4IOCH

Crystal structure of compound 4f bound to large ribosomal subunit (50s) from deinococcus radiodurans
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
134
structure length
134
Chain Sequence
MIMPQSRLDVADNSGAREIMCIRVLNSGIGGKGLTTGGGGNKRYAHVGDIIVASVKDAAPRGAVKAGDVVKAVVVRTSHAIKRADGSTIRFDRNAAVIINNQGEPRGTRVFGPVARELRDRRFMKIVSLAPEVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Novel 3-O-carbamoyl erythromycin A derivatives (carbamolides) with activity against resistant staphylococcal and streptococcal isolates.
pubmed doi rcsb
molecule tags Ribosome/ribosome inhibitor
molecule keywords 23S ribosomal RNA
total genus 29
structure length 134
sequence length 134
ec nomenclature
pdb deposition date 2013-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF00238 Ribosomal_L14 Ribosomal protein L14p/L23e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.150.20 Mainly Beta Beta Barrel Ribosomal Protein L14 Ribosomal protein L14 4iocH00
3CCEK 1VQ8K 1QVFJ 5DM6H 1K73L 1YITK 3CCUK 3OW2J 4U67H 3PIPH 3CC2K 5MLCM 4UY8K 1VQKK 1VQ4K 3CXCJ 2ZJPH 5GAEL 1WHIA 3CCMK 3I55K 1VQOK 4IO9H 1QVGJ 3CCJK 1VQMK 4IOAH 3CCVK 3CC4K 5GAHL 1YI2K 3CCRK 1YJNK 3G4SK 3J7ZK 3CMAK 1JJ2J 5H1SM 5HL7H 1VQ5K 4WFBH 1Q81L 4IOCH 4WFAH 1KQSJ 3G6EK 3DLLH 1M1KL 5GADL 3CF5H 1VQ9K 1YJWK 5DM7H 3CD6K 3CMEK 1S72K 1Q82L 1K9ML 4V19O 1YHQK 5JVGH 1N8RL 3CC7K 1K8AL 1YJ9K 5JVHH 1VQ7K 1W2BJ 3CCQK 2OTLK 2ZJRH 1VQ6K 3CCSK 3J7YL 3PIOH 4WFNH 2ZJQH 2OTJK 1KD1L 1VQPK 3G71K 1M90L 2QEXK 3I56K 1Q7YL 1KC8L 5GAGL 1NJIL 5AN9E 1Q86L 4WCEH 4WF9H 1YIJK 1VQLK 3CCLK 1VQNK 2QA4K 3CPWJ
chains in the Genus database with same CATH superfamily
3CCEK 1VQ8K 1QVFJ 5DM6H 1K73L 1YITK 3CCUK 3OW2J 4U67H 3PIPH 3CC2K 5MLCM 4UY8K 1VQKK 1VQ4K 3CXCJ 2ZJPH 5GAEL 1WHIA 3CCMK 3I55K 1VQOK 4IO9H 1QVGJ 3CCJK 1VQMK 4IOAH 3CCVK 3CC4K 5GAHL 1YI2K 3CCRK 1YJNK 3G4SK 3J7ZK 3CMAK 1JJ2J 5H1SM 5HL7H 1VQ5K 4WFBH 1Q81L 4IOCH 4WFAH 1KQSJ 3G6EK 3DLLH 1M1KL 5GADL 3CF5H 1VQ9K 1YJWK 5DM7H 3CD6K 3CMEK 1S72K 1Q82L 1K9ML 4V19O 1YHQK 5JVGH 1N8RL 3CC7K 1K8AL 1YJ9K 5JVHH 1VQ7K 1W2BJ 3CCQK 2OTLK 2ZJRH 1VQ6K 3CCSK 3J7YL 3PIOH 4WFNH 2ZJQH 2OTJK 1KD1L 1VQPK 3G71K 1M90L 2QEXK 3I56K 1Q7YL 1KC8L 5GAGL 1NJIL 5AN9E 1Q86L 4WCEH 4WF9H 1YIJK 1VQLK 3CCLK 1VQNK 2QA4K 3CPWJ
chains in the Genus database with same CATH topology
3CCEK 1VQ8K 1QVFJ 5DM6H 1K73L 1YITK 3CCUK 3OW2J 4U67H 3PIPH 3CC2K 5MLCM 4UY8K 1VQKK 1VQ4K 3CXCJ 2ZJPH 5GAEL 1WHIA 3CCMK 3I55K 1VQOK 4IO9H 1QVGJ 3CCJK 1VQMK 4IOAH 3CCVK 3CC4K 5GAHL 1YI2K 3CCRK 1YJNK 3G4SK 3J7ZK 3CMAK 1JJ2J 5H1SM 5HL7H 1VQ5K 4WFBH 1Q81L 4IOCH 4WFAH 1KQSJ 3G6EK 3DLLH 1M1KL 5GADL 3CF5H 1VQ9K 1YJWK 5DM7H 3CD6K 3CMEK 1S72K 1Q82L 1K9ML 4V19O 1YHQK 5JVGH 1N8RL 3CC7K 1K8AL 1YJ9K 5JVHH 1VQ7K 1W2BJ 3CCQK 2OTLK 2ZJRH 1VQ6K 3CCSK 3J7YL 3PIOH 4WFNH 2ZJQH 2OTJK 1KD1L 1VQPK 3G71K 1M90L 2QEXK 3I56K 1Q7YL 1KC8L 5GAGL 1NJIL 5AN9E 1Q86L 4WCEH 4WF9H 1YIJK 1VQLK 3CCLK 1VQNK 2QA4K 3CPWJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCE K;  1VQ8 K;  1QVF J;  5DM6 H;  1K73 L;  1YIT K;  3CCU K;  3OW2 J;  4U67 H;  3PIP H;  3CC2 K;  5MLC M;  4UY8 K;  1VQK K;  1VQ4 K;  3CXC J;  2ZJP H;  5GAE L;  1WHI A;  3CCM K;  3I55 K;  1VQO K;  4IO9 H;  1QVG J;  3CCJ K;  1VQM K;  4IOA H;  3CCV K;  3CC4 K;  5GAH L;  1YI2 K;  3CCR K;  1YJN K;  3G4S K;  3J7Z K;  3CMA K;  1JJ2 J;  5H1S M;  5HL7 H;  1VQ5 K;  4WFB H;  1Q81 L;  4IOC H;  4WFA H;  1KQS J;  3G6E K;  3DLL H;  1M1K L;  5GAD L;  3CF5 H;  1VQ9 K;  1YJW K;  5DM7 H;  3CD6 K;  3CME K;  1S72 K;  1Q82 L;  1K9M L;  4V19 O;  1YHQ K;  5JVG H;  1N8R L;  3CC7 K;  1K8A L;  1YJ9 K;  5JVH H;  1VQ7 K;  1W2B J;  3CCQ K;  2OTL K;  2ZJR H;  1VQ6 K;  3CCS K;  3J7Y L;  3PIO H;  4WFN H;  2ZJQ H;  2OTJ K;  1KD1 L;  1VQP K;  3G71 K;  1M90 L;  2QEX K;  3I56 K;  1Q7Y L;  1KC8 L;  5GAG L;  1NJI L;  5AN9 E;  1Q86 L;  4WCE H;  4WF9 H;  1YIJ K;  1VQL K;  3CCL K;  1VQN K;  2QA4 K;  3CPW J; 
#chains in the Genus database with same CATH topology
 3CCE K;  1VQ8 K;  1QVF J;  5DM6 H;  1K73 L;  1YIT K;  3CCU K;  3OW2 J;  4U67 H;  3PIP H;  3CC2 K;  5MLC M;  4UY8 K;  1VQK K;  1VQ4 K;  3CXC J;  2ZJP H;  5GAE L;  1WHI A;  3CCM K;  3I55 K;  1VQO K;  4IO9 H;  1QVG J;  3CCJ K;  1VQM K;  4IOA H;  3CCV K;  3CC4 K;  5GAH L;  1YI2 K;  3CCR K;  1YJN K;  3G4S K;  3J7Z K;  3CMA K;  1JJ2 J;  5H1S M;  5HL7 H;  1VQ5 K;  4WFB H;  1Q81 L;  4IOC H;  4WFA H;  1KQS J;  3G6E K;  3DLL H;  1M1K L;  5GAD L;  3CF5 H;  1VQ9 K;  1YJW K;  5DM7 H;  3CD6 K;  3CME K;  1S72 K;  1Q82 L;  1K9M L;  4V19 O;  1YHQ K;  5JVG H;  1N8R L;  3CC7 K;  1K8A L;  1YJ9 K;  5JVH H;  1VQ7 K;  1W2B J;  3CCQ K;  2OTL K;  2ZJR H;  1VQ6 K;  3CCS K;  3J7Y L;  3PIO H;  4WFN H;  2ZJQ H;  2OTJ K;  1KD1 L;  1VQP K;  3G71 K;  1M90 L;  2QEX K;  3I56 K;  1Q7Y L;  1KC8 L;  5GAG L;  1NJI L;  5AN9 E;  1Q86 L;  4WCE H;  4WF9 H;  1YIJ K;  1VQL K;  3CCL K;  1VQN K;  2QA4 K;  3CPW J; 
#chains in the Genus database with same CATH homology
 3CCE K;  1VQ8 K;  1QVF J;  5DM6 H;  1K73 L;  1YIT K;  3CCU K;  3OW2 J;  4U67 H;  3PIP H;  3CC2 K;  5MLC M;  4UY8 K;  1VQK K;  1VQ4 K;  3CXC J;  2ZJP H;  5GAE L;  1WHI A;  3CCM K;  3I55 K;  1VQO K;  4IO9 H;  1QVG J;  3CCJ K;  1VQM K;  4IOA H;  3CCV K;  3CC4 K;  5GAH L;  1YI2 K;  3CCR K;  1YJN K;  3G4S K;  3J7Z K;  3CMA K;  1JJ2 J;  5H1S M;  5HL7 H;  1VQ5 K;  4WFB H;  1Q81 L;  4IOC H;  4WFA H;  1KQS J;  3G6E K;  3DLL H;  1M1K L;  5GAD L;  3CF5 H;  1VQ9 K;  1YJW K;  5DM7 H;  3CD6 K;  3CME K;  1S72 K;  1Q82 L;  1K9M L;  4V19 O;  1YHQ K;  5JVG H;  1N8R L;  3CC7 K;  1K8A L;  1YJ9 K;  5JVH H;  1VQ7 K;  1W2B J;  3CCQ K;  2OTL K;  2ZJR H;  1VQ6 K;  3CCS K;  3J7Y L;  3PIO H;  4WFN H;  2ZJQ H;  2OTJ K;  1KD1 L;  1VQP K;  3G71 K;  1M90 L;  2QEX K;  3I56 K;  1Q7Y L;  1KC8 L;  5GAG L;  1NJI L;  5AN9 E;  1Q86 L;  4WCE H;  4WF9 H;  1YIJ K;  1VQL K;  3CCL K;  1VQN K;  2QA4 K;  3CPW J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...