4IOCJ

Crystal structure of compound 4f bound to large ribosomal subunit (50s) from deinococcus radiodurans
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
136
structure length
136
Chain Sequence
KRTKFRKQFRGRMTGDAKGGDYVAFGDYGLIAMEPAWIKSNQIEACRIVMSRHFRRGGKIYIRIFPDKPVTKKPAETRMGKGKGAVEYWVSVVKPGRVMFEVAGVTEEQAKEAFRLAGHKLPIQTKMVKREVYDEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Novel 3-O-carbamoyl erythromycin A derivatives (carbamolides) with activity against resistant staphylococcal and streptococcal isolates.
pubmed doi rcsb
molecule tags Ribosome/ribosome inhibitor
molecule keywords 23S ribosomal RNA
total genus 22
structure length 136
sequence length 136
ec nomenclature
pdb deposition date 2013-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF00252 Ribosomal_L16 Ribosomal protein L16p/L10e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.1170.10 Alpha Beta Alpha-Beta Complex Aldehyde Oxidoreductase; domain 3 Ribosomal protein L10e/L16 4iocJ01
1VQ6H 1M90J 1VQ8H 3CCSH 1M1KJ 3G6EH 3I55H 4IO9J 1Q7YJ 4WFAJ 1VQPH 1KC8J 3DLLJ 2PA2A 3CF5J 3CD6H 1YJWH 4WFBJ 1NJIJ 1VQNH 2ZJPJ 1QVGH 5GADN 1K9MJ 1K73J 1K8AJ 1JJ2H 1YJ9H 3G71H 1VQ5H 3CC4H 1YITH 3CCMH 3CPWH 3PIPJ 3CCLH 5H1SO 1S72H 3I56H 1Y69K 1VQLH 5AN9F 1YIJH 1QVFH 5JVGJ 2ZJQJ 4IOAJ 3CCVH 1N8RJ 4WFNJ 3CCEH 2OTJH 5GAGN 2OTLH 3J7ZM 1YHQH 1YI2H 3CC2H 1VQ7H 4IOCJ 3G4SH 4UY8M 5HL7J 3CMAH 3CXCH 3PIOJ 1VQKH 5GAEN 2QEXH 3CCRH 3CMEH 2ZJRJ 4U67J 1Q82J 5DM6J 4WF9J 1VQ9H 1WKIA 1KD1J 1VQOH 3CCQH 3CCUH 1YJNH 3CCJH 5DM7J 1VQ4H 3OW2H 4WCEJ 5MLCO 1KQSH 5JVHJ 2QA4H 1VQMH 1Q81J 5GAHN 1W2BH 1Q86J 3CC7H
chains in the Genus database with same CATH superfamily
1N61B 1VQ6H 4USAA 3L0GA 1M90J 3CCSH 1SIJA 1N5WB 1M1KJ 1VQ8H 3G6EH 3I55H 1N60B 3C2RA 4IO9J 1Q7YJ 3SR6C 1JRPB 3EUB4 5HUOA 1O4UA 3FAHA 4X46A 3VMMA 4ZOHA 4WFAJ 1VQPH 1KC8J 4US9A 2PA2A 3CF5J 3DLLJ 3CD6H 1YJWH 2WK5A 4GA5A 4WFBJ 2JBMA 3AN1A 1NJIJ 1VQNH 2ZJPJ 1FMAE 4XR5A 5EP8A 1QVGH 1YTEA 5GADN 1K9MJ 4YEKA 1NVJA 1K73J 1K8AJ 1JJ2H 5AYXA 1QPOA 1FFVB 1YJ9H 2B7QA 5MPOC 3C2OA 3AMZA 3G71H 1VQ5H 3CC4H 2W3SB 1YITH 1N63B 3CCMH 1FFUB 3CPWH 3PAJA 1QAPA 3PIPJ 5AYYA 5AYZA 3CCLH 1N62B 1V97A 5H1SO 1S72H 2TPTA 3NVVC 3I56H 1Y69K 4EADA 4AP8A 5AN9F 1VQLH 4KWVA 1YIJH 1QPRA 1QVFH 5JVGJ 3BIIE 2ZJQJ 4IOAJ 3CCVH 1QPQA 1BRWA 1JROB 1RM6A 1FO4A 1N8RJ 3C2EA 5HUPA 4WFNJ 3CCEH 2OTJH 1OTPA 5GAGN 1YTDA 2I1OA 2OTLH 3J7ZM 1YHQH 1YI2H 1WYGA 3CC2H 1VQ7H 4US8A 4IOCJ 3G4SH 1DGJA 1YTKA 4UY8M 5HL7J 3H5QA 1VLBA 3CMAH 3CXCH 3NS1C 3PIOJ 4C7ZA 1VQKH 5GAEN 2I14A 4EAFA 2QEXH 3CCRH 3CMEH 1AZYA 3NVWC 2ZJRJ 3TQVA 3NVYC 4C80A 4GA6A 3GNNA 4U67J 1Q82J 5EY3A 2W3RB 2WK6A 3NVZC 3NRZC 5DM6J 1WKIA 4WF9J 1VQ9H 3ETRC 1QPNA 1KD1J 1NVIE 2B7NA 3WO0A 1VQOH 3CCQH 2W54B 3CCUH 1YJNH 3C2FA 3CCJH 2W55B 3WNZA 5DM7J 4YYYA 3FC4A 3B9JC 1VQ4H 3OW2H 4WCEJ 3L4PA 5MLCO 1UOUA 1KQSH 1SB3A 1FIQC 4GA4A 3WO1A 5JVHJ 1X1OA 2QA4H 1N5XA 2OMDA 2QIEA 1VQMH 3AM9A 2E3TA 4C7YA 1Q81J 2Q5WE 4KWWA 5GAHN 2J0FA 2B7PA 2DSJA 2WP4A 4I9AA 1W2BH 4LHMA 1Q86J 1VDVA 1ZXIB 3C2VA 3CC7H 3RPFA 1FM0E 5HULA
chains in the Genus database with same CATH topology
1VQ6H 1M90J 1VQ8H 3CCSH 1M1KJ 3G6EH 3I55H 4IO9J 1Q7YJ 4WFAJ 1VQPH 1KC8J 3DLLJ 2PA2A 3CF5J 3CD6H 1YJWH 4WFBJ 1NJIJ 1VQNH 2ZJPJ 1QVGH 5GADN 1K9MJ 1K73J 1K8AJ 1JJ2H 1YJ9H 3G71H 1VQ5H 3CC4H 1YITH 3CCMH 3CPWH 3PIPJ 3CCLH 5H1SO 1S72H 3I56H 1Y69K 1VQLH 5AN9F 1YIJH 1QVFH 5JVGJ 2ZJQJ 4IOAJ 3CCVH 1N8RJ 4WFNJ 3CCEH 2OTJH 5GAGN 2OTLH 3J7ZM 1YHQH 1YI2H 3CC2H 1VQ7H 4IOCJ 3G4SH 4UY8M 5HL7J 3CMAH 3CXCH 3PIOJ 1VQKH 5GAEN 2QEXH 3CCRH 3CMEH 2ZJRJ 4U67J 1Q82J 5DM6J 4WF9J 1VQ9H 1WKIA 1KD1J 1VQOH 3CCQH 3CCUH 1YJNH 3CCJH 5DM7J 1VQ4H 3OW2H 4WCEJ 5MLCO 1KQSH 5JVHJ 2QA4H 1VQMH 1Q81J 5GAHN 1W2BH 1Q86J 3CC7H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQ6 H;  1M90 J;  1VQ8 H;  3CCS H;  1M1K J;  3G6E H;  3I55 H;  4IO9 J;  1Q7Y J;  4WFA J;  1VQP H;  1KC8 J;  3DLL J;  2PA2 A;  3CF5 J;  3CD6 H;  1YJW H;  4WFB J;  1NJI J;  1VQN H;  2ZJP J;  1QVG H;  5GAD N;  1K9M J;  1K73 J;  1K8A J;  1JJ2 H;  1YJ9 H;  3G71 H;  1VQ5 H;  3CC4 H;  1YIT H;  3CCM H;  3CPW H;  3PIP J;  3CCL H;  5H1S O;  1S72 H;  3I56 H;  1Y69 K;  1VQL H;  5AN9 F;  1YIJ H;  1QVF H;  5JVG J;  2ZJQ J;  4IOA J;  3CCV H;  1N8R J;  4WFN J;  3CCE H;  2OTJ H;  5GAG N;  2OTL H;  3J7Z M;  1YHQ H;  1YI2 H;  3CC2 H;  1VQ7 H;  4IOC J;  3G4S H;  4UY8 M;  5HL7 J;  3CMA H;  3CXC H;  3PIO J;  1VQK H;  5GAE N;  2QEX H;  3CCR H;  3CME H;  2ZJR J;  4U67 J;  1Q82 J;  5DM6 J;  4WF9 J;  1VQ9 H;  1WKI A;  1KD1 J;  1VQO H;  3CCQ H;  3CCU H;  1YJN H;  3CCJ H;  5DM7 J;  1VQ4 H;  3OW2 H;  4WCE J;  5MLC O;  1KQS H;  5JVH J;  2QA4 H;  1VQM H;  1Q81 J;  5GAH N;  1W2B H;  1Q86 J;  3CC7 H; 
#chains in the Genus database with same CATH topology
 1N61 B;  1VQ6 H;  4USA A;  3L0G A;  1M90 J;  3CCS H;  1SIJ A;  1N5W B;  1M1K J;  1VQ8 H;  3G6E H;  3I55 H;  1N60 B;  3C2R A;  4IO9 J;  1Q7Y J;  3SR6 C;  1JRP B;  3EUB 4;  5HUO A;  1O4U A;  3FAH A;  4X46 A;  3VMM A;  4ZOH A;  4WFA J;  1VQP H;  1KC8 J;  4US9 A;  2PA2 A;  3CF5 J;  3DLL J;  3CD6 H;  1YJW H;  2WK5 A;  4GA5 A;  4WFB J;  2JBM A;  3AN1 A;  1NJI J;  1VQN H;  2ZJP J;  1FMA E;  4XR5 A;  5EP8 A;  1QVG H;  1YTE A;  5GAD N;  1K9M J;  4YEK A;  1NVJ A;  1K73 J;  1K8A J;  1JJ2 H;  5AYX A;  1QPO A;  1FFV B;  1YJ9 H;  2B7Q A;  5MPO C;  3C2O A;  3AMZ A;  3G71 H;  1VQ5 H;  3CC4 H;  2W3S B;  1YIT H;  1N63 B;  3CCM H;  1FFU B;  3CPW H;  3PAJ A;  1QAP A;  3PIP J;  5AYY A;  5AYZ A;  3CCL H;  1N62 B;  1V97 A;  5H1S O;  1S72 H;  2TPT A;  3NVV C;  3I56 H;  1Y69 K;  4EAD A;  4AP8 A;  5AN9 F;  1VQL H;  4KWV A;  1YIJ H;  1QPR A;  1QVF H;  5JVG J;  3BII E;  2ZJQ J;  4IOA J;  3CCV H;  1QPQ A;  1BRW A;  1JRO B;  1RM6 A;  1FO4 A;  1N8R J;  3C2E A;  5HUP A;  4WFN J;  3CCE H;  2OTJ H;  1OTP A;  5GAG N;  1YTD A;  2I1O A;  2OTL H;  3J7Z M;  1YHQ H;  1YI2 H;  1WYG A;  3CC2 H;  1VQ7 H;  4US8 A;  4IOC J;  3G4S H;  1DGJ A;  1YTK A;  4UY8 M;  5HL7 J;  3H5Q A;  1VLB A;  3CMA H;  3CXC H;  3NS1 C;  3PIO J;  4C7Z A;  1VQK H;  5GAE N;  2I14 A;  4EAF A;  2QEX H;  3CCR H;  3CME H;  1AZY A;  3NVW C;  2ZJR J;  3TQV A;  3NVY C;  4C80 A;  4GA6 A;  3GNN A;  4U67 J;  1Q82 J;  5EY3 A;  2W3R B;  2WK6 A;  3NVZ C;  3NRZ C;  5DM6 J;  1WKI A;  4WF9 J;  1VQ9 H;  3ETR C;  1QPN A;  1KD1 J;  1NVI E;  2B7N A;  3WO0 A;  1VQO H;  3CCQ H;  2W54 B;  3CCU H;  1YJN H;  3C2F A;  3CCJ H;  2W55 B;  3WNZ A;  5DM7 J;  4YYY A;  3FC4 A;  3B9J C;  1VQ4 H;  3OW2 H;  4WCE J;  3L4P A;  5MLC O;  1UOU A;  1KQS H;  1SB3 A;  1FIQ C;  4GA4 A;  3WO1 A;  5JVH J;  1X1O A;  2QA4 H;  1N5X A;  2OMD A;  2QIE A;  1VQM H;  3AM9 A;  2E3T A;  4C7Y A;  1Q81 J;  2Q5W E;  4KWW A;  5GAH N;  2J0F A;  2B7P A;  2DSJ A;  2WP4 A;  4I9A A;  1W2B H;  4LHM A;  1Q86 J;  1VDV A;  1ZXI B;  3C2V A;  3CC7 H;  3RPF A;  1FM0 E;  5HUL A; 
#chains in the Genus database with same CATH homology
 1VQ6 H;  1M90 J;  1VQ8 H;  3CCS H;  1M1K J;  3G6E H;  3I55 H;  4IO9 J;  1Q7Y J;  4WFA J;  1VQP H;  1KC8 J;  3DLL J;  2PA2 A;  3CF5 J;  3CD6 H;  1YJW H;  4WFB J;  1NJI J;  1VQN H;  2ZJP J;  1QVG H;  5GAD N;  1K9M J;  1K73 J;  1K8A J;  1JJ2 H;  1YJ9 H;  3G71 H;  1VQ5 H;  3CC4 H;  1YIT H;  3CCM H;  3CPW H;  3PIP J;  3CCL H;  5H1S O;  1S72 H;  3I56 H;  1Y69 K;  1VQL H;  5AN9 F;  1YIJ H;  1QVF H;  5JVG J;  2ZJQ J;  4IOA J;  3CCV H;  1N8R J;  4WFN J;  3CCE H;  2OTJ H;  5GAG N;  2OTL H;  3J7Z M;  1YHQ H;  1YI2 H;  3CC2 H;  1VQ7 H;  4IOC J;  3G4S H;  4UY8 M;  5HL7 J;  3CMA H;  3CXC H;  3PIO J;  1VQK H;  5GAE N;  2QEX H;  3CCR H;  3CME H;  2ZJR J;  4U67 J;  1Q82 J;  5DM6 J;  4WF9 J;  1VQ9 H;  1WKI A;  1KD1 J;  1VQO H;  3CCQ H;  3CCU H;  1YJN H;  3CCJ H;  5DM7 J;  1VQ4 H;  3OW2 H;  4WCE J;  5MLC O;  1KQS H;  5JVH J;  2QA4 H;  1VQM H;  1Q81 J;  5GAH N;  1W2B H;  1Q86 J;  3CC7 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...