1FBU A;  2QEN A;  3A02 A;  2F6C A;  4OOI A;  3FXK A;  1UCR A;  4ZTF A;  3IRR A;  2Y2Z A;  4RLQ A;  4XK4 A;  3FK7 A;  2AQE A;  3T8R A;  2IS2 A;  2QKM B;  4HX7 A;  2DOF A;  2GBY A;  2WB1 N;  4UHT A;  3DXJ F;  3CME I;  2ESH A;  3RKQ A;  2QYO A;  5J1Y A;  1VQ9 I;  1T38 A;  3KP7 A;  5C4J J;  1YG2 A;  3CCY A;  2EZL A;  2COM A;  4BE2 A;  2IJL A;  4QLC U;  2ZXH A;  2KRC A;  3MVP A;  2ZJQ F;  2Z9O A;  5ICG A;  1K79 A;  2L3D A;  4P9F A;  1IJW C;  2EA4 A;  1QQI A;  2IA2 A;  4YFN F;  4IRI A;  4A3B J;  2XKP A;  4CZZ A;  4V2G A;  4ASN A;  4P55 A;  3SEQ A;  2LK2 A;  3ZXS A;  1Y1V J;  3ZQ7 A;  4AC0 A;  3BTJ A;  1FT9 A;  3S1Q J;  3WU1 B;  4OIQ F;  1XMX A;  2O5R A;  1XTA A;  2FQ3 A;  2F4M B;  3KPH A;  5JFR A;  4HV5 A;  4ITV A;  3RIR A;  2DFH A;  2HDD A;  3RZO J;  3KP6 A;  3DKW A;  4XON A;  4BQQ A;  5FLV A;  1D0Z A;  3AAF A;  2NXN B;  5GP9 A;  2VOO A;  2GWR A;  2OV7 A;  4BQN A;  2CW8 A;  1IN6 A;  1LNW A;  1SMT A;  4GYG A;  2NNY A;  3OV8 A;  4RB0 A;  2VBX A;  3F6V A;  2LR8 A;  2K9Q A;  5KAF C;  2R0Q C;  5F6F A;  1FSH A;  2PMZ N;  4GGG A;  2GXG A;  4CYC B;  1LDJ A;  3QYE A;  1WJB A;  2DJI A;  2E1O A;  3VYT B;  1TC3 C;  3PL8 A;  3HOZ J;  1X3W B;  4IHT A;  4XR6 A;  2GXA A;  1SFX A;  2EFO A;  5LHI A;  3CP8 A;  3E6B A;  3I4P A;  5L3G A;  3MKZ A;  4BNC A;  1IRZ A;  1Z3X A;  2K4J A;  4A0Y A;  2JA7 J;  3ESW B;  5M3M J;  4M6X A;  4AIH A;  1MBJ A;  2ZNY A;  1U9N A;  1J59 A;  1WKM A;  3H9J A;  2R7T A;  2DPU A;  3RKW A;  1I1G A;  1Y0N A;  3HB9 A;  1X1A A;  2CJJ A;  4Y15 A;  3TP3 A;  2NVU B;  1IRF A;  5FLM J;  5D5X B;  5K5O A;  1K78 A;  3ZQQ A;  2JVG A;  4EJT A;  5E17 F;  3CLQ A;  3M1E A;  2Z5U A;  2H1K A;  3EDP A;  2AXT C;  4IHW A;  1IUY A;  4IVN A;  2FD5 A;  3TBI A;  2M8E A;  1IXR C;  1DGR M;  1F1Z A;  2Z1D A;  3E6D A;  3HYI A;  3P9C A;  3PFI A;  1JT0 A;  1T6S A;  4XM3 A;  4MO7 A;  2DTR A;  2AXL A;  2XIG A;  1O3S A;  1YI2 I;  1FMV A;  2BEO A;  3GCM A;  1KYW A;  3KYC B;  1OFC X;  3H92 A;  2L54 A;  1TW3 A;  3BT9 A;  3E6M A;  4DZJ A;  3OSF A;  2L0K A;  2KIS A;  3QYF A;  3D1N I;  2DCE A;  4OAY A;  2G7H A;  2OBP A;  2W84 A;  4LLL A;  2MG4 A;  2DA7 A;  4BHC A;  2O7O A;  4ANJ A;  2Y0S N;  2X48 A;  1DP3 A;  4BJT A;  5JLX A;  1Z1D A;  4BJ6 C;  4YEJ A;  2AHQ A;  3HTU A;  2KIQ A;  4AUX A;  3M7G A;  2C6Y A;  4XRM A;  2TDX A;  1S7O A;  3DTI A;  5ILS A;  3ULQ B;  1FLI A;  4NNJ A;  2DA6 A;  3E3V A;  1WI3 A;  2ZME B;  3HM5 A;  1OYY A;  1U5T B;  1G8X A;  5IP6 A;  3BOQ A;  3PO2 J;  2VKH A;  4FAS D;  1G2H A;  3W6V A;  2XHK A;  4EM2 A;  2PLY A;  4IZZ A;  5TRD A;  4N4N B;  5FKO A;  2IA0 A;  3HUG B;  4G8X A;  4B3A A;  3MKY B;  1FPQ A;  1W7P B;  3F8M A;  1EH6 A;  2PQ8 A;  5FD6 A;  2X6Y A;  4AYB A;  4E6K G;  1WH7 A;  3E7L A;  3VWB A;  4YFK F;  2NOJ B;  2Y30 A;  1P7J A;  1CF7 B;  5D4S A;  5BNG A;  2EFW A;  2XGE A;  2HYG D;  3SXY A;  3QU3 A;  5IT9 Z;  3OIP A;  1VFC A;  5CJ9 A;  3HL2 A;  3FBI B;  1X4P A;  2FQ4 A;  1JKP C;  3FIS A;  4DGW B;  5LLQ A;  4BQA A;  1P4X A;  2JSP A;  4I99 C;  5JR3 A;  2VJ5 A;  5L3B A;  2A69 F;  2DFF A;  5LGT A;  3GFM A;  3NAU A;  4M9Z A;  4UV9 A;  1MDM B;  1QBJ A;  4BBS J;  4HF1 A;  1JJ6 C;  3J80 K;  2BXZ A;  2FNP A;  3TKY A;  4N0B A;  3WE3 A;  2R7Q A;  4JBA A;  1R36 A;  5LGU A;  5EF6 A;  3GTO J;  3JAM K;  3JRF A;  2PBI A;  4B4C A;  4OIP F;  1S3J A;  3BG3 A;  5TIS C;  4HZF A;  2Y31 A;  1E3O C;  4O3M A;  1SFK A;  2HTS A;  1HDP A;  3BDD A;  1JTY A;  1OPC A;  3LQR A;  5J6X A;  4II2 A;  4UUS A;  3V7R A;  5DEQ A;  3GFI A;  1YIT I;  4HQM A;  5F1R A;  2STT A;  4O6J A;  4ZDO A;  3GEZ A;  2BY2 A;  2L01 A;  2MFZ A;  3DFG A;  1KU7 A;  1WQ2 A;  1R49 A;  4BY7 J;  4PJN A;  2VAS A;  2LRE A;  4EJW A;  1RKT A;  1K61 A;  2LBF A;  1WWX A;  3S3M A;  4CCL A;  2Z99 A;  2HNH A;  2VJI A;  5LRR A;  1QA6 A;  5IYB J;  2DT5 A;  3CMA I;  1Z3Y A;  2XAF A;  4XRS G;  4YFX F;  2E71 A;  3OYE A;  3G6E I;  1U8B A;  3J7A Y;  5C44 J;  1G6N A;  4G9Y A;  3CC2 I;  1T2K A;  1H9G A;  3TO9 A;  1B72 A;  2HPI A;  2GIV A;  2K9M A;  1BIA A;  2WWY A;  3VOE A;  1S7E A;  1K6O A;  3CCE I;  4L9N A;  3QRF F;  1QVU A;  4RLF A;  2UXN A;  2IPQ X;  1R58 A;  2F5D A;  3L9F A;  4PJJ A;  1V54 H;  1WCM J;  2M34 A;  2EIJ H;  3TL4 X;  4ZZD A;  1AOY A;  2ZXW H;  4FT8 A;  2BZT A;  4GO1 A;  4E4H A;  3S2D J;  2EZI A;  4QWQ A;  4AIK A;  1IF1 A;  4MHG A;  1XDU A;  1KA8 A;  1OR7 A;  1Z6T A;  2MD0 A;  1HSJ A;  5HDK A;  1I50 J;  2R7V A;  4FE7 A;  1V3F A;  2FU4 A;  3A2K A;  3A0B C;  1ZK8 A;  1ETX A;  1FNN A;  4G12 A;  4MFE A;  3JSP A;  3AG3 H;  3DQV C;  2M30 A;  4BEH A;  2YR2 A;  4A69 C;  4UUV A;  2WY8 Q;  4A93 J;  3C2H A;  2HDW A;  1FTT A;  4OIR F;  3BC8 A;  1Q1H A;  1TZL A;  3H0D A;  5DDG A;  3E6C C;  1A5J A;  2R7F A;  4IHX A;  3G1O A;  1RC9 A;  2W00 A;  1JHH A;  3TW7 A;  4BHP A;  1DU0 A;  3BTL A;  3GX4 X;  1MJA A;  1A04 A;  5L3F A;  2QQB A;  1FOY A;  2FX0 A;  2K9S A;  4QIW N;  3L2R A;  2ZME A;  1U0J A;  1XGN A;  1N77 A;  4KT6 A;  1IXS B;  4XID A;  1QRY A;  3BWG A;  1SAX A;  2GLO A;  4M73 A;  2ELH A;  2OAZ A;  2QLZ A;  2XAS A;  2H09 A;  2A3S A;  1ZN2 A;  5LHG A;  4B1R A;  4AVP A;  1LEA A;  1KGS A;  1IGN A;  1MIJ A;  1ZG3 A;  3G73 A;  4BHB A;  3DKY A;  3V7S A;  2E5Z A;  2WV1 A;  2W57 A;  1ZGW A;  3K4L A;  3EQL F;  1E0E A;  1T08 B;  1HQC A;  1SD7 A;  1X3U A;  2M0M A;  4L18 B;  2B7E A;  4XLH A;  4RA2 A;  4EV0 A;  1Z91 A;  4ZJZ A;  3GWZ A;  3QPL A;  4FHT A;  2FUG 2;  3BY6 A;  3E97 A;  3H5R A;  5M3F J;  2MGQ A;  3NAR A;  4HF2 A;  4UB8 C;  5FKL A;  1H89 C;  1PUF B;  3LNQ A;  3PM1 A;  4PGG A;  2XAG A;  2R5Y B;  1MMG A;  2KDO A;  1B1B A;  4RGU A;  4KIB A;  5IOY A;  1MNM C;  3AL0 C;  2M7A A;  1X1C A;  4XOT A;  2IRF G;  1TNS A;  1ITY A;  2V9K A;  1OYI A;  2Z16 A;  1MND A;  2BE5 F;  4CCJ A;  3BPX A;  2DO7 A;  2DTZ A;  4NB5 A;  5J4V A;  1S72 I;  2H8W A;  5EEA A;  4A0X A;  1FSE A;  1WJA A;  2ZJP F;  2V26 A;  3FMR A;  1WGX A;  5GAH J;  5EZH A;  2VT3 A;  1VTN C;  5EJC A;  1ZHF A;  1O3Q A;  1LDK B;  1UFM A;  1WJF A;  4JK1 X;  2CV2 A;  4GDF A;  1R4N B;  3OMY A;  1JXS A;  1B6A A;  5BS6 A;  2ESN A;  1L3L A;  4IL6 C;  5KAI C;  1WI9 A;  4I0B A;  5E18 F;  2LC2 A;  3CCQ I;  3AL0 B;  1XCV A;  3U21 A;  4EGY A;  2Z33 A;  4S04 A;  3OYN A;  1VZ0 A;  2CGP A;  4NQW B;  4MTD A;  3CDI A;  2NS0 A;  2Y9Z A;  2QVO A;  2CFX A;  4L5I A;  4XRF A;  4OWR B;  2HOT A;  2IW5 A;  5FGM A;  4JX5 A;  1GLN A;  2P5V A;  5K7H A;  1LQ1 A;  3TGN A;  4UVB A;  4BGD A;  2LY9 A;  3T1B A;  5IOZ A;  4W1U A;  4A0Z A;  2ZXJ A;  3R0A A;  2XF7 A;  2LFB A;  3D0S A;  3LFK A;  3REO A;  2EPF A;  2EZK A;  4XLP F;  2EV6 A;  2NNN A;  4D7M A;  1DUX C;  3K4K A;  3HOY J;  1MJ9 A;  2GQQ A;  2F5F A;  2BV6 A;  4RM2 A;  4YG2 F;  5HVQ C;  4L0Z B;  1OIS A;  2D1V A;  1ZRF A;  1V4R A;  4OIN F;  3J7Z I;  2IAI A;  2FE3 A;  4V2F A;  3CMM A;  2CQ7 A;  2KIU A;  2OQR A;  5F1J A;  1MZB A;  4MEY F;  2L7M P;  3S93 A;  1NH3 A;  3M8F A;  4DZP A;  3O8H A;  4LLG F;  1X1D A;  2FSW A;  2NOG A;  1R1T A;  2EIN H;  2V4J C;  3C7J A;  3DTE A;  4IX7 A;  4A3J J;  4FX4 A;  1H0M A;  4Y7N J;  1IW7 F;  2NRA C;  3JTH A;  4YIF A;  2MAB A;  5LBQ A;  4ZYH A;  4WK8 F;  2LH9 A;  2HKO A;  4HV6 A;  1QVT A;  2MH9 A;  4OU0 A;  5D5U B;  4L0Y B;  4WXC A;  2JJ7 A;  2F5C A;  2R92 J;  2DMP A;  2NAZ A;  5KK1 A;  4HRI A;  3I0T A;  4IRH A;  3RI4 A;  3HHH A;  1MSE C;  1T0F C;  4U87 A;  4AIJ A;  1T8I A;  1MBH A;  4XSZ F;  4J00 A;  2R7X A;  3FDY A;  3CC7 I;  1K78 B;  4F93 B;  2IEK A;  2LDU A;  3CJR B;  2LYC A;  2V1U A;  3N05 A;  1YS6 A;  5HNH A;  3HOX J;  4U0W A;  3NQO A;  4KT5 C;  4M9X A;  1ETO A;  1YW9 A;  1YHQ I;  2EV5 A;  1YRN A;  2E1M B;  1TW2 A;  2JSC A;  2GAU A;  3OWT A;  2KQR A;  2QBY B;  2OCC H;  3VYU B;  5HS8 A;  1MH4 A;  2EB7 A;  1U78 A;  2O8K A;  4LJZ F;  4NDL A;  4XNF A;  3WGI A;  2WBM A;  1KYZ A;  2XC7 A;  2HVR A;  2JPB A;  2M45 A;  3Q9S A;  1X58 A;  5IYC J;  4ETS A;  1Z21 A;  2L4M A;  1E3P A;  3FIW A;  3MMY B;  1RZ4 A;  2IA1 A;  5IYD J;  1H9T A;  3BTC A;  2CRG A;  5EG0 B;  1Z9C A;  3GVA A;  3MQ0 A;  1JKR C;  3QOD A;  3DEE A;  2HYF A;  2GZW A;  5EGO A;  4DNC A;  3F22 A;  4CCM A;  1J75 A;  5GPC A;  2G7U A;  4ABZ A;  1YQA A;  1UJ8 A;  4JX4 A;  1FIA A;  2LD5 A;  4DBR A;  1QZZ A;  2CUJ A;  3WTX C;  2D2W A;  4JQF A;  4XRS A;  2PFB A;  4IPA A;  1PYV A;  1HOM A;  4WXH A;  2LKS A;  3BZ6 A;  4N4O B;  1U6G A;  1NHA A;  4IEJ A;  3AFH A;  2A6E F;  4QTR A;  1AA7 A;  3DPU A;  2A6T A;  3ZQL A;  1RUN A;  1WHU A;  3OL3 A;  3CZ6 A;  2BW3 B;  2QWW A;  3KP4 A;  4YRV A;  2QZ8 A;  3IUO A;  2YU3 A;  4FET A;  3BR5 A;  3JRC A;  3E0J B;  4PJL A;  2P5L C;  1IUF A;  1X2M A;  5HS7 A;  5K5R A;  1U5T A;  3OS1 A;  3HKZ A;  3JSO A;  1ACI A;  1N75 A;  4W97 A;  3IWZ A;  1RIO H;  3CDH A;  2PJP A;  2V6E A;  1EH8 A;  5EDN A;  3A4C A;  3HHG A;  3IH2 A;  2O6G E;  4BKX A;  3F8N A;  4L9T A;  3H9Q A;  3QPT A;  3RQI A;  2DT6 A;  1ULY A;  5JHU A;  4RB1 A;  3DF8 A;  1R71 A;  1QU3 A;  1S29 A;  3A0H C;  3G71 I;  1LUJ B;  1YW8 A;  3O6B B;  1ERD A;  3LL7 A;  1ENH A;  2E60 A;  5J8C A;  4MFD A;  2DDA A;  4EJU A;  3S14 J;  5LFA A;  1D1B A;  2W1O A;  1C0W A;  5E79 C;  3LA3 A;  1HBX G;  3LMM A;  2ZME C;  4Z6Y A;  2CSO A;  2QQ8 A;  3CLO A;  3EUA A;  2VI6 A;  3RPU A;  3K4C A;  1XSD A;  5H6R A;  3M3Y J;  1IDY A;  4XKB A;  3JRE A;  2ICW G;  1HA8 A;  3LAP A;  4AVZ A;  4D7N A;  1BW5 A;  3R0J A;  2PMH A;  4F91 B;  2MH2 A;  5D5W B;  4DOZ A;  3VEP A;  3IRQ A;  4MIM A;  1UEL B;  1FIP A;  2HZD A;  3GZN B;  2WB1 A;  1T39 A;  4CA0 A;  1GXP A;  2OA4 A;  3K1M A;  5B66 C;  3TMO A;  2KDZ A;  2M3A A;  5CVV A;  4BAY A;  1DPR A;  2KT0 A;  4AU7 A;  3EUH A;  1S6L A;  4PSX A;  1W36 C;  3KE2 A;  1TNT A;  1TQP A;  4M3D A;  3FK6 A;  2CS3 A;  1V5E A;  4KUM A;  2RKH A;  1MJB A;  1N25 A;  2P81 A;  5D5V B;  3JAM Z;  5L3E A;  1DGW Y;  5LRS A;  1VI0 A;  2BXY A;  5L3D A;  2K27 A;  4RGS A;  3WG7 H;  1BR2 A;  2X6O A;  5L3C A;  4I02 A;  3KEY A;  3M07 A;  4G7Z F;  2COB A;  2YX4 A;  1J7K A;  5TGT A;  2QM3 A;  3S1M J;  1J5Y A;  2IGM A;  3IC7 A;  2W48 A;  4L5J A;  4M9S A;  4C3I J;  1YO5 C;  3DU6 A;  4ENM A;  1B4A A;  3FXR A;  3DEU A;  2LKX A;  3BPV A;  3L2Q A;  2ZJ2 A;  1BI3 A;  1HCR A;  4B3X A;  2GA1 A;  2BBY A;  4E70 A;  4A3F J;  4KIC A;  2STW A;  3W3C A;  1SD6 A;  2IGK A;  2DYR H;  3CUQ B;  1JKQ C;  2A5W A;  3U2R A;  1E3H A;  1MD0 A;  1FOK A;  1ZEL A;  4LD5 A;  3HOS A;  2CV0 A;  3K4N A;  1FOX A;  4FTH A;  3B6A A;  2XPU A;  1P9Q C;  1EKE A;  2F4I A;  2KLO A;  2D45 A;  4Y17 A;  1D0X A;  3WGG A;  1ZLJ A;  3BG5 A;  5LEK A;  5EG0 A;  3D5R C;  2XAU A;  4DIQ A;  2HGC A;  2M4K A;  5BOX A;  1YLF A;  3GTQ J;  2MC3 A;  5EEG A;  5F0F A;  4EM0 B;  2VKD A;  3KET A;  2MYS A;  6PAX A;  4R1H A;  4J19 A;  4HDU A;  5DUI A;  2HXO A;  4S0H B;  3OOP A;  5FFX A;  2UUZ A;  1ZG1 A;  1Z77 A;  3FBN B;  3K0L A;  3ABM H;  2D5V A;  1JI8 A;  5E1X A;  2B63 J;  3K4M A;  3LSK A;  3QAH A;  3T8T A;  1AU7 A;  5J47 A;  3E1S A;  3CES A;  1X2N A;  1W5S A;  3IL2 A;  1JHF A;  1I3Q J;  1OCR H;  2M8G X;  1YIO A;  4E7Z A;  3BG6 A;  4PGH A;  1AWC A;  4BDY A;  1TP4 A;  2O9L A;  3K7A J;  3K9T A;  2HQ5 A;  3CC4 I;  5KHD A;  2Q8K A;  1B8I A;  3R6S A;  1X4O A;  3CCM I;  2GM4 A;  4U0V A;  3IHU A;  3P5J A;  1QZY A;  1S8N A;  1MMD A;  5LGN A;  1D5V A;  2TCT A;  5HLI A;  2EFP A;  3H3V K;  2DOA A;  2DFE A;  3BR3 A;  3RKX A;  1BW6 A;  3RTR A;  3A03 A;  2QQ9 A;  3NWS A;  3FXM A;  2XF5 A;  1D8J A;  3BJO A;  4MEX F;  2VJJ A;  2LMD A;  1LDD A;  4A3E J;  3HUG A;  3CUO A;  1PJR A;  3U1D A;  2OC6 A;  1LFP A;  1U8R A;  4M74 A;  3Q0V A;  3FHN A;  4K2E A;  1ZGA A;  4A3L J;  4XIC A;  5GAD J;  3KYL A;  1Z67 A;  5ICF A;  4LB6 B;  3FHZ A;  1XGM A;  4PDK A;  4A5N A;  4LGW A;  1X3Z B;  1MSF C;  3M4O J;  3RCO A;  5F0C A;  2D1H A;  2Y0S A;  5IY5 H;  4MNU A;  3K2Z A;  1MH3 A;  3FXL A;  5E3N A;  1B59 A;  3F21 A;  4ZDP A;  4S05 A;  4IKF A;  3K4B A;  1KQ0 A;  2KP6 A;  2JA5 J;  2A05 A;  4MLO A;  3K6G A;  4XOR A;  4E7H A;  1BOB A;  2K4B A;  3OR2 C;  3N4M A;  3GZ5 A;  4HQE A;  4KMU X;  3FZV A;  1SMY F;  1UMQ A;  1YX5 A;  4HSR A;  3WU0 A;  1LEB A;  3IWF A;  1XX5 A;  3I59 A;  4XLA A;  4BBR J;  3I54 A;  2HOA A;  2GXB A;  2LBF B;  2LLK A;  2Y48 A;  2VKV A;  3F8C A;  3BQZ A;  2HVS A;  3CJQ B;  2ELK A;  3BJA A;  2PJR A;  1EF4 A;  2VJ4 A;  4II3 A;  1RES A;  4E7K A;  3C2G A;  2K9N A;  3J81 Z;  3DV8 A;  2XRO A;  1A31 A;  3MZ8 A;  2K5C A;  2P4W A;  2CUE A;  3V7C A;  1D5Y A;  2R4G A;  1VQP I;  1T95 A;  4L5E A;  3WG9 A;  1BI1 A;  3DP7 A;  3KP3 A;  4ZDL A;  4ZYA A;  4OMY A;  2JRM A;  3WHC A;  1BI2 A;  4O5V A;  2JK3 A;  2M0C A;  4PJM A;  2VON A;  2VC1 A;  3Q0U A;  3I71 A;  3Q5F A;  1JKO C;  1IV6 A;  4Q5S F;  2DU9 A;  4MGR A;  2FNA A;  4XLC A;  2E7W A;  1MBK A;  2BOL A;  3WTS C;  1OKR A;  3VYS B;  2NVT J;  2WAD A;  2R7O A;  1V55 H;  5CVU A;  3IKT A;  2JA6 J;  2ZBK A;  5J3L A;  5GTH C;  3ZQC A;  1ETY A;  3I4M J;  5CYV A;  3OYG A;  4ESB A;  2VXZ A;  3BLY A;  4RAZ A;  5EEH A;  1TQM A;  1YX3 A;  2RQQ A;  1HKT A;  4G6Q A;  1FZP B;  4GFB A;  2PMZ A;  1J2X A;  4HNU A;  3PQJ A;  2E35 A;  2MSY A;  2HQN A;  1UHM A;  2ZCW A;  1LFB A;  5K7F A;  5DCM A;  1MMS A;  2M1B A;  2VBY A;  3J7A O;  5J4Y A;  1D1C A;  2ZB9 A;  3OYK A;  2EWN A;  2FOW A;  1VQN I;  1FY7 A;  3EET A;  4ENK A;  3I5U A;  4KIS A;  2L9V A;  5ERI A;  3VYR B;  1PUE E;  2HS5 A;  1ETK A;  4GXO A;  1XB4 A;  3TW6 A;  3RYP A;  4RAF A;  5D8L B;  1PDN C;  5LEJ A;  1DPU A;  2X85 A;  4PJ0 C;  2EK5 A;  2HTJ A;  1A35 A;  2QBY A;  2FML A;  4A6D A;  2RNG A;  2OZU A;  3BR2 A;  3GTK J;  1QHH D;  1DU6 A;  4UB6 C;  3TQN A;  2ACJ A;  1OMI A;  1O7L A;  5IT9 K;  1NTC A;  4CSW A;  3MZH A;  5J40 A;  1D0Y A;  2OUM A;  1Y56 A;  3BTI A;  1I3A A;  2X1D A;  3UNG C;  2WAQ A;  4Q4Z F;  2QSG X;  2VUM J;  2XAH A;  5E1Z B;  2VBZ A;  1NG7 A;  3GTG J;  1UZC A;  3FXU A;  3LWF A;  2XSJ C;  2KZV A;  4LK0 F;  4DBQ A;  1R5G A;  1ZTR A;  4LG0 A;  2X9D A;  3W6K B;  2R5Y A;  4QPO A;  4A3D J;  1FTZ A;  4MQ9 F;  2FBK A;  4BS9 A;  3C1D A;  2HQA A;  2F48 A;  1MKM A;  1IXC A;  3ZMT A;  4HEA 2;  2KMU A;  1RR8 C;  3HOT A;  3B6C A;  4KMF A;  1GXQ A;  1Z7L A;  3P9I A;  4KIG A;  3ABU A;  3ZRG A;  5B1B H;  3S16 J;  1U5T C;  4KDP A;  4C2M J;  3GXO A;  2LY2 A;  4PUS A;  3C18 A;  3KLN A;  4XL9 A;  4F7Z A;  3PO3 J;  3S1N J;  2HOS A;  1IO2 A;  4N9I A;  2L9S A;  2OTL I;  1U3E M;  1K4S A;  4I76 A;  2IS6 A;  1QPI A;  4NC6 A;  3HKZ N;  1I1S A;  3NWT A;  3WU2 C;  4C3J J;  2DMQ A;  2XGX A;  2ZFW A;  2P0W A;  5ED4 A;  3DPL C;  2DQR A;  2CH0 A;  3F8F A;  4ENN A;  4BL0 B;  3E5U A;  3P7N A;  1BJZ A;  1VND A;  3MCZ A;  5FKK A;  1IAW A;  4BE1 A;  2DN0 A;  3DTK A;  2A5Y B;  5D6F A;  5FB2 A;  1KU2 A;  2GIZ A;  2XGC A;  3ISP A;  1T56 A;  3Q9V A;  4FE4 A;  3TOB A;  2FMY A;  2PMU A;  5HNF A;  1JGS A;  2R7R A;  1E2X A;  2AQF A;  5F08 A;  1TLH B;  3DEW A;  3HSR A;  3H3U A;  2WY7 Q;  1Y39 A;  2EFQ A;  2DQL A;  1UAA A;  2XPW A;  3HG9 A;  3J80 Z;  3GYH X;  5K1Y A;  2GA2 A;  1YYV A;  5BPI A;  2OQG A;  1IZ1 A;  1SD4 A;  2AO9 A;  1W0T A;  2LF7 A;  4KA4 A;  2X0L A;  2MBF A;  1BR1 A;  4OIO F;  1XDS A;  1YFH A;  2DAO A;  3UKG A;  3ZMD A;  1SD5 A;  5FLX Z;  4CXF A;  2F5V A;  3ZN1 A;  4EJV A;  5JI6 A;  3F72 A;  2HWV A;  1MMA A;  2HU9 A;  3EUH C;  5IT3 A;  2IS4 A;  4EVI A;  3ZMS A;  4A3I J;  4B48 A;  1WZ2 A;  4LIU A;  5FKN A;  2L9N A;  3CF5 F;  1JUS A;  3K1N A;  5ICC A;  2LG4 A;  5AON A;  3JW4 A;  2ZSH B;  2QCO A;  5DD4 A;  1JJ8 C;  5F64 A;  2ZJR F;  1HKS A;  2VB6 A;  5CPR B;  4BDZ A;  3LAJ A;  2CQX A;  4M3G A;  1PP7 U;  1W0U A;  3EPZ A;  3ZQH A;  1FOW A;  1SAU A;  2RV8 A;  4RGR A;  2UZK A;  4CHU A;  3PJR A;  4V19 K;  2CUF A;  2RN7 A;  3COA C;  2ME0 A;  4EJO A;  4G7O F;  5E3M A;  1SVM A;  4JP0 A;  2XB0 X;  3GW2 A;  2H8R A;  3ELK A;  1ZGJ A;  3OYB A;  1W5T A;  4U88 A;  3QOE A;  4PK4 A;  1UHW A;  1XD7 A;  2V1D A;  1XCB A;  1KU9 A;  1IN7 A;  4IF4 A;  4R79 A;  3ZN0 A;  5DD8 A;  4A5M A;  1B9M A;  1J0R A;  1IN8 A;  2IBD A;  3JTG A;  5TJJ A;  2J5P A;  1Z7U A;  3LFU A;  4ZTJ A;  3WTY C;  3WTV C;  1RPW A;  3HGG A;  4EGZ A;  3FM5 A;  3QYB A;  2Y0M A;  4EEF G;  5E8G A;  1O7F A;  4ESF A;  3I4N J;  1XSV A;  5BQT A;  3CCR I;  4N9H A;  3KYD B;  1D1A A;  1N78 A;  4DW6 A;  2JZY A;  1HW2 A;  5AIP A;  3OS2 A;  4CIC A;  4RMN A;  1K83 J;  5GTI C;  3ASN H;  3G1L A;  1W7P D;  1YOV B;  2JA2 A;  3LA2 A;  4LG0 B;  2VBW A;  4QPQ A;  3G2B A;  4ZC3 A;  3U1K A;  2E7X A;  1T33 A;  2P6T A;  1ZR4 A;  2VQL A;  4CGZ A;  1JTX A;  2NVY J;  1FP2 A;  2R5Z A;  3V8K A;  2B9S A;  1R9T J;  2KPM A;  3CUQ C;  2DI3 A;  3OYA A;  4DYQ A;  4BEH B;  1XPX A;  4LIT A;  5H6Q A;  3PUF A;  3SZT A;  1WH5 A;  3AG2 H;  1EV7 A;  2QSH X;  2AS5 F;  1U9O A;  2CUZ A;  2ZC2 A;  1TWG J;  2DMT A;  2LF8 A;  4CCO A;  5LD2 C;  3LSI A;  2RNJ A;  1I5Z A;  4ESJ A;  5K7Z A;  2PN6 A;  2LRD A;  3ZQG A;  1YRN B;  1G4D A;  5CVR A;  2V9V A;  1VQ8 I;  2RRE A;  3IKV A;  3R60 A;  5H20 A;  1F36 A;  2K85 A;  3OL4 A;  3J81 K;  3L2V A;  1MNE A;  3H9G A;  1WSU A;  1SFU A;  3FXQ A;  1TWA J;  3GLX A;  2DW4 A;  3PNV A;  1Y8Q B;  3JRI A;  3GTP J;  4OAZ A;  3S17 J;  2L4A A;  1ZAR A;  3F8B A;  2P6S A;  1RET A;  1T98 A;  1SC7 A;  2EH3 A;  4XBF A;  4EM1 A;  1IV8 A;  3SDG A;  3CCJ I;  3S1R J;  1BC7 C;  1X1P A;  2HR3 A;  1FWZ A;  1YJW I;  3A01 B;  3WHB A;  2YPR A;  1S7A A;  4M3E A;  5M5W J;  1OCC H;  4LMY A;  3ZP5 A;  1HC8 A;  2VL8 A;  3NEU A;  1GDT A;  2X1E A;  4BXF A;  2H1L A;  3F9K A;  5F27 A;  2ECB A;  1IDZ A;  2PJR B;  3O8G A;  3KFW X;  5DCF A;  2F5E A;  1JE8 A;  1AHD P;  1Y0U A;  5J1R A;  3HTS B;  4Q47 A;  3G3Z A;  3ML6 A;  3HPH A;  5HS9 A;  2R93 J;  3OS0 A;  3BZK A;  5BPD A;  4NHJ A;  1APL C;  2JQ7 A;  1UHS A;  2CW7 A;  3IAM 2;  3AKZ A;  2LTP A;  3CO7 C;  1GT0 C;  1R00 A;  2EIL H;  4A3K J;  3HRS A;  4HLY A;  1I39 A;  1O57 A;  3A1Y A;  2Y69 H;  1TT0 A;  2R7U A;  3OYF A;  1HLV A;  2H27 A;  4B8X A;  2TRT A;  4CYD A;  3H35 A;  3P9K A;  4BU2 A;  4WF2 A;  2UXX A;  1LE8 A;  1P6R A;  2V9P A;  1U2W A;  3ABK H;  3RPU D;  1ETQ A;  3I53 A;  2EBI A;  1SVL A;  2P8T A;  3DBL B;  1R5H A;  4PFP A;  4KN7 X;  4F52 A;  4HG2 A;  2Z3Y A;  1CGP A;  5E3L A;  3HXL A;  3HOU J;  2QSF X;  2JUC A;  4HOB A;  3B73 A;  3S8P A;  2IGO A;  2XDV A;  3MKW B;  2BVM A;  3F0C A;  2LVS A;  3GFJ A;  4HBL A;  2VQC A;  1ZRC A;  3KCC A;  5IP7 J;  4BQO A;  1O3T A;  1KQ9 A;  1ETW A;  4JYK A;  5ICE A;  1MMN A;  4CO8 A;  2YS9 A;  3FF5 A;  2YU9 J;  1GVJ A;  1X1B A;  4YIR X;  3CP2 A;  4AID A;  1Z05 A;  1BC8 C;  3ROU A;  1FX7 A;  2O8X A;  5EZG A;  5JHF A;  4RB3 C;  3FMQ A;  2YX7 A;  3HBL A;  2E2J J;  3HGY A;  3LQQ A;  3SYT A;  3SQN A;  2A61 A;  4HPQ A;  4FCY A;  1EH7 A;  2HEO A;  4BUP A;  2HZT A;  1A36 A;  2YSR A;  3WTU C;  3S15 J;  2X4H A;  2XB5 A;  3V42 A;  3PNT A;  2A07 F;  2VE8 A;  2QF7 A;  5DCM B;  5FJ8 J;  2DBB A;  3MAJ A;  5HDN A;  3GFL A;  1NK3 P;  1VQK I;  1TWF J;  2JN6 A;  3OYI A;  3JRH A;  2BYV E;  4RGX A;  4I09 A;  5FKM A;  1W36 D;  5DM6 F;  4BXX J;  4EMS A;  2P7C B;  2HYJ A;  3HIF A;  2ZFU A;  1G3Y A;  3JRA A;  3LOC A;  3Q0W A;  1Z6R A;  2QEX I;  2E2H J;  2Q2E B;  1FYM A;  3CJT B;  2DK5 A;  1KQ8 A;  1UB9 A;  2RAE A;  1RKW A;  4IQ4 A;  3ZQI A;  4UVA A;  3W2W A;  2K9L A;  4HAM A;  3F23 A;  2PI0 A;  5D6E A;  2XVC A;  2K40 A;  2E1M C;  2M4G A;  3MZY A;  1XS9 A;  2ZO4 A;  3JCU C;  5CQG A;  1K7A A;  2M9H A;  2L7Z A;  2DOE A;  2JUG A;  3WOD F;  3HRM A;  1H88 C;  1MGT A;  2O03 A;  3H5N A;  5DTD A;  2LY1 A;  4XLN F;  3HPG A;  3IH3 A;  4I01 A;  2HPM A;  1B8I B;  1IG7 A;  5JVG F;  3K10 A;  1FP1 D;  3DLA A;  2HKX A;  2KRH A;  2E5N A;  3TDU C;  3LSP A;  2E1C A;  1LKX A;  4X0G A;  3OIQ A;  3IP4 B;  2XKO A;  2F2E A;  4GCV A;  4E7S A;  2EIK H;  1TQI A;  1HW5 A;  3MWM A;  2NS8 A;  1TL8 A;  1HW1 A;  2DDB A;  4NC7 A;  4RDU A;  1MBF A;  3VOD A;  4HDV A;  4YII A;  2WAF A;  3T0Y A;  5B3S H;  2DYS H;  4ENJ A;  2V1X A;  1GUU A;  1YE9 A;  4D0P A;  2ADU A;  4ZYE A;  3OY9 A;  1MDM A;  4AM3 A;  5KVR A;  1XN7 A;  4D5F A;  1HST A;  1K4T A;  3BRO A;  3I64 A;  2BY0 A;  1Y6I A;  3LSM A;  4M3F A;  4RAY A;  3WGH A;  5D4R A;  4IHY A;  1QPM A;  4IRG A;  2RC4 A;  2OZ6 A;  3JRB A;  1BI0 A;  1R22 A;  2ECC A;  2ME6 A;  3GTL J;  4P96 A;  2X6X A;  3R61 A;  1X19 A;  5CKT A;  4IQJ A;  1HKQ A;  4KIF A;  1LVK A;  1LE8 B;  3ZPL A;  2CQN A;  2DA1 A;  2DA4 A;  3BCB A;  4B43 A;  1HF0 A;  3AG1 H;  4Y13 A;  2CG4 A;  4LFU A;  3WE2 A;  2ZXI A;  5FFZ A;  4UUS B;  2IXS A;  5J1U A;  1ON2 A;  3W2V A;  4Y4R A;  5HLG A;  3S2H J;  1SEU A;  1A6Q A;  3O2P E;  3I59 B;  5DV5 A;  1ZRE A;  1M1E B;  4AD9 A;  2ZSI B;  4PCQ A;  3EUK L;  3ZMU A;  2RDP A;  3D5S C;  2I5U A;  3K4J A;  3HRT A;  4F3Q A;  5HLH A;  3TED A;  1LFU P;  2FXA A;  4WWC A;  3LSH A;  4HX8 A;  1W4M A;  1ZR2 A;  1ON1 A;  1F4K A;  1QGP A;  3DKX A;  2ISZ A;  4Q48 A;  2CU7 A;  3HC7 A;  2X1C A;  4TV7 A;  4R8H A;  1SVO A;  2OPT A;  4NBQ A;  1VQL I;  1UG0 A;  1O3R A;  3ZCO A;  3L1P A;  4M6V A;  4FQG A;  4UNO A;  3QOP A;  3AG4 H;  3JRD A;  4E7J A;  2MD5 A;  3CCL I;  1YS7 A;  2W25 A;  4Y3O A;  4CYC A;  2ISY A;  2L7F P;  3RZD J;  3KZZ A;  2FEZ A;  3IH4 A;  3W6J B;  3MEX A;  3HEF A;  4PSW A;  1NG6 A;  3TO6 A;  3CCU I;  4WXD A;  2HQR A;  4PFO A;  1BN5 A;  4EAT A;  3LSJ A;  2QA4 I;  3QWL A;  2BVL A;  3ZQF A;  3KEQ A;  2XRN A;  4D1Q A;  1WFX A;  2LNB A;  3L2W A;  2L02 A;  3QP5 A;  3DBR B;  3ERM A;  3BCA A;  4P5O A;  3FX3 A;  3RKY A;  5J8F A;  1J09 A;  2XV4 S;  2Y75 A;  3ZMV A;  3VSK A;  3QQA A;  3MFK A;  4P9U A;  2R5Z B;  1IRX A;  3OIO A;  4UV8 A;  2JRT A;  2W82 A;  3VSL A;  4LLN A;  2KJB A;  1WJ5 A;  1UG2 A;  2DMU A;  2FBH A;  2P7V B;  4M71 A;  4XN3 A;  2HFH A;  1OR7 C;  4XN0 A;  2FA5 A;  5AIQ A;  3L09 A;  1R7J A;  3CDL A;  5B5E C;  4F92 B;  1RI7 A;  2QQA A;  2VN2 A;  3PIP F;  3K70 C;  5GAG J;  1FYK A;  3L00 A;  2FF4 A;  1HXD A;  1W5C C;  3O3K A;  5FRM A;  3I3L A;  4CCN A;  2FJ1 A;  2K86 A;  2JA8 J;  2I10 A;  4XKV A;  2W7N A;  4C2T A;  1OCO H;  2WV0 A;  4HX4 A;  1VF9 A;  2VIX A;  4B47 A;  3CCV I;  1ORK A;  2DA5 A;  3CUQ A;  4HF0 A;  2M87 A;  1PVE A;  2W4S A;  1VQ4 I;  5FLX K;  4G6T B;  1ZYR F;  1I27 A;  2OTJ I;  2O3F A;  4BAC A;  2VPR A;  4CZC A;  2H94 A;  1W7P A;  4XMY A;  2XAJ A;  4FX0 A;  3A01 A;  1GHC A;  4XKW A;  4RBO A;  1BA5 A;  3ERE D;  3N97 A;  2G9W A;  4U7D A;  4Z2Y A;  2QKL B;  1BR4 A;  3HRU A;  2I8D A;  4BYY A;  2ELJ A;  2MLG A;  1OYW A;  4I7H A;  4F55 A;  3GO5 A;  1K6Y A;  4RAG A;  4HNT A;  2VOP A;  1E17 A;  3KZY A;  3OR1 C;  4I0A A;  2CFO A;  2LOO A;  1A6I A;  5F0H A;  3OYL A;  4A6E A;  1R23 A;  1G3S A;  3DU5 A;  2KIM A;  3K1P A;  3I56 I;  3VPR A;  2VQH A;  2IT0 A;  2BY1 A;  2EJR A;  4NUB A;  5ILU A;  2A68 F;  2K02 A;  1LB2 A;  3KX2 A;  4L9J A;  2IGN A;  3ONQ A;  4QSH A;  2FRH A;  2WTE A;  1JUM A;  2CQK A;  4HYE A;  2CV1 A;  1WVR A;  5H2F C;  2BHY A;  3GBG A;  3IAS 2;  3EYY A;  1FJL A;  4RB2 C;  1V5G A;  1CF7 A;  1HDD C;  4XLE A;  1P4W A;  1TT5 B;  3HOV J;  4UY8 I;  5DM7 F;  3SEZ A;  5B1A H;  4Y52 J;  2K3F A;  2L2O A;  3M8J A;  5GAE J;  3L2C A;  4CCK A;  2KZG A;  2JMW A;  2P5K A;  3FM3 A;  5IPA A;  3K69 A;  3FWE A;  4DQ2 A;  3H3Z A;  2DPD A;  3SFI A;  2W85 A;  1L0O C;  4G94 A;  1F9N A;  2XGD A;  3ZR8 X;  2OJE D;  1YIJ I;  2JPC A;  4A12 A;  3K2A A;  2DXI A;  1XMA A;  3FXO A;  4RM3 A;  4KJZ A;  3VB2 A;  3OYM A;  1DDN A;  2IP2 A;  2JTV A;  3RJP A;  1JGG A;  3QU6 A;  3IV5 A;  2R7W A;  1XC5 A;  4E7L A;  3CD6 I;  1G3T A;  3E5Q A;  4IJA A;  4M3B A;  2K3P A;  4FIS A;  3VDX A;  1Y8R B;  5KCM A;  3SDB A;  1YJ9 I;  2WA0 A;  1GV5 A;  4C30 A;  4BY1 J;  3X2Q H;  2O61 A;  4LIV A;  3H1C A;  1V5F A;  3PQK A;  1P2F A;  2BHZ A;  3KP5 A;  1I6H J;  2V79 A;  3OYJ A;  1BL0 A;  1ZQ3 P;  3HSE A;  3T5X A;  3ZOB A;  4BE0 A;  2J5O A;  4U7B A;  1D3Y A;  2JWT A;  5CVI A;  4C9Y A;  5GPA A;  4A3C J;  4A3G J;  2E19 A;  3ASO H;  4M72 A;  4DJA A;  2M7B A;  3QP6 A;  3QPH A;  2ID3 A;  5E20 A;  2DOD A;  1Y1W J;  2CWE A;  3PSF A;  3I55 I;  1BJA A;  2PG4 A;  5FD5 A;  2GOM A;  2XPV A;  1IRG A;  4L9V A;  5CVJ A;  2H6C A;  1MW7 A;  3UR3 C;  3KZI C;  4CUG A;  3H0G J;  5E8I A;  3DLL F;  3JR9 A;  2E2I J;  2Q2E A;  3BR6 A;  2NYX A;  3F6O A;  4HNV A;  2IVM A;  1FBS A;  4UUT A;  2UV1 A;  1KU3 A;  4DYR A;  2IS1 A;  3F3X A;  4E7I A;  1S5L C;  5K5Q A;  1R1V A;  4H0E A;  1EA3 A;  2EV0 A;  1VQM I;  4LK1 F;  1O4X A;  4ON0 A;  4A2U A;  1FYL A;  2FOK A;  2ZKZ A;  4X1E A;  1KON A;  3ZGK A;  4RS8 A;  2MA3 A;  2HDC A;  1VQ7 I;  3MN2 A;  2VC0 A;  2V6C A;  3HOW J;  2ZNZ A;  2HXI A;  3BP8 A;  2MC4 A;  1REP C;  3SZP A;  4YEL A;  4WX9 A;  4BJ5 C;  2XAQ A;  3FXJ A;  2VLA A;  1F43 A;  2XF6 A;  2VQG A;  2XUB A;  3S3O A;  1CQT A;  4XLF A;  4NC8 A;  3S32 A;  4OMZ A;  2X51 A;  3H5A A;  2LKP A;  3OOU A;  3EYI A;  5FRN A;  5JVT A;  2DK8 A;  4D9J A;  3GLL A;  3CCS I;  2E36 A;  2XRL A;  1PP8 F;  1WJD A;  3W2A A;  4C2U A;  4I2O A;  1RRJ A;  3TP0 A;  3KP2 A;  4IHV A;  2NVQ J;  3HZJ A;  4IO9 F;  5HLT A;  3DWL E;  2DLL A;  3CO6 C;  4I6Z A;  1MBE A;  5M5Y J;  2OF7 A;  4IOA F;  3D5L A;  4ZYG A;  1WJC A;  1ZLK A;  2HI3 A;  2QGU A;  3Q3S A;  1OLT A;  1ZKG A;  1TWH J;  1BBY A;  4XOP A;  3WTT C;  4HLX A;  1YW7 A;  2B0L A;  1RNL A;  3CQZ J;  1H8A C;  3L7W A;  2M2E A;  2V1N A;  4JX6 A;  3BR1 A;  1TBX A;  1FC3 A;  1IN4 A;  5M5X J;  3V8L A;  2BW3 A;  2M5W A;  1JUP A;  1BIB A;  3BR0 A;  4ZZL A;  3M1C A;  3I9V 2;  3GZ6 A;  3KIO A;  1OJL A;  1SFE A;  3S3N A;  1WRJ A;  2KL4 A;  2RVC A;  3MKL A;  4WCG A;  4CDG A;  1VQO I;  1TWC J;  3GME A;  4GRI A;  4AYB N;  4HST A;  2KRF A;  1QNT A;  1RR7 A;  4I98 B;  4D5C A;  2OU2 A;  3BQY A;  1OCZ H;  1R1U A;  2OCE A;  4BH9 A;  4A3M J;  2RGV A;  4IHS A;  4CH7 A;  5C3E J;  3KEO A;  3BG7 A;  3G4S I;  2VKE A;  1KZH A;  2BGC A;  3OYC A;  2VT2 A;  1MBG A;  4NQW A;  3HDD A;  2L5Q A;  2VXD A;  2R7D A;  1YJN I;  2KHM A;  5CQE A;  1OCT C;  3BG9 A;  3CJN A;  1XSX A;  5F04 A;  1XMK A;  3LSG A;  3CTA A;  1YTY A;  3BJ6 A;  4G6D A;  1ZRD A;  1XGS A;  4IXA A;  4ZH4 F;  2PX9 A;  5D8K B;  2Z2S B;  1BM9 A;  2YUS A;  1AKH A;  5IP9 J;  4UXN A;  5HOO A;  2V7F A;  2R7Z J;  4H4K C;  1W1W E;  2KJC A;  1ONV A;  3K70 D;  2A6H F;  3SZG A;  4BXU A;  1R6R A;  3WTW C;  2E1N A;  5HDG A;  3TO7 A;  4LB5 A;  3DPT A;  3CMY A;  2DFI A;  1TTY A;  3ABL H;  3PUB A;  3C2B A;  3TOA A;  2JT1 A;  5ILV A;  2RQP A;  5C4X J;  1IN5 A;  1WPK A;  3M8E A;  4AWX B;  1LVA A;  4U0Y A;  3V8J A;  2G0E A;  3E5X A;  1ZAO A;  2UWM A;  1STZ A;  3MD2 A;  2DMN A;  2LP0 A;  1QHG A;  3RQ4 A;  2CW0 F;  4EQQ A;  5HOD A;  2HOE A;  2Y9Y A;  3J7Y J;  3GTJ J;  3G1M A;  2Q1Z B;  4Y33 A;  3OYH A;  1Z0X A;  3DBH B;  5FRO A;  3FMS A;  2E34 A;  3DCF A;  1BOA A;  1P4A A;  1R5I D;  2GOX B;  2W24 A;  1UST A;  2WC2 A;  2DJN A;  1WJE A;  3CF2 A;  3JRG A;  2K7L A;  2DT7 B;  4GYI A;  4HW0 A;  1VQ6 I;  1DP7 P;  4LOC A;  2NS7 A;  3KLO A;  2VOD A;  2VE9 A;  5FO5 A;  2EQR A;  4B09 A;  4M6Y A;  2DA2 A;  4P1W A;  1ZG5 A;  4XQF A;  2ETH A;  4XSX F;  1FBQ A;  4KN4 X;  4KYW A;  3OSG A;  4DYC A;  3LST A;  4MTE A;  2FBI A;  4KFC A;  1I6X A;  3RSN A;  3OYD A;  2L9R A;  2X6W A;  3C3W A;  1QZE A;  1T0F A;  2QUF A;  4MQV A;  1POG A;  1ZH5 A;  4HA8 A;  1GVD A;  2OD5 A;  3FKI J;  1OQY A;  1SFO J;  3HSF A;  3ZMZ A;  2EFN A;  2ID6 A;  2MW8 A;  4C3H J;  3NRV A;  3SFZ A;  3FKJ A;  1SAN A;  2EA2 A;  2F4O B;  3H36 A;  2L7K A;  4JOM A;  3BZC A;  3PNY A;  2EIM H;  5EGO B;  3LSR A;  5BMZ A;  5E1W A;  2LSO A;  2CYY A;  2EZH A;  1ETV A;  4UVC A;  2KKO A;  1USS A;  5DYM A;  1VQ5 I;  1G59 A;  4G7H F;  1B72 B;  1J9I A;  3GF2 A;  1Q1V A;  1FMW A;  3ECH A;  2Q0O A;  5A2Q K;  3I58 A;  3WTZ A;  4LG3 A;  3RYR A;  1OCP A;  2WAE A;  1QO0 D;  4KNY A;  2WAQ N;  2KIF A;  5DUK A;  4PZJ A;  2PEX A;  2DA3 A;  3ECO A;  3S2W A;  3HJE A;  3TDZ C;  5KNL A;  3LA7 A;  2R3S A;  2HVQ A;  3PFY A;  1LJ9 A;  3RPQ A;  1EJ9 A;  1XG1 A;  3SHF A;  4KIT B;  5JLW A;  2O0Y A;  3B02 A; 
#chains in the Genus database with same CATH homology
 5GAE J;  2QA4 I;  1YJN I;  2OTJ I;  4IOA F;  2E34 A;  4IOC F;  2ZJQ F;  1VQ5 I;  1VQL I;  3PIP F;  3CC4 I;  1VQP I;  1FOW A;  1VQO I;  1YHQ I;  5GAG J;  1QA6 A;  3CCQ I;  3CCM I;  3CMA I;  1YIJ I;  1VQK I;  4V19 K;  3G6E I;  1FOX A;  3G71 I;  2OTL I;  1FOY A;  1VQM I;  2E35 A;  5GAD J;  3CCR I;  2NXN B;  3CCL I;  3PIO F;  3CC2 I;  5DM6 F;  1S72 I;  1VQ6 I;  2H8W A;  1Y39 A;  4IO9 F;  3CD6 I;  3I55 I;  1YIT I;  1MMS A;  3CCS I;  2E36 A;  3J7Z I;  3G4S I;  2QEX I;  3CCJ I;  2ZJP F;  3CME I;  3CCV I;  1YI2 I;  1VQ7 I;  2JQ7 A;  1ACI A;  1YJ9 I;  1VQ9 I;  4UY8 I;  3CJT B;  5GAH J;  5DM7 F;  1YJW I;  3CCE I;  3CC7 I;  5JVG F;  3CCU I;  2FOW A;  2K3F A;  3J7Y J;  1VQN I;  2ZJR F;  1VQ4 I;  1HC8 A;  3CF5 F;  3I56 I;  3DLL F;  1VQ8 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...