4IOCP

Crystal structure of compound 4f bound to large ribosomal subunit (50s) from deinococcus radiodurans
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
127
structure length
127
Chain Sequence
FRNKKQRKQQVKLRKPGFAVAKYVRMSPRKVRLVVDVIRGKSVQDAEDLLRFIPRSASEPVAKVLNSAKANALHNDEMLEDRLFVKEAYVDAGPTLKRLIPRARGSANIIKKRTSHITIIVAEKGNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Novel 3-O-carbamoyl erythromycin A derivatives (carbamolides) with activity against resistant staphylococcal and streptococcal isolates.
pubmed doi rcsb
molecule tags Ribosome/ribosome inhibitor
molecule keywords 23S ribosomal RNA
total genus 26
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2013-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF00237 Ribosomal_L22 Ribosomal protein L22p/L17e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.470.10 Alpha Beta Alpha-Beta Complex Ribosomal Protein L22; Chain A Ribosomal protein L22/L17 4iocP00
2OTLR 1VQNR 3I55R 3CD6R 4WFNP 4WCEP 3CCRR 3OW2Q 4WFAP 1Q86S 2OTJR 2ZJPP 1VQKR 2ZJRP 3CC7R 1VQ9R 5GAET 3PIOP 3CMER 3CCMR 1KD1S 1M1KS 3CXCQ 5JVGP 5DM6P 3CMAR 3PIPP 3J7YT 1S72R 1VQ4R 1N8RS 1Q7YS 5H1SU 4IO9P 1JJ2Q 4V19W 3CCSR 1YHQR 1YIJR 5JVHP 1YJNR 5MLCU 1W2BQ 1Q81S 2ZJQP 4IOAP 4WF9P 1QVFQ 5GAHT 1K73S 3G71R 1VQ5R 2QEXR 1K9MS 4UY8S 1VQMR 3CPWQ 3CCLR 3CCVR 1VQPR 1KC8S 4WFBP 3CCER 1VQ8R 1KQSQ 1YITR 3CCQR 3J7ZS 3DLLP 2QA4R 5GAGT 1BXEA 1VQ7R 1VQOR 1I4JA 3CCJR 3CC2R 5GADT 1VQ6R 1VQLR 4IOCP 3G4SR 5HL7P 1YJ9R 1YI2R 1K8AS 4U67P 3G6ER 1YJWR 3I56R 5DM7P 3CCUR 1M90S 1QVGQ 1NJIS 3CF5P 3CC4R 1Q82S
chains in the Genus database with same CATH superfamily
2OTLR 1VQNR 3I55R 3CD6R 4WFNP 2WASB 2WDSA 4WCEP 3CCRR 3OW2Q 4WFAP 1F7TA 3H7QA 1Q86S 2OTJR 4DXEA 2ZJPP 3HYKA 1VQKR 2ZJRP 3CC7R 1QR0A 2WDOA 1VQ9R 5GAET 3PIOP 3CMER 3CCMR 1KD1S 1M1KS 4HC6A 2D0OA 5CXDA 3CXCQ 1F80A 1FTEA 5JVGP 2JBZA 5DM6P 3CMAR 3PIPP 2BYDA 3QMNA 3J7YT 3NFDA 1S72R 1VQ4R 1N8RS 3NE9A 4JM7A 1Q7YS 5H1SU 4IO9P 1JJ2Q 2CG5A 4V19W 3CCSR 1YHQR 4MRTA 1YIJR 5JVHP 1YJNR 5MLCU 1W2BQ 1Q81S 2ZJQP 4IOAP 4WF9P 1QVFQ 5GAHT 1K73S 1FTHA 3G71R 1VQ5R 2QEXR 1F7LA 1K9MS 1VQMR 4UY8S 3CPWQ 2C43A 3CCLR 3CCVR 1VQPR 1KC8S 4WFBP 3CCER 1VQ8R 1KQSQ 1YITR 1FTFA 3CCQR 3J7ZS 3DLLP 2QA4R 5GAGT 1BXEA 1NBWA 3NE1A 1VQ7R 1VQOR 1I4JA 3CCJR 3CC2R 5GADT 1VQ6R 2WATA 2BDDA 1VQLR 4IOCP 3G4SR 2WASA 5HL7P 1YJ9R 1YI2R 1K8AS 2D0PA 4U67P 3G6ER 1YJWR 2WDYA 3I56R 5CMOA 5DM7P 3CCUR 3GWMA 1M90S 1QVGQ 3NE3B 2JCAA 3HQJA 1NJIS 3CF5P 2QG8A 3CC4R 1Q82S
chains in the Genus database with same CATH topology
2OTLR 1VQNR 3I55R 3CD6R 4WFNP 4WCEP 3CCRR 3OW2Q 4WFAP 1Q86S 2OTJR 2ZJPP 1VQKR 2ZJRP 3CC7R 1VQ9R 5GAET 3PIOP 3CMER 3CCMR 1KD1S 1M1KS 3CXCQ 5JVGP 5DM6P 3CMAR 3PIPP 3J7YT 1S72R 1VQ4R 1N8RS 1Q7YS 5H1SU 4IO9P 1JJ2Q 4V19W 3CCSR 1YHQR 1YIJR 5JVHP 1YJNR 5MLCU 1W2BQ 1Q81S 2ZJQP 4IOAP 4WF9P 1QVFQ 5GAHT 1K73S 3G71R 1VQ5R 2QEXR 1K9MS 4UY8S 1VQMR 3CPWQ 3CCLR 3CCVR 1VQPR 1KC8S 4WFBP 3CCER 1VQ8R 1KQSQ 1YITR 3CCQR 3J7ZS 3DLLP 2QA4R 5GAGT 1BXEA 1VQ7R 1VQOR 1I4JA 3CCJR 3CC2R 5GADT 1VQ6R 1VQLR 4IOCP 3G4SR 5HL7P 1YJ9R 1YI2R 1K8AS 4U67P 3G6ER 1YJWR 3I56R 5DM7P 3CCUR 1M90S 1QVGQ 1NJIS 3CF5P 3CC4R 1Q82S
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OTL R;  1VQN R;  3I55 R;  3CD6 R;  4WFN P;  4WCE P;  3CCR R;  3OW2 Q;  4WFA P;  1Q86 S;  2OTJ R;  2ZJP P;  1VQK R;  2ZJR P;  3CC7 R;  1VQ9 R;  5GAE T;  3PIO P;  3CME R;  3CCM R;  1KD1 S;  1M1K S;  3CXC Q;  5JVG P;  5DM6 P;  3CMA R;  3PIP P;  3J7Y T;  1S72 R;  1VQ4 R;  1N8R S;  1Q7Y S;  5H1S U;  4IO9 P;  1JJ2 Q;  4V19 W;  3CCS R;  1YHQ R;  1YIJ R;  5JVH P;  1YJN R;  5MLC U;  1W2B Q;  1Q81 S;  2ZJQ P;  4IOA P;  4WF9 P;  1QVF Q;  5GAH T;  1K73 S;  3G71 R;  1VQ5 R;  2QEX R;  1K9M S;  4UY8 S;  1VQM R;  3CPW Q;  3CCL R;  3CCV R;  1VQP R;  1KC8 S;  4WFB P;  3CCE R;  1VQ8 R;  1KQS Q;  1YIT R;  3CCQ R;  3J7Z S;  3DLL P;  2QA4 R;  5GAG T;  1BXE A;  1VQ7 R;  1VQO R;  1I4J A;  3CCJ R;  3CC2 R;  5GAD T;  1VQ6 R;  1VQL R;  4IOC P;  3G4S R;  5HL7 P;  1YJ9 R;  1YI2 R;  1K8A S;  4U67 P;  3G6E R;  1YJW R;  3I56 R;  5DM7 P;  3CCU R;  1M90 S;  1QVG Q;  1NJI S;  3CF5 P;  3CC4 R;  1Q82 S; 
#chains in the Genus database with same CATH topology
 2OTL R;  1VQN R;  3I55 R;  3CD6 R;  4WFN P;  2WAS B;  2WDS A;  4WCE P;  3CCR R;  3OW2 Q;  4WFA P;  1F7T A;  3H7Q A;  1Q86 S;  2OTJ R;  4DXE A;  2ZJP P;  3HYK A;  1VQK R;  2ZJR P;  3CC7 R;  1QR0 A;  2WDO A;  1VQ9 R;  5GAE T;  3PIO P;  3CME R;  3CCM R;  1KD1 S;  1M1K S;  4HC6 A;  2D0O A;  5CXD A;  3CXC Q;  1F80 A;  1FTE A;  5JVG P;  2JBZ A;  5DM6 P;  3CMA R;  3PIP P;  2BYD A;  3QMN A;  3J7Y T;  3NFD A;  1S72 R;  1VQ4 R;  1N8R S;  3NE9 A;  4JM7 A;  1Q7Y S;  5H1S U;  4IO9 P;  1JJ2 Q;  2CG5 A;  4V19 W;  3CCS R;  1YHQ R;  4MRT A;  1YIJ R;  5JVH P;  1YJN R;  5MLC U;  1W2B Q;  1Q81 S;  2ZJQ P;  4IOA P;  4WF9 P;  1QVF Q;  5GAH T;  1K73 S;  1FTH A;  3G71 R;  1VQ5 R;  2QEX R;  1F7L A;  1K9M S;  1VQM R;  4UY8 S;  3CPW Q;  2C43 A;  3CCL R;  3CCV R;  1VQP R;  1KC8 S;  4WFB P;  3CCE R;  1VQ8 R;  1KQS Q;  1YIT R;  1FTF A;  3CCQ R;  3J7Z S;  3DLL P;  2QA4 R;  5GAG T;  1BXE A;  1NBW A;  3NE1 A;  1VQ7 R;  1VQO R;  1I4J A;  3CCJ R;  3CC2 R;  5GAD T;  1VQ6 R;  2WAT A;  2BDD A;  1VQL R;  4IOC P;  3G4S R;  2WAS A;  5HL7 P;  1YJ9 R;  1YI2 R;  1K8A S;  2D0P A;  4U67 P;  3G6E R;  1YJW R;  2WDY A;  3I56 R;  5CMO A;  5DM7 P;  3CCU R;  3GWM A;  1M90 S;  1QVG Q;  3NE3 B;  2JCA A;  3HQJ A;  1NJI S;  3CF5 P;  2QG8 A;  3CC4 R;  1Q82 S; 
#chains in the Genus database with same CATH homology
 2OTL R;  1VQN R;  3I55 R;  3CD6 R;  4WFN P;  4WCE P;  3CCR R;  3OW2 Q;  4WFA P;  1Q86 S;  2OTJ R;  2ZJP P;  1VQK R;  2ZJR P;  3CC7 R;  1VQ9 R;  5GAE T;  3PIO P;  3CME R;  3CCM R;  1KD1 S;  1M1K S;  3CXC Q;  5JVG P;  5DM6 P;  3CMA R;  3PIP P;  3J7Y T;  1S72 R;  1VQ4 R;  1N8R S;  1Q7Y S;  5H1S U;  4IO9 P;  1JJ2 Q;  4V19 W;  3CCS R;  1YHQ R;  1YIJ R;  5JVH P;  1YJN R;  5MLC U;  1W2B Q;  1Q81 S;  2ZJQ P;  4IOA P;  4WF9 P;  1QVF Q;  5GAH T;  1K73 S;  3G71 R;  1VQ5 R;  2QEX R;  1K9M S;  4UY8 S;  1VQM R;  3CPW Q;  3CCL R;  3CCV R;  1VQP R;  1KC8 S;  4WFB P;  3CCE R;  1VQ8 R;  1KQS Q;  1YIT R;  3CCQ R;  3J7Z S;  3DLL P;  2QA4 R;  5GAG T;  1BXE A;  1VQ7 R;  1VQO R;  1I4J A;  3CCJ R;  3CC2 R;  5GAD T;  1VQ6 R;  1VQL R;  4IOC P;  3G4S R;  5HL7 P;  1YJ9 R;  1YI2 R;  1K8A S;  4U67 P;  3G6E R;  1YJW R;  3I56 R;  5DM7 P;  3CCU R;  1M90 S;  1QVG Q;  1NJI S;  3CF5 P;  3CC4 R;  1Q82 S; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...