4IOCQ

Crystal structure of compound 4f bound to large ribosomal subunit (50s) from deinococcus radiodurans
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
93
structure length
93
Chain Sequence
SHYDILQAPVISEKAYSAMERGVYSFWVSPKATKTEIKDAIQQAFGVRVIGISTMNVPGKRKRVGRFIGQRNDRKKAIVRLAEGQSIEALAGQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Novel 3-O-carbamoyl erythromycin A derivatives (carbamolides) with activity against resistant staphylococcal and streptococcal isolates.
pubmed doi rcsb
molecule tags Ribosome/ribosome inhibitor
molecule keywords 23S ribosomal RNA
total genus 15
structure length 93
sequence length 93
ec nomenclature
pdb deposition date 2013-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00276 Ribosomal_L23 Ribosomal protein L23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4iocQ00
2LKZA 2GO9A 3THPA 3Q2TC 2CPHA 2AYBA 3PIOQ 4YOEA 2E5IA 2KXFA 3MDFA 1VQ8S 3CMES 2DHGA 2M9KA 2BZ2A 1HA1A 1YJWS 2MB0B 1DBDA 3B4DA 4LJMA 2DNPA 1QVGR 3FEYB 3NNAA 2RVJA 3CTRA 4J5OA 2RS8A 2Q79A 1R8HA 3CXCR 2M8HA 2DGVA 5IM0B 2X1FA 3D2WA 3CCES 3CCLS 1UFWA 1OPIA 1WG4A 2GHPA 3I55S 1O0PA 2FC8A 2MYFA 2V94A 5GAEU 1WEZA 1DHMA 5LSLA 3BO2A 2VONA 2LECA 1JMTA 2XNRA 2VOPA 3CCMS 2E44A 5CA5A 5CYJA 2MHNA 5DETA 1VQ7S 3VAMA 3MD3A 1VQLS 3Q2SC 1VQ6S 5DDOC 1U1QA 3VAGA 2KHCA 2DNNA 2RT3A 4QPTA 1VQ5S 3BS9A 2PE8A 1KOHA 2DHAA 2XSFA 1WHVA 2UP1A 1OIAA 2E5JA 3RW6A 1YWXA 2XB2D 1X5SA 4TU8A 2DNYA 4PR6A 2MQLA 3HI9A 5EN1A 2KVIA 3UD3P 1W2BR 1X4HA 1KOOA 3CULA 2CQBA 2OJ3A 1H2VZ 2XS2A 3U1LA 5LSOA 1N8RT 3NNHA 2K3KA 2KXHA 1ZZNA 2CQGA 2M4MA 2I2YA 1U1LA 3S8SA 1M5PC 1FT8A 3H2UB 2LEAA 3K0JA 1JJ2R 1N88A 4QU7A 1M5OC 2HGMA 1X5OA 4TLQA 5ITHA 2LEBA 4Y0FA 1YJ9S 2ERRA 5D78A 2DNLA 1WHWA 2KRBA 1X4EA 3S01A 2CQCA 2D9OA 3H2VE 1VBYA 2EVZA 2MKJA 3UE2A 4UY8T 4FXVA 3MXHP 2DH9A 4TU9A 5DDPC 2QFJA 2MJNA 4F02A 2XNQA 3MOJB 3VF0B 3CD6S 1WG5A 2LYVA 2DIVA 5FJ4A 4EGLA 2RRAA 2DGSA 4OZ0A 2MSSA 3MD1A 4U67Q 3UCUP 1X5TA 3G6ES 2MKKA 1A7GE 5DDRC 3HHNB 3US5A 1SJRA 2MGZB 1URNA 4W90B 2CQHA 1U1MA 2HVZA 3J7ZT 3CCSS 3P6YC 2KM8C 2RS2A 3EGNA 3U1MA 3R1LA 4CH0S 2DHXA 1F9FA 4IOAQ 1WELA 2AYGA 1HL6A 2N7CA 1YIJS 1FO1A 2JVOA 4C4WA 2MY7A 1DZ5A 2RUGA 5DDQC 2ADBA 2CQ0A 3CCJS 2F9JA 3L3CA 2KXNB 3G9CA 4WIIA 2D3OR 1ZZFA 3IRWP 2EK1A 2MZSA 4OZ1A 1VC0A 3P3DA 3LQVA 3DLLQ 4RU2A 2M2BA 1U6FA 2MQOA 2XS7A 2YKAA 5D77A 1WF2A 5JVGQ 2HGLA 3BO3A 2DGQA 2DGXA 2HYIB 1VQNS 2DH8A 3IWNC 2MQQA 5JVHQ 2DGOA 1VQOS 2MZ1A 1K73T 2KI2A 2WBRA 2DNRA 2CQIA 2MZQA 2YH1A 1R8PA 2FPHX 1Q82T 3OW2R 4LMZA 2DH7A 1YI2S 3MUTP 2MKHA 2DNZA 1Q81T 1D8ZA 3I56S 2NLWA 3CC4S 5CXTA 1UW4A 5GAGU 4V19X 4BS2A 2D9PA 3G96A 4CIOA 3NMRA 4WFAQ 2L41A 2KM8B 4FXWA 4A8XA 4YB1P 4C7QA 1KC8T 2YTCA 5GVQA 1Q86T 2B0GA 1ZH5A 4PRFA 2KFYA 2L9WA 4TU7A 2CQ4A 4P6QA 2CPJA 1QVFR 1PGZA 1N54B 5IFMA 2MMYA 1U1OA 2JWNA 3MURP 1WTBA 2HZCA 2LXUA 2J8AA 1D9AA 2OSQA 2XS5A 2MSTA 2F3JA 2KG0A 2PEHA 5DM6Q 3VAFA 2JVRA 1WI6A 2SXLA 2MXYA 2MZTA 2X1BA 2MQPA 2MJUA 2FC9A 2YWKA 4WCEQ 2NZ4A 2CQPA 4IOCQ 1VQKS 4F26A 2CQDA 2RQCA 1X0FA 4WKRA 3LPYA 2DO0A 1FXLA 1FJCA 2DNMA 1PO6A 2M88A 2A3JA 1RK8A 1UAWA 2DNOA 2LA6A 5BJRA 5HO4A 1X4DA 2G4BA 1FJEB 2E5GA 1HD1A 1K8AT 2J0SD 2DNQA 1NO8A 2CPIA 3CUNA 2LCWA 3FEXB 2DHSA 3UWTA 1JJHA 2KRRA 1NJIT 2MGZA 2CJKA 1X4BA 3ZZYA 3UD4P 3EGZA 1YJNS 4QU6A 1WF0A 2N3LA 3G4SS 2E5HA 2MY8A 1A9NB 1CVJA 3MUVP 2DITA 2DGWA 2KH9A 2CPFA 2MKSA 4IO9Q 4WFBQ 5LXRA 1FJ7A 1X4GA 2N3OA 5DM7Q 3CCUS 3S6EA 1KQSR 2X1GA 3ULHA 3J7YU 4IUFA 2YH0A 2ZJPQ 1H2TZ 5LJ5Y 4ERDA 3BEGB 1JJ4A 5LJ3Y 2MQMA 2J76E 2LQ5A 1M5KC 1WF1A 2KN4A 1SJ3P 1X5PA 4M5DB 2CPDA 3SXLA 3TYTA 3G8SA 2DGTA 3P5TL 3PIPQ 1U2FA 1YTYA 2M0GB 4LIRA 4ZKAA 2DIUA 3CCRS 1S79A 1UP1A 2MZRA 2ADCA 3TP2A 3JB9k 4PKDB 1YHQS 2M7SA 4Y00A 2KYXA 2U1AA 1SJFA 1OO0B 2AYMA 2MKCA 1N52B 2RNEA 1VQPS 3VAKA 3CC2S 1M1KT 1SXLA 3EX7B 2DGUA 2DK2A 4F25A 5IM0A 3SDEA 5HL7Q 1K9MT 2CPYA 1SJQA 1M5VC 3MUMP 3SMZA 2J0QD 2BOPA 3NS6A 1WG1A 5GAHU 1IQTA 2CQ2A 2JRSA 3G8TA 1B7FA 3CCQS 1FNXH 1WI8A 1L3KA 1U1PA 2JX2A 3ZZZA 2DNKA 4W92B 3NS5A 1VQ9S 1X4CA 2RRBA 1QM9A 2CQ3A 2LMIA 3UCZP 1RKJA 1U1RA 2AYEA 4CH1A 1NU4A 1H2UX 2MZJA 4UQTA 5H1SV 1X4AA 4Z2XA 2X1AA 2CPXA 1P1TA 2VODA 2L08A 3UCGA 4WFNQ 1KD1T 2KT5A 2QEXS 1FHTA 3THTA 3P49B 4CQ1A 2DNHA 3VAHA 1U1NA 3TO8A 1BY9A 2CQ1A 5GMKa 2MPUA 1Q7YT 1VBXA 2DB1A 1WEXA 2LXIA 5IQQA 3V4MA 2ZJRQ 2HGNA 1M90T 2AD9A 2LA4A 2M70A 4ED5A 3N9UC 2OTLS 1SJ4P 3R1HA 1VC5A 1VBZA 3DXBA 1VQ4S 2O3DA 2QA4S 1WEYA 3B4MA 1XN9A 2OSRA 4WF9Q 2DNGA 4C0OC 1S72S 2OTJS 2CPEA 2RQ4A 2N82B 2DO4A 3R27A 3RW7A 4YUDA 1WHXA 3CPWR 1OWXA 2MQNA 3VALA 3SDEB 3CC7S 1X4FA 3BO4A 1P27B 2DISA 2OIHA 2CPZA 1YITS 2VOOA 2EK6A 1VC6A 5LXYA 2RU3A 3VAJA 2FY1A 3CF5Q 2KG1A 2M8DB 2F9DA 2I38A 2KU7A 1U1KA 1WHYA 3S7RA 1HD0A 2MKIA 1G2EA 1U6BA 3VAIA 5MLCV 3CMAS 2K8GA 2FHOB 1WWHA 5GADU 3NNCA 2U2FA 2G1DA 3G71S 1VQMS 1AUDA 4QQBA 2ZJQQ 3CCVS 1H6KX 2M52A 2G0CA 1DRZA 3MI7X
chains in the Genus database with same CATH superfamily
3N5FA 3C6TA 1QDUB 1JLEA 2P2CB 1RLDA 4JYAF 5F8JA 1PCAA 3ZZ0A 4IG0B 4MJKA 3IG1B 3MEDB 3Q0AA 4DQQA 1J5OA 4C6AA 4P72A 2BANA 4GO7X 4RO0A 2ZH3A 2VA2A 2HAFA 3HVTA 3NCPA 1KLMB 1PAUB 1RHJB 1ZAWA 2X3GA 1UFKA 3DOLA 1UJ4A 2BBEA 5HQMA 3Q8RB 4K4TA 5HLFB 3CD0A 4JI6F 2ZWPA 1RYRA 1IR2A 4YDXA 2BM1A 3CMES 2JLFA 1Q5VA 1VRUB 4ECZA 2I6WA 1HWKA 3ILJA 3M32A 1BWVA 2WOMB 5AE2A 2ZDOA 1S4FA 3B4DA 2V2KA 2QGFB 3EUNA 2O01C 2H5IB 5EN1A 3SSRA 3M8QA 1HMVA 5D4OA 1K1QA 3MM7B 2ZD1A 1NHKL 4OJGA 1N5QA 2K2PA 2Q79A 2HURA 1SKRA 1RAOA 3DRSA 1R8HA 4I6AA 2FVSA 2R8JA 4LFBJ 2LQJA 1VLYA 2YKNB 4LSLB 5CD4A 4ANDA 2FQQB 1JLAB 5A0YA 1VQYA 2Z56B 3IBFB 1FDDA 1NJXA 4NXNF 4WYLA 1SH2A 4KGMA 1OPIA 3UDVA 1WG4A 1NXIA 3KUEA 1H73A 2JLEA 2OHDA 1SIWB 5HJXA 2ZH4A 4D3HA 3RRGA 1LK5A 1UA1A 4IFYA 1IUJA 2UUWA 2LECA 4J37A 1ZM2A 4ZPTR 2CVIA 3A3OB 5EHHA 1LWEA 3ET6B 3ZZRA 3Q23A 1X9MA 3M8YA 2VOPA 2EWHA 5DQGA 1TELA 4OHWA 4CLTA 2K1RA 3BGRB 1ICEB 3LF0A 3NGUA 4YB7A 4OHVA 4DLEA 4A8MP 2CIMA 1LV5A 3VAMA 3I9ZA 1TZ0A 2WSCC 3PTWA 4DR2J 1VQ6S 1RTDA 1SKSA 1G3OA 2KHCA 4DS4A 2DNNA 2NPIA 1VQ5S 2MHEA 4L76A 4P2FA 4JOUA 2IMWP 4ZPWR 1OIAA 2E5JA 4NLSA 1WJ9A 2ZUAA 4DV4J 3LWLA 3K5NA 1GAOA 1U25A 1X5SA 4N47A 4WFZA 3ZTQA 4H54A 4O3PA 2HHTA 2EG1A 5I4MA 2ZH6A 5G0RA 2QSFA 3BF4A 4LF6F 1KHWA 5L1IA 1APSA 2MQLA 4ECTA 2DRBA 4OIXA 2VG7A 3PR4A 4OX9J 4X4RA 2ZZNA 5I3QA 1X4HA 1C1CA 3Q8SB 3TX8A 1W2BR 4K4UA 4L3NA 2C2KB 4B3MF 2K3IA 4DQIA 1F3VA 1SPBP 2OJ3A 2MTLA 2D1CA 3NBPB 3TEHB 2E5LJ 1NDKA 2QLBB 3ZTOA 3K58A 4TKTA 4EBDA 2MB0B 4ILRA 4Y34A 3UI3A 3BSOA 1EQ0A 3HDSA 3X3UA 1ZTWA 1HQUA 2CQGA 3GILA 2M4MA 1H0HB 3KG4A 5HMZA 1C1BA 1PBAA 5A8RA 5AJ3J 3AJ1A 1REVB 2HFZA 1Y4ZB 3NGRA 5JJBA 4DV6F 3TANA 1PJ6A 1M5PC 1FT8A 1S1XA 4DPOA 2JEGA 4FP9A 2B7BB 3I4PA 1U2CA 4NL5A 4ER8A 3FUYA 4CLZA 4X4OA 3T5HA 3K0JA 2ZVSA 1M5OC 4TLQA 1RUSA 2EG2A 1CJTB 3GP9A 4PG8A 1P9QC 1SC6A 2D41A 2GVZA 2AF6A 4UW2A 4AFFA 5D78A 5ITHA 1EJ7L 1XK8A 2E7VA 3LP2A 2YQ0A 3OR2B 2O67A 4M95A 2HNYB 2V34A 1I3OB 1X4EA 3DDNA 4DFPA 4NLDA 2D9OA 1BUXA 4RPFA 2MKJA 4MAKA 3WC0A 4DPXA 1JLQB 4DX7A 2ZH9A 1HR0F 2BDPA 3QRPA 3TZZA 2DH9A 5F41A 4A8SA 2OO4A 1YJ7A 1JLCA 1T11A 3IGNA 4YB6A 5DGBA 4B9VA 3PVXA 2OP5A 4PXBA 4DUYJ 5KT6A 2BJDA 2H51B 3VTIA 3BDPA 2QFJA 2CZ4A 2NSCA 5D4PA 1MWZA 3F0NA 5F9NA 1LWFB 3MOJB 2C2DA 2CDQA 3UN3A 1WG5A 2LYVA 3MMCB 1S1WA 4H4KC 5FJ4A 3CVKA 3K5LA 3RR7A 4R8UA 4NZ6A 4EGLA 5KFQA 3VGUA 2J6SA 3UN2A 5KFSA 4WYWA 2NXJA 3O5TB 4OJ3A 5IT4A 2XSJB 3CDAA 4FN5A 3DCAA 3TA2A 2EEYA 3PW4A 3A8IA 1IBCB 1RWNB 2BE9B 3EDQB 3HCXA 3H5YA 4AE5A 1IKWB 4I6YA 3DLHA 3HHNB 3RZAA 4EI2A 1PAEX 1URNA 4PQAA 1U1MA 4LFAF 4DV0F 3CCSS 4CLPA 4V19J 4P74A 1AYEA 4GRSA 2G1HA 3EGNA 4WPAA 5E2QA 3D67A 1AROP 2XMUA 3U1MA 3OV7A 2VQFJ 5I3UA 2AGQA 4HHUA 3AQPA 1LXJA 4IOAQ 1S0NA 2ZZMA 2R8KA 2HW3A 2HVIA 1UVKA 4YHHJ 2PFFB 3AA9A 4ELUA 4K50A 1CS4B 3MF5A 3C15A 1IBMJ 5J2NB 2LEPA 2MY7A 3MM6B 3RBZA 3U27A 2MDAA 1HHQA 1G1XA 3GYXB 3I82A 2F9JA 3C16B 3FFIA 1CULA 4TLRA 1RAGB 4XTTA 3M8QB 1IKXA 2V5HG 1FFGB 4KPYA 3G9CA 4JI4F 3H5XA 8AT1B 4ILMA 5HQ8A 1XNQF 2QC3A 3I5CA 1KEKA 2JZ5A 3TAMB 3VQTA 2XYGB 5BR8F 4R5PA 1FI4A 4LIWA 5J2NA 1YX2A 4CDIA 2MZSA 3ETMA 4LRDA 5KFAA 4LF6J 4N76A 3P3DA 2MLXA 4WBFA 1HBOA 4F4AA 4ATNA 2BJ8A 2M5YA 2M2BA 4DPTA 3PFOA 1S1TB 2B5JB 1YVFA 1WF2A 3TA1A 5KT7A 3HVTB 1KR4A 4EO8A 3GIJA 2OEJA 2V6AA 2ZOGA 5JVGQ 4KB7A 2R8IA 4M5IA 1LEOA 1U7LA 2DGXA 1MNEA 3W5YA 1FK9B 2RIJA 2DH8A 1RT4B 3QWUA 4Q43A 1ITPA 3DLKB 3KK3B 2FLLA 3V6DB 4KGVB 2ZBIA 2AZ3A 1Q95G 2GFFA 2VDHA 2MZQA 3J81U 2P6SA 3VGSA 2YH1A 2FPHX 1K1SA 2V69A 2HFSA 1Q82T 4FBUA 4YDDB 4DV5J 1BWEA 1W7WA 2DXFA 3HX9A 1U47A 5CXTA 2COLA 2QA2A 3PDNA 1ULRA 3RGIA 1RWWB 3ZZOA 1XQIA 4CLSA 5GAGU 4BS2A 1BHNA 2GJIA 2IAJA 3G96A 5KFHA 1PJ5A 3FJ2A 1UL3A 2V8PA 3PR5B 4ZCMA 3NMRA 1TAUA 2FVRA 3O1LA 5E3AA 3LO3A 1F5AA 2PIIA 2L9NA 1UPPA 2L41A 2VFUA 4A8XA 5CYQB 4C7QA 2YTCA 5GVQA 4J9SA 1BD6A 1M1HA 4X4PA 1Q86T 3PW2A 3PKYA 4PRFA 2IVYA 4A47A 4CT8A 4MFBA 3CJ3A 2ZH2A 4EBEA 4DL2A 1D9DA 5SUHA 5IFMA 2YNHA 3UQSA 3PYEA 2DPJA 4DZDA 3E51A 1U1OA 3MURP 1S49A 2FY8A 4CP5A 4UT4A 1EETB 1RAJA 1W2IA 1Q53A 2O66A 2OSQA 3QWPA 4LR9A 1S7IA 4C8NA 5KOWA 1M1GA 3MFHA 5KFYA 1ZTTA 3IN5A 2DY1A 4Q2MA 5F3TA 3VVTA 5DM6Q 3TAQA 1WI6A 2SXLA 3DDKA 5F8IA 2MZTA 4ALZA 5J2QB 1NB2A 4F4ZA 3KMSA 2FC9A 3CDEA 2YWGA 2YWKA 1JLBB 1N33F 3M2UA 4OYXA 2EBGA 2QYCA 1F2GA 1T95A 1R0BG 2BVZA 4C8KA 1RI7A 3V2UC 5A8WA 4IG3A 4DL3A 4F26A 1OPZA 1V5VA 2CQDA 3IA0A 3PX6A 2HHHJ 1DLOA 4LVOP 2BR0A 2NUHA 5CCLA 1QSLA 3CJQA 3PACA 4X66F 3OJSA 1NK6A 3RR8A 4USMA 1FJCA 2FJBB 4FKYA 5HVHA 5LOQA 3MEEB 2H9ZA 2QV6A 1WTFA 3GYNA 5C24A 3DC2A 3QFWA 4NLWA 3HHLA 1N5YA 1UAWA 2LQBA 3GU0A 1FJGJ 4CO1A 5BJRA 5HO4A 3JSRA 2PA3A 2GX8A 1TL7A 4ZVGA 4QW9A 3AXKA 1FEEA 1HBMB 4CT9A 3EM1A 1FFSB 2FGOA 3DFEA 1RZMA 3GG1A 3J81j 1AB8A 1OQ6A 2IM3A 1FXDA 1T9YA 4IKAA 1U1RA 4WFXA 1U49A 1EIYB 4ED8A 2F40A 4B9UA 2CPIA 1HBNB 4HDHA 2LFVA 4N5SA 5E3RA 5C24B 2OD4A 5DLFA 2B4UA 4DMZA 3FBBA 4AQYJ 2BEFA 3PW0A 3I96A 2EFNA 1EKSA 4DOZA 3UWTA 2GAHC 4ZMMA 3C6TB 1NJIT 2MGZA 1JLFB 3DM2B 4YP3A 1X4BA 4PABA 3WIUA 3DOKA 3ZZTA 1RWPB 3UD4P 1IBLF 5T14A 2R2SA 2PI4A 1B7YB 2GHVC 1WF0A 5KFVA 2QFIA 1UVIA 4DX6A 2UUAJ 4K59A 3GFZA 2LQ9A 3V6JA 1B0PA 4OYZA 3C14B 2ZNYA 3AA8A 3HFZB 2QO3A 2EPIA 4TYAA 2DGWA 3C15B 2KH9A 4K8RA 5FLXY 4RW4B 4LF5F 2GZOA 2CG8A 4IO9Q 3T3FA 5LXRA 2ZBRA 2A1BA 5DM7Q 3CCUS 3C16A 3S6EA 4YB5A 1IQZA 4G65A 2EC2A 2W9AA 1KQSR 2UU9F 4IRDA 1K0VA 1KBRA 3J7YU 2BX6A 4KFBB 5DQIA 3KUHA 2JEIA 2ZJPQ 5LJ5Y 1RHMB 3DRXA 5F8LA 4RU9A 3OT9A 4HACB 5KFDA 5LJ3Y 4X62F 1V5IB 3H2LA 2ZUGA 2DEJA 1VRUA 2QMWA 4MKVA 4TY8B 3DGPB 1XR6A 5C42A 3SV4A 5FIIA 2CPDA 3A3NB 4GVLA 1U2FA 3W5ZA 1HNXF 2M0GB 5LMUF 4LIRA 1S76D 4ZKAA 1RA6A 1IQTA 2E7XA 2YX7A 3KXDA 4DSKA 1FWPA 1TK5A 1P1LA 1FKOB 1REGX 3CCRS 4F3MA 5T7LB 1ZETA 3NBPA 1Q78A 1Y3JA 2BOAA 1S79A 2AIRB 3M1VB 3CDUA 3SFGA 2VASA 2F5GA 2J9EA 3FRZA 2KYXA 4USIA 1OYEA 4Y00A 1UA0A 1N56A 1N36J 3C19A 1TFWA 1REVA 1JQGA 1KP6A 1DTQB 3AXMA 1N33J 1N52B 4RZRA 1FX4A 2W4DA 2VC1A 4ZPVR 2O5DA 1M1KT 1HLWA 4AXIA 5GAHI 4LUBA 3K5PA 4I69A 5EWEA 5KOXA 3BR9A 5IOLA 2E66A 3AD9C 4LFCJ 2BV3A 5HL7Q 1S1TA 4BBYA 4J9RA 5KFBA 3HVAA 2E9TA 2CNNB 1CJKB 2WB4A 3TUPA 4R0EA 1F3FA 1PBUA 2CJQA 2EFGA 1G4CA 4NXNJ 1NHVA 2LU2A 4RNFA 3G2XA 4ZVUB 4RUCA 3G8TA 4A8WA 3NLCA 3C6UA 2OH2A 4OYBA 1HKAA 4A8FA 1IKVB 2H1YA 2JX2A 4CZCA 1N5TA 1RCOB 3KLFB 3DHWC 4W92B 3H59A 1F5BA 1MMDA 3DOMB 4S0MA 4FF2A 2NXUA 3R7BB 2XHCA 1X4CA 2RRBA 4X4TA 4K5SA 2CQ3A 1HQUB 4CH1A 1ZS6A 2CFXA 1GK8A 4FYDA 1H2UX 1JLGA 4LBIA 4ZVOB 3UPFA 3CJTA 4CCHA 3KK1A 1OQ3A 3MAAA 1IJFB 2OUGA 2CPXA 1LW0B 1P1TA 1U8SA 1VCTA 3C6UB 3PYFA 3HVWA 1RBAA 3UCGA 2VODA 5A8KB 1KD1T 1SH0A 2VPXB 3WBZA 1XTZA 4MK8A 4NCAA 4KJIA 4X62J 2OPRB 2B51A 2PT0A 2VC0A 3KJFB 3QATA 3GCWP 4ICLB 1R6VA 1HI8A 4RL1A 2AU0A 3P49B 1LNQA 4CQ1A 4DR5J 3HHEA 1SJ1A 2RILA 4Y65A 4RUHA 4Y3CA 3BBCA 3HHLC 4HT7A 5CABA 1E6YA 1VBXA 4TQSA 2HIQA 5CYMB 3V4MA 1F1BB 1V9OA 3JS9A 4WTOB 2B9EA 2HGNA 1RE1B 2FHJD 3HJVA 2J7UA 4FZVA 2M70A 2DHHA 2JC1A 4ED5A 3UDCA 2OTLS 2XCPA 2E9RX 2CXEA 1L3VA 1QAIA 4JI5F 1IKXB 1OMSA 1VBZA 2R8GA 3MR3A 2DCLA 2XYPB 2OSRA 2BW7A 4FVCA 1EB0A 3W61A 1JK9B 4CLWA 1VS3A 4JI5J 1NKEA 2RQ4A 2PMHA 2FHMA 3AT1B 4RR5A 1L3UA 2FGCA 4YUDA 1WUUA 3EMTA 4IH6A 3V81A 1N6QA 4LF9F 2KHDA 1FRKA 2W2PP 2YQ3A 2YNGB 4MYUA 1P8GA 4YY3J 3SDEB 3LWMA 2FIUA 4IG3B 3EGWB 2B5JA 4AUKA 1JLFA 1X4FA 2HNYA 1SQFA 2DISA 1VQMS 5IC4B 3UN5A 1MROB 2Q3PA 3NWGA 3SQGA 3TNVA 3CF5Q 2R7UA 3PEJA 3MMAA 4JV1A 2WSFC 3FKBA 1U4BA 4KGZB 4KT0C 1X0PA 3V6DA 1U1KA 2ZBPA 1C4AA 4NLTA 3S7RA 2DEIA 2MKIA 1NKBA 1S0VA 1G2EA 3VAIA 1U0HA 3CMAS 2GGPB 2PSZA 2ZBCA 1WSVA 3HP6A 3MR2A 5HP1B 3TJAA 4B3RF 3ZNUA 4IR9A 2K1RB 2VICA 4B17A 4ED1A 3RBEA 3MZIA 1AUSL 4OHXA 2F65A 1S5ZA 2RD5C 3DLJA 3MM8B 5A6WA 1GXLA 3MMAB 3WX8A 4CI0B 3QPIA 4F0KA 1SUQA 5GAEI 5B09A 5I42A 1YJUA 3MI7X 2ZOMA 1S6PB 3M30A 4DQPA 1XJWB 2VKRA 3MCSA 4DR6F 3NY0A 4Z7CA 1KDNA 4IQMA 1T3NA 3OXGA 2GGPA 4J91A 3DLEA 2GO9A 3THPA 3U1NA 3BYRA 3IWLA 3FRYA 3KNGA 3ZZPA 2OAUA 4ZVHA 4QR2A 2I0XA 3BN7A 3QMQA 3QZ8A 3FFIB 2WB1D 4G1PA 4B9SA 3EPGA 3UVJB 4KTQA 3MDFA 3GLJA 5B0AA 4P52A 2O1PA 4C8OA 1XMBA 5CHCB 1V3ZA 2BJ7A 3CO0P 3D1HA 1X7VA 2XMKA 3MM7A 1H7WA 2NYIA 3MOZA 4UZCA 4WU2A 7AT1B 4RNNA 4E0DA 2L9DA 4MK7A 4DV3J 4DR3J 3JQJA 1N48A 4W98A 1DBDA 3FZ2A 2AJQA 5DZ7A 4I0WA 1C1BB 5A8RB 5LSRA 2PO4A 3IRXB 3UR0A 4URQU 1VFJA 1ZA2B 4FS2A 1TL1A 3NNAA 2FLOA 2QTWA 3OXFA 1U2RA 3IXQA 4KPCA 4DS5A 1FK9A 4J5OA 3W3SA 3AAWB 5H9FK 4M5JA 1HPZB 3I6PA 3WHIA 4X84A 5KG5A 3G6XA 4XK8C 2M8HA 4DPWA 2KT2A 1TKTB 2C2OB 1EP4A 2VU5A 3A13A 3BBFA 3VZIA 1MN9A 4F8RA 2K7JA 3L95X 5E3PA 2HS4A 1UFWA 2IDEA 5IWAJ 5H9EK 2GHWA 2JOQA 1U8WA 3M6VA 3E01A 2MYFA 1HW9A 4QR0A 5AXLA 2VFSA 2W9BB 3HHKA 3SBMA 4RW6A 1RTHA 5D0GA 3TZWA 3QBCA 4B3SJ 5HK4A 2G2YA 4RNOA 4F4KA 2VONA 1PJ7A 1JKHA 5KFLA 4UZBA 2Y8YA 1JMTA 2XNRA 2HVDA 2PEBA 1TL7B 1TL5A 5D0EA 4ZJQA 4P7TA 2QLXA 4R8UB 4Y2MA 5DETA 4PUOB 1VQ7S 1TL4A 1S6QA 4JI7J 1H98A 2Y1RI 3H42A 1TUVA 3LGNA 5D3GB 5DDOC 2W4PA 2F7VA 3VAGA 1RB0A 4KR0B 2P5VA 2ZBQA 2RT3A 4QPTA 3UNYA 1T9WA 3BS9A 4RWWA 2QLFB 2A6OA 2WCXA 1NHUA 5J2PA 2DHAA 3RW6A 1SC1B 1WHVA 3RB0A 1ZM4A 1HWJA 4DV2F 5CYQA 2BM0A 4M5DA 2ZNZA 4PG5A 1LFPA 2E1CA 4FXDA 1D1UA 3DU6A 3NCQA 1DFDA 2DNYA 3HFVA 3GE9A 3R5CA 5EX0A 3F41A 4CLKA 4X65J 3GFYA 3D3BJ 2D3O1 4DPUA 3CCTA 3HI9A 4NPOA 1MWYA 2IM2A 1N34J 3RRHA 2FLNA 4ES1A 5IZHA 1UVLA 1O5JA 1KOOA 1FNOA 1S1XB 1V6HA 2Z0GA 1EKRA 3ILLA 5DZ6A 2EFVA 3VR1A 1IBMF 4UY85 3JYTB 3DI6A 1VRQC 1BC6A 3ISNC 1KRPA 1NDCA 1N8RT 3QSYB 4Q8FA 4X64J 3MM6A 3NNHA 2XMVA 4P10A 1JXEA 2UVRA 1R8CA 1CC7A 5G4DA 4YS2A 1S1VA 1TMJA 2XWXA 4P71A 2NXNA 4C0BA 3BV8A 3I0RB 1HW8A 3FSXA 1U1LA 4WE1B 5GMDA 2HHWA 3BREA 3CMQA 2F8MA 4CWBA 2HFNA 2BE2A 3MPVA 4CO4A 1JJ2R 2DR7A 1TK8A 2GMLA 1X5OA 2D7SA 4K4YA 2VUGA 2LEBA 1YJ9S 4YR3A 2ERRA 3HMJG 3Q24A 2WW8A 4DSFA 5KFOA 4QIVA 2J5AA 1S97A 3S01A 1TKDA 2YPZA 1O8BA 2Z2YB 2EVZA 3IWXA 5KFFA 2ZVIA 3UE2A 3DYAB 4L74A 5L38A 4ZP8A 2KFZA 3G82A 2GIRA 3VV2B 3PY8A 1HBNA 4J9QA 4YY3F 5DDPC 1ZM9A 3K7RA 4IDKB 2ROGA 2KKHA 3ZO7A 4PAAA 1OSDA 4MT1A 2JFKA 3KDOA 5DG7A 1FRHA 3ADAC 3QJJA 4ITSA 4OI2A 4P9SA 1KHVA 1BLUA 3BSCA 3SEOA 5KG6A 3FZBA 5KFWA 2HZVA 4JI8J 4ZVRB 5IT0A 1AFIA 1SKWA 4DFKA 2DGSA 2PA8D 4OYIA 3VHQA 2W9CA 3OTDA 4PUOA 4OZ0A 3IMQJ 3MD1A 3QJPA 4AXJA 3OHAA 1CSJA 3D0HE 4Y2KA 3G6ES 4J9LA 2PFDA 1PIEA 3R2DJ 2IVMA 3BN4A 4DV0J 4ZK7M 4KC5A 2R42A 1CEZA 3DGPA 3GJRB 5C42B 3US5A 1T7PA 2MGZB 2CQHA 3B78A 3H25A 3MMBA 2HVZA 1PC4A 3M6WA 1R8AA 3LP1B 5KFXA 2RDDA 4NMLA 5DO2A 3KJQB 4ANEA 4CYUB 3J7YI 4WZQA 4DR5F 1F9FA 1DQ9A 4BLGA 1Q5YA 5AXKA 4DXLA 2YWEA 4JUZA 5A2QU 4MKBA 4EZ6A 3OLBA 2XZWA 1FO1A 1I1GA 3TAMA 2JVOA 1Z1ZA 2W8LA 4A46A 1H3DA 1KTQA 2H4YB 2IMOA 3DOMA 3W8GA 3FSYA 2IBOA 2HRTA 5HP1A 1DZ5A 1R0AA 5L39A 4A8KA 5KG3A 2ADBA 4NX9A 2GS8A 4HHHA 1HBUA 2ROPA 4H4OB 1RSCA 5F8HA 1C2PA 2GCFA 1U24A 5J2MB 1FVQA 3NL0A 1ZZFA 4KV8B 1VBKA 4LBPA 4LSNA 1AXQA 1R89A 3BH7B 3IRWP 3GR0A 2I5JA 4F4WA 3RAQA 2I1RA 2VG5B 1JLCB 2EK1A 7FD1A 2A10A 5E41A 3DLEB 3UDLA 4QYZK 1S12A 1UMJA 4TY8A 4GMKA 4USHA 1HNIB 1VC0A 2UU9J 3LQVA 4CH7A 3HK2A 2OD6A 4OL8A 2FHKA 3FC9A 1HBUB 3EE3A 5HBMA 3GTYX 4QW8A 1HQEB 2Q43A 3F44A 4AT1B 2HPUA 4YR2A 1N4LA 1S9FA 2OPPA 2HK2A 3BO3A 2HFOA 1L3SA 2XTJP 1VQNS 1B4SA 5C2CA 4FNIA 5C7PA 3MR6A 2DGOA 3FQLA 2MZ1A 1I5OB 2Y1IA 1TV6B 2WBRA 3HHLB 2DNRA 2GIQA 2XCAA 3V6HA 1N5YB 1R8PA 3GYGA 3M7VA 3TUZC 2H5EA 3KLFA 3OW2R 4LMZA 4WKYA 4ECXA 3CJ0A 2DH7A 1RWUA 2NPFA 1VLOA 2VG6B 2NQPA 4NZ0A 1IBKJ 3N6LA 5I3PA 2UVWA 4V19X 2HEKA 4DWIA 4NWBA 4PG7A 2D9PA 2VH7A 5KTQA 3KHGA 1NK7A 4NA2A 2YNGA 4U95A 5J2PB 2ZKUA 4CIOA 1M5VC 3CD5A 1QSYA 1S77D 4U9RA 2YWHA 2KM8B 1NRKA 4DLGA 4M63A 4YB1P 3RUBL 1KC8T 3BKFA 2B0GA 3BPSP 2I8EA 2V63A 4TU7A 4CNYA 3A1YG 3CB4A 1N54B 4DSEA 4USJC 3SZ2A 5HJYA 3DMJA 1RBOB 4DR7F 1QSSA 2AJ4A 2V8VA 2J6TA 2JWNA 1XBWA 1RT1A 4UOHA 1K47A 2LXUA 3AJDA 1TUWA 4PPDA 4ZPBA 3R7NB 1RDRA 2NUUG 3I9V9 1FDNA 2F3JA 4NLUA 3HSDA 2W7PA 2CADA 3QJLA 1Y11A 1U0SA 3DLGA 1YJRA 2PD1A 2MXYA 2HHPA 3TI0A 3SQOP 4URGA 2E1RA 1N32J 3M8ZA 4USTA 1DLOB 2J0WA 2CG4A 4OZ5A 2MJUA 2BRKA 2RMLA 3D68A 3NGSA 1SKUB 4O0NA 5K14B 3T1HJ 4J9OA 3OQ2A 3QIPA 1FRJA 1SVDA 3QGIA 4QWBA 1NM2A 1J5OB 2W8KA 2GNKA 3QNWB 4IOCQ 1UWAA 5BYSA 1VQKS 2V4JA 4ZP6A 2C3OA 1T03B 1UETA 2IC3A 4FDFA 4OQJA 2RQCA 3QAEA 4OYOA 1MWQA 4JI2F 1FKAF 1D9FA 4NXMF 3LPYA 1GEHA 1RGVA 3A8KA 3SSQA 3DGVA 3V4IA 5K14A 3QRRA 4X4UA 3DI6B 5IV4A 3H0PA 3SCJE 1R6YA 3T6BA 2A3JA 4DV6J 4BDPA 2HHVA 3R5AA 2DNOA 2J0XA 1TAQA 2XBPA 2GVDB 1NK8A 3QSIA 5AE3A 5KT4A 1Q8KA 4DL0C 1F2HA 1X4DA 2DT9A 3PM9A 1TKZB 1DY3A 4OYMA 4KHPF 4DDFA 1QD1A 1LWCA 3MHYA 1V3SA 2E5GA 5LM7E 4RNMA 2KL8A 4B08A 3T1YF 3D9BA 5M2RA 4F4YA 2IBKA 3DDIA 3E3XA 4N8OA 4J9KA 4MFBB 2IRYA 2C28A 1NJZA 3NP5A 5ETSA 3CUNA 2CYYA 3W1YC 2IA0A 2UVUA 5JXSA 2VFVA 2R2RA 1JB0C 3IS9A 2J6UA 2ATCB 2PMZD 5CZVA 2CJKA 1TUGB 4DV4F 3ZZYA 4QBUA 3P8BB 3CGIA 3LP1A 4GO5X 3G82B 2AEMA 1KVKA 2N3LA 4K4XA 1MROA 3SQGB 2Y8WA 2R4FA 2E5HA 4LF9J 2PMWA 4KFBA 2CZ9A 1OY8A 2YX1A 3HZGA 3R5JB 4FF4A 1CVJA 3MUVP 1WACA 4DR4J 1RACB 5M2UA 1SL2A 4F7VA 2MKSA 1QJHA 2VL1A 2EFPA 1U0HB 4DUTA 1WC1A 4TYBA 2DVIA 1FJ7A 3K8WA 3EXYA 1BQXA 3LGMA 2VJUA 1RT7B 4H4OA 2X1GA 2DXDA 2GMJA 1DTTA 5ETKA 1C4CA 5KG4A 2CNLB 3ULHA 4IUFA 1XNRJ 3HJFA 5HLFA 2RQMA 2B4OA 1DQ8A 4UUXA 4Q5VA 2IDLA 2Y0BB 3FBFA 5ETQA 5CAAA 3TA0A 4FVMA 3CJRA 4NZ7A 4UUWA 3W9JA 3IM8A 2FJDB 1M5KC 4KHPJ 4ICLA 4NLGA 2KN4A 3SXLA 3G8SA 3P5TL 1RT7A 1TL3A 2C3PA 4EEYA 3D6FB 4F36A 4Q0BB 2OFGX 3KMQA 2V2QA 4LF8J 4O3QA 3EZOA 1E6VA 2OKQA 5J1EA 2D3ZA 3NKYA 4JI2J 5EUHA 3QIDA 4ID5B 3DRSB 5HMWA 4JI1F 2IRUA 2VHGA 4JP8A 4ILLA 3MM5A 3CEDA 2RH3A 1KN6A 2AMCB 3TP2A 1Z2LA 2DTJA 4PXCA 4PKDB 4ZJOA 3Q8QB 4DBQA 2VDIA 3JB9k 5IT9Y 2M7SA 5F8NA 5DQHA 4CTAA 3HSJA 5D8HB 4AL5A 2AYMA 4F0MA 3QGPA 3C66A 3SFUA 3PRBA 3KLGB 4JI8F 2RKIA 3OVAA 1F60B 3BGFA 3Q8UA 2RS2A 2B8QA 3FQKA 3T19A 5K8MA 3R8YA 3RBXA 4HH0A 3OR2A 1JIHA 1QTNB 2HBYB 4RLEA 5B08A 1RQ0A 1K9MT 4LREA 1VK3A 2CPYA 1SJQA 4G1IA 1GMWD 2WZ1A 4RW9A 5HBMB 3N6MA 1WKKA 3DYAA 4QWAA 1FF2A 3H8YA 1M0SA 3QO9A 1DJ0A 5C25B 3KLGA 4LSZB 4RUBA 1WG1A 5C5JA 1RKIA 5LMNJ 2CA9A 2RKIB 3M8SA 1LKZA 3Q22A 1H72C 4KKOA 4C2MA 4B3TF 4DI6A 4LRCA 3PFEA 1FNXH 1JKHB 4I68A 3DXSX 3JYTA 4DF4A 2ASJA 1FWKA 3ZZZA 1O51A 5IWAF 3KLIA 3KUGA 2ZZTA 4PG6A 3KK2A 3PX0A 2XI3A 4ZOSA 1QM9A 1XR7A 2LMIA 4NMXA 1S4EA 2J7KA 3HF5A 3UCZP 4JI4J 2KZZA 1S6QB 1NU4A 5G0RB 5DJBA 2ASLA 4UQTA 1PYTA 4ED2A 3BGUA 1VI7A 1X4AA 2YWFA 2BJ1A 1M5SA 3LAKA 1FTCA 3PNIA 4WFNQ 1RHUB 1I94F 2VFTA 3JTPA 2KZMA 1TK0A 1XMOF 1FHTA 1RWXB 5HROA 2HNDB 4NCGA 3N5BA 2F4FA 3QT7A 1ZPWX 4MH8A 4DL6A 1IWAA 2MQ8A 2DNHA 1PILA 5T41A 4LF2A 2J9DE 1U1NA 4PWUA 3RU0A 3E2EA 3KG1A 3IC1A 2P9EA 4KH0B 2CQ1A 5GMKa 1UWBB 4HYKA 2CJYB 4GC7A 2UUCJ 1Q7YT 1WOSA 3KKFA 1DAXA 2ZH7A 2DB1A 1MN7A 1TTHB 5KT5A 1GNKA 1Q8IA 2LXIA 3DMJB 3LGHA 3OFHA 2R9LA 2ZJRQ 3EVOA 1KQKA 3X1LB 2MKYA 3B8HA 3JQKA 2LA4A 3OTOJ 1NKCA 2K06A 4LRAA 1JLAA 1T0TV 2WOMA 4ZDNA 6FD1A 2IVFB 3KG0A 1GTEA 3CIMA 3R1HA 4DR3F 1S1VB 3LTOA 3JTOA 3KLVA 1VQ4S 3HHLD 3M8WA 1MU2B 2QA4S 3PHEA 2B8PA 4ZPDA 4DCOB 4JV5J 1UW9A 2DNGA 2VFRA 4W4MA 2OTJS 2H3EB 5DG8A 1HI0P 2DO4A 3R27A 3HKZD 1HYSB 3RW7A 1WHXA 2Z2MA 4O3OA 3QYYA 3AD8C 3AOCA 4ECUA 3QQCD 3O6QA 3ZC4A 5A0YB 1S10A 3BO4A 3JSBA 4WXOA 3OVSA 3BJYA 3R2CJ 1N5VA 2KT3A 4NRUA 4ELVA 2RDJA 1GH8A 3N01A 3UW1A 4EO6A 2RU3A 2ZD1B 2FY1A 4AQYF 2HSEB 2KJWA 4KHRA 4O3NA 1ELOA 4KAIA 4Q7AA 4U7UK 3NS7B 3TJ9A 2I38A 4C8LA 1CJUA 1URRA 1HD0A 3CCZA 2GMHA 3W8PA 1T9XA 3KHLA 1D0EA 2XLJA 1TU0B 1VQSA 3SSSA 2D69A 1AFJA 5MLCV 2YY3A 3A4TA 2FHOB 3AB4B 3FMBA 1WWHA 1NH8A 1Q8LA 2VG6A 1HNZJ 3AY0A 4OZ2A 2U2FA 3KFWX 4NYOA 2AW0A 3JTNA 5GAGI 1RU1A 1UEKA 3UVJA 2V4RA 1AUDA 4QQBA 2YX4A 2UXCF 4RW8B 1H6KX 2M52A 1ROFA 3BGOP 2EFQA 2IM0A 1MSWD 2H48B 2BKNA 2P8IA 2I5JB 1B0TA 2G13A 3D6TB 4ZIVA 2LKZA 2LVWA 4WK1A 1AA1B 3OHBA 4LT6A 1WC5A 3O2IA 2JJ4D 4MIBA 2BE7D 1JJCB 4ZCLA 3NOCA 3PIOQ 1P6TA 2KO1A 4P2SA 2QX0A 4P75A 4C3LA 4E8UA 3MMJA 4QCLA 2NREA 2Z30B 3I4HX 3J81Y 3OUYB 1RTDB 3PW5A 2UXDJ 4LSNB 4KIAA 1KNZA 4Y2AA 2VG5A 2QJ3A 2WW4A 5D0HA 4DCJB 5A8KA 4DV1J 4DL4A 4NXMJ 1EETA 2DHGA 2BZ2A 2M9KA 4UOCA 3CNQP 3I5AA 2GV1A 3POTB 2X7IA 5A2QY 1LXNA 1WDDA 2ABYA 2EXUA 4ZPAA 4BHQA 4XO0A 1UVMA 2QLJB 3KTQA 3RRKA 2OPQB 3I0RA 3JSYA 2VF3A 3GIKA 1QVGR 2VG7B 3FEYB 4PQUA 2RVJA 3P96A 4B3RJ 3CTRA 5FDLA 3MEKA 2RS8A 3BB5A 1RISA 1HNVB 2M3DA 3MEGB 4O4GB 4RW6B 1Y7PA 5KG2A 5THWA 3CXCR 1Z4UA 4D3GA 3D2WA 3H20A 4NLYA 1U48A 3CCLS 2J9DA 4MKAA 2YKMA 3BM7A 3I55S 1JLQA 1O0PA 2B9WA 2BRLA 2FC8A 4DZ6A 3ZTSA 2V94A 3HLUA 2X3DA 3MPUB 5CD4H 1CQMA 1NK5A 4PXDA 4LFCF 3J80U 1FESA 2HG4A 4DL5A 1DHMA 2LDIA 4RKUC 5LSLA 2UV8G 3M30B 2W4CA 4I2PA 5KT3A 4GKJF 3QRQA 4FYXB 3KLIB 1V3RA 4JV5F 1RADB 4B3OB 4I67A 5CA5A 5CYJA 4M5HA 2QG9B 4Y6IA 1NZAA 1O6XA 3KWMA 4ZVTB 3ZFVA 3M6XA 3BZQA 2ZHBA 1YJVA 3BKTA 3Q2SC 2N4CA 3T41A 3OVBA 3CW2C 2F1FA 1D8YA 4LF4F 4IH5A 2ZITA 3IM9A 2PGCA 1YI2S 2XSFA 5HMXA 4J9MA 2UP1A 1TVRB 1YWXA 2OGUA 5KFPA 2XB2D 3QIPB 4IG0A 2N7YA 4OYAA 3MMBB 4YQWA 3RBDA 4R25A 3R97A 1NUEA 2UUAF 1T9UA 3JAMU 1CJVA 1FRXA 4HTIA 5LMUJ 4K5RA 1CPZA 3K57A 2JNJA 1XMQJ 5AE1A 1HMVB 4I1TA 1EHWA 4M94A 3UD3P 3MECA 1YGYA 3CULA 2CQBA 2BJEA 3H7HB 4F4XA 2XC9A 2BE2B 4NASA 3ENWA 5E3CA 2XO7A 1NJYA 2VB6A 2AWZA 2BJ9A 4OMFG 4YHHF 4C97A 3ETOA 3M32B 1R0AB 1QAXA 3D0IE 2CVEA 2IJFA 2K3KA 2GVDA 1NZ8A 1RT3B 1B70B 4N8NA 3M2VA 7FDRA 3DOLB 3DRRA 4KO0A 1XC9A 2XULA 2HLUA 4MIAA 3D6MB 3EWGA 1N88A 3QT6A 2G2OA 2MLYA 2RAQA 3NGTA 3HPOA 4QU7A 1JNRB 4I4BA 4LSLA 2ACYA 4IH7A 3A12A 2DR9A 3L7UA 1TL3B 1WHWA 2DXEA 2HVEA 2KRBA 4HR2A 5ETOA 2V4JB 3H2VE 3OTOF 5ETRA 2W1BA 2GJ2A 2VZ9A 1VBYA 4ZVPB 4KO0B 1IM6A 3MAQA 4FXVA 4UY8T 1RABB 1NSAA 4Q8EA 2A2CA 3UDEA 3MXHP 1Y10A 3W7BA 2CDRB 2QT7A 3DRPB 5L9NA 3W2WA 4TU9A 4UQGA 2VA3A 5CZXA 3PJ9A 4PWWA 4LF1A 2BKOA 2YKNA 2MJNA 4F02A 2H54B 3N79A 2DPIA 3VF0B 4NCBA 2W01A 4HI2A 1HQ2A 2DIVA 2R2UA 2FJAB 3CJKB 4C0HA 4U7CA 3TUIC 4OX7A 4IRKA 2VBWA 3T1AA 4ZVSB 5KFKA 4F04B 4TXSA 1ZOTA 2BMBA 1NLKL 2IPOB 4PYAA 1Q0NA 4EU0A 3KLEA 4U67Q 1SQEA 5D15A 3UCUP 2XY6A 3MCOA 2BQ3A 1X5TA 3K5OA 4NEYA 3D66A 2GQCA 3FCWA 4EFAC 3KJVA 2YNHB 2ZH1A 3FEZA 2DCUB 3C8YA 5B0BA 5DDRC 2FD2A 2AP6A 4OI0A 1C0TB 3IS9B 3HXMA 3VGVA 3ELHA 3NG8A 2V8HA 1SJRA 2Y3YA 4W90B 4RUAA 4WTYA 3I87A 2HFVA 2IA6A 2UXCJ 2B6AA 2Q6BA 4K7QA 1KSPA 3ICLA 3OTCA 2HHQA 2HHSA 1NPPA 1DTTB 4HTJA 5DRKA 2HBZB 1RAEB 2GO8A 1WELA 4OYWA 5J2MA 2AYGA 4PG4A 4K4SA 4GKKJ 3CO9A 2DYAA 2LDYA 2NXEA 2VKZG 2YPYA 3KK2B 3PKMA 4I56A 2RUGA 2AEFA 2RU9A 4I2QB 4Y28C 2F63A 4DQRA 4AL7A 4FBTA 1FEHA 3RAXA 3CCJS 3PW7A 2RUSA 3PCOB 1YRUA 4ID8A 3D4JA 1RAAB 2E5LF 2KXNB 4Q0BA 3FMWA 5HSPA 2D3OR 1VHFA 4C8ZA 1WKLA 1XERA 4F50A 3QT8A 1KTVA 2EW9A 2B56A 4C8MA 2ZWOA 1GX5A 2WVDA 4C11A 3U02A 1GMUA 3FBEA 4X65F 3A3PB 3LP2B 3DLLQ 2GC8A 3MPWA 4RU2A 1EARA 1U6ZA 4E2FB 1U6FA 3CJSA 2WK4A 3OFEA 2IIHA 1NEEA 4N7TA 3RG6A 2MQOA 2HMIA 1SC3B 5F0UA 1QUPA 3G87A 2R2TA 3CWJA 4MKYA 2HGLA 4A8OA 2DGQA 5B0DA 3OFGA 3IR6B 3W5XA 4J7CA 1RTZA 2BYCA 4FPRA 2MQQA 1VQOS 3W62A 1NBEB 2KI2A 1CJTA 2R7QA 1K73T 4O3RA 2CQIA 3EZ5A 1XEZA 2RF2A 2KYZA 1XIQA 2RJZA 4OI6A 2AJFE 2OMOA 1MU2A 1GQEA 1D8ZA 5KFUA 1YZ6A 2NLWA 4ENOA 3I56S 2BOPA 4NI2B 3CC4S 3PYDA 3VZHA 1PYOB 3Q8PB 4ZCKA 4ETXA 1LW2A 4CYUA 2W2MP 3MEEA 4OZJA 1RAFB 2Y0SD 3M9OB 3UO0A 1K0TA 1VJWA 2DR5A 3ENQA 5E5NA 2D74B 4A8QA 3CDBA 4QJVA 4USVA 4DR1F 1QTMA 3G86A 3JSMA 5J1PA 3T9NA 4NI2A 2KTQA 2VPYB 5IS2A 2KFYA 2FLPA 4DSIA 1S48A 2WVFA 4ZLNA 1FKPB 1RA7A 4P6QA 1MLAA 3RB4A 1QVFR 1PGZA 5IV3A 2Y1JA 2B4VA 3A8JA 4C98A 2MMYA 3Q8VA 1CC8A 2E7WA 4M1KA 2ZOFA 5HROB 5EWGA 2BACA 3M6UA 3FBCA 2HZCA 4Q2LA 3EVMA 4MIWA 5HQLA 2J8AA 1VR6A 2XLIA 3NOGA 4NLRA 3RTVA 2MSTA 3G6YA 1Y9OA 1IN0A 1CULB 4MMOA 1JWWA 1Q8BA 2KG0A 2KVQE 3BQ2A 1HHTP 3T1HF 2W2QP 2XI2A 1YDLA 1SQGA 2QL5B 4TNOA 4Z7YA 5KAKA 2W7AA 1WC0A 1UKUA 2X1BA 5CYMA 5KFIA 2J8SA 1TVRA 2NSBA 4KSEB 1A0OB 1Q16B 1UVNA 2HNDA 1GMVA 4J90A 4NCGB 3W60A 3UFCX 3BR8A 4UOGA 2NZ4A 1RU2A 3GFXA 1DURA 3VWSA 4QPXA 1RWVB 2CQPA 3KOAA 1OJ4A 5JMNA 3RB6A 1MMLA 3QFHA 2CZVC 2AT1B 4JYAJ 2E1AA 1B3TA 2P9GA 1UTAA 1RT6A 2YXLA 2Q66A 2FB0A 3UNGC 2DO0A 2ILYA 3BSAA 4HACA 5AT1B 1FXLA 1GFWB 2DNMA 1PO6A 2CRLA 1HIYA 2E9ZA 1G6BA 3V5RA 2ALZA 5BYRA 1AZSB 1WSRA 4GVBA 3BSNA 3TUJC 2YNIB 1VIXA 2VQEJ 1CJKA 1NPRA 1OS5A 2XS2A 4PQUB 4OX8A 5LL6d 2AQ4A 3THVA 2IYIA 1FJEB 4K4WA 1TP7A 3NAHA 1HD1A 2OPPB 4ZLPA 2DNQA 1NO8A 5T7LA 1FE4A 4FYYB 1RP5A 2LCWA 3M1VA 3ISND 4KRWA 3FEXB 3OXLA 1JX4A 3F56A 1RTIB 1LWFA 2DHSA 2OEMA 3D1OA 2WTFA 4FPIA 1JJHA 2KRRA 4OV6A 5KG1A 3DN9A 2Q6CA 2V8GA 3HT0A 4A4JA 3M9NB 3EGZA 4WP3A 3LPEA 1YKWA 3QO9B 5C25A 2EBEA 5CCMA 3G4SS 1FD2A 4QU6A 3TOQA 3W2VA 4B3TJ 1NCLA 1SUQB 2DR6A 2MY8A 4NLXA 1LW0A 5F3ZA 3VGTA 1A9NB 1S6PA 2FUG9 2ZKTA 4NE9C 3K5MA 5LMNF 2QRRA 4ECQA 5BYQA 5L1KA 4JB8B 1MG7A 2DITA 1B99A 2CPFA 3EICA 1IBLJ 4TVAB 3RYLA 4F3OA 2IRXA 2V9KA 4OV1A 4WFBQ 2ZM6F 4XPEA 1YQHA 5B0CA 1X4GA 3GJTB 4LBHA 5FD1A 5EDWA 2BUNA 2HQIA 5GMEA 5L1LA 4DR2F 3QLHA 2VBYA 3LUYA 3SYZA 3GWCA 2OPQA 2YH0A 4ES3A 1H2TZ 2B7CB 1FVSA 3ONQA 1TMMA 1NNDA 1SB6A 2MQMA 1FRIA 3EVWA 4LF8F 1CS4A 4LQ3A 1VOMA 2J76E 2LU1A 4U8YA 3T5JA 4F67A 1WF1A 1WNEA 4PWDB 2WONB 1SJ3P 1X5PA 4M5DB 1GMWA 4IYQA 4OX9F 1F6TA 1F9EB 2DGTA 3LALA 3TYTA 5A8WB 3PIPQ 3GV8B 1UVJA 2HQCA 3MFIA 1AT1B 2ILZA 3TRGA 3PV8A 4EWTA 3LH2S 3MAAB 1UWBA 1NPKA 2JFDA 5E3QA 4B3MJ 3HULA 3EZUA 1QLNA 2DIUA 5J2QA 2V4QA 3K8VA 1QE1A 3J7Z5 1UP1A 1JXVA 3HSZA 5ETVA 3M2RA 4O23A 5AJ3F 2XZTB 4ZP9A 2HHHF 1YHQS 5HAOA 2FVCA 5K9FA 3DRYA 2IJNA 3KLHB 1SJFA 2U1AA 3NCRA 1I51B 4DR1J 4PZVA 2MKCA 5LT5A 1VRTB 5CQGA 3AOAA 2C2RA 2JH3A 1OY9A 3O3LA 4ZLLA 3MTJA 4Y2IA 1NH7A 1Z2ZA 1VQPS 2ASYA 3PJWA 4CO5A 1CBKA 1QY7A 1QE1B 1X9WA 2KM8C 4WP8A 3DLKA 3JXOA 3C14A 3KK3A 1XNRF 3ZZUA 5IM0A 3GIMA 3E8OA 3SDEA 2UXBJ 2RDIA 4A48A 3IBWA 1RT2B 2XHWA 4F3QA 2HQGA 1ACMB 1PC5A 1HBMA 1JNZB 3DOKB 1QAJA 3FCHA 3ILOA 3SMZA 3BQ1A 4IRCA 4JI3J 2DD8S 2R7TA 1LWCB 3CDWA 3H5UA 3NS6A 4JV0A 3V4IB 2E1MC 2XQCA 1FDBA 2VV5A 3O44A 5KFTA 5GAHU 3H4BA 3T5LA 5K5MA 2PN6A 2QMXA 1B7FA 4DU8A 2P9CA 3SCIE 4G1QA 1WI8A 2Z57B 3D1QA 3Q83A 3WQPA 3WZ0A 3VVUA 3M8PA 3OR1A 2DNKA 1D09B 5CH7B 5KG7A 1FRLA 4WFYA 2AJ0A 1VQ9S 1FCAA 4GKKF 1B64A 3CJ4A 4CLLA 2HHXA 1RKJA 4HKQA 2AYEA 4GKJJ 1G7CB 1CJVB 2JSXA 4QIEA 2XMWA 5H1SV 2OFHX 2X1AA 3GJSB 4RBVA 3FGVA 4O44A 4ED7A 1Y00A 2OPSA 2FTRA 2FJXA 2ZE2B 1VHIA 4QYRA 3MR7A 4BWJA 3JSMB 3VQSA 3L4BC 2XY7A 1UEVA 1T9VA 2OMLA 5KFNA 1KVIA 3N28A 5FLXU 2AJ1A 2F4VF 5I42B 3OUYA 3PEHA 3MCNA 4NLOA 2HHUA 3TR5A 1F9HA 4FNHA 1RBLA 1WEXA 2OPSB 4PCQA 2DRDA 4BWMA 1RYSA 1AW0A 3JAMY 2CJXB 5EWFA 1M90T 2W2OP 2YNFA 2AD9A 1TKTA 2C3YA 2HBRB 3N9UC 3PZPA 3K17A 2AZ1A 2R7OA 2XMJA 1SJ4P 4WZMA 4X4VA 2C2NA 1RT3A 4NYPA 1VC5A 4I64A 3DHXA 2O3DA 5AXNA 2W9BA 2DRAA 1WEYA 1SV5A 3BGLA 3P45B 4KV8A 4LVNP 4YEAA 5BR8J 1MW7A 4CM2A 4WF9Q 4DFMA 1RTHB 1X60A 4DV7F 1S72S 3DRPA 1N36F 2CNKB 2KDOA 6FDRA 5KFCA 2N82B 4X4SA 2IAJB 2V2ZA 3IR5B 3MM5B 1OWXA 3PRDA 1IR0A 2MQNA 1EP4B 3L7PA 3RAMA 3VALA 2OLWA 2ZFHA 4ZIWA 1NB7A 1CQNA 2H4WB 1P27B 1DQAA 2HMIB 4JI6J 2CPZA 1YITS 2UXBF 2HZAA 4HI1A 1NSKL 1TL1B 2EK6A 3EXCX 2B6AB 4NEZA 3S1TA 3D6HB 3TW0A 2BA9A 3AD7C 3TVYA 2UUBJ 1TFYA 4M8LA 1FDAA 3JQMA 3KYLA 2F9DA 2KU7A 4NYZA 1IWGA 1WHYA 3W65A 3C2PA 3PJXA 1U6BA 1KKHA 3T1YJ 2XMAA 4RJVA 5HN0A 1IKYB 1KFSA 4DR7J 4ZJLA 4X66J 4ZN3A 4B3OA 2AV5A 4KGKA 4IO1A 3TVKA 4DUZF 1HNWJ 1RAIB 2FVQA 1EAYC 3GJQB 2G1DA 1ZYQA 2FJVA 3G71S 2N4DA 4L75A 1FD8A 2ATLA 4HVZA 3RJMB 4DL7A 2ZJQQ 2XYHB 2IJRA 3B82A 3CCVS 1T94A 2G0CA 1C1CB 1GXTA 2XY5A 3NRBA 1SL1A 4HLBA 5JUMA 2CWKA 1DRZA 3I0SA 1H74A 2W7OA 4ECSA 1VDHA 4PWDA 4OZNA 3Q2TC 4CO3A 1ZAVA 2CPHA 2MLZA 4NLVA 2AYBA 5SZTA 2L3MA 3HZEA 4QWCA 2V68A 5D4LA 2QE5A 4DV3F 4FF1A 4YOEA 2E5IA 2KXFA 4CM0A 1VQ8S 3K2YA 5D3GA 3KDNA 3IP0A 3ZTPA 2HRYA 4ETZA 3CJ8A 1RCXB 2W24A 1OY6A 4ZLJA 4C11B 2V9WA 1HNVA 4KHMA 2RHQB 4AD6A 5BXIA 1T05A 1J5EF 1HA1A 5U47A 2B43A 2VQEF 4YMEA 1YJWS 4LF5J 2W2NP 4I2QA 1YBAA 2E1PA 3FCVA 2FJEB 2DNPA 4LJMA 4OFZA 1Y5IB 4OZ3A 2P6TA 2A6MA 3W63A 4YR0A 4WK3A 4U8VA 3MR5A 4U7UD 2V0NA 2C2MB 3IAS9 3SV3A 4LRFA 4HH1A 4DSLA 2CUYA 1HNZF 4K0KJ 5C2GA 3PO4A 3OL8A 1RT5A 3CCWA 4QOTA 1BQNA 3FNNA 4EYHB 2CJ9A 3ITHA 2BQUA 3KJNB 3DKDA 3EDRB 2DGVA 2HLTA 5IM0B 3N4WA 2X1FA 2XGQA 3CCES 4M5GA 1PKUA 4DHVA 4ZVEA 3K59A 4ZPCA 2HWHA 2JHEA 4KYZA 2GHPA 3DM2A 3GV5B 3PRVA 2NXCA 1X8DA 3R5DA 2DR8A 5GAEU 1WEZA 1PYSB 2C2ZB 2C3MA 1RT5B 4R0JA 1YG0A 1RXOB 1LW2B 1HNXJ 4RW8A 4XDCA 5ETNA 4EBCA 1HYSA 3BO2A 2GVZB 3OL9A 3PO5A 2JC0A 4BC9A 3FSIA 3GIRA 5HI7A 1SL0A 2PDAA 3P5BP 2YNIA 4KH1B 2RF2B 1FNMA 1IM4A 1UEUA 3TQ1A 3H90A 3CCMS 3WC2A 2ASDA 2E44A 3BDEA 2AEJA 2MHNA 4OLPA 2ZHAA 1RTJA 2G2ZA 4K2XA 1GXUA 2B9XA 1KVJA 3MD3A 3OPKA 1VQLS 4DR6J 1FKPA 2V67A 1R31A 2CAJA 1WKJA 3GSIA 5AXMA 4XPCA 2AGPA 1U1QA 2C22A 2UVVA 2XLKA 2XMMA 2FZCB 1FXRA 1KOHA 2PE8A 2VBXA 2Z58B 1W26A 9ATCB 5HMYA 1KWMA 2IHR1 4IQXA 2RHSB 3ZTRA 4DQSA 2XGPA 4OHZA 2C1EB 2HS0A 4DJBA 4ZHRB 2Y1LB 4EK2A 3WIVA 2ACMA 4TU8A 3H4DA 3Q89A 4PR6A 4JI1J 1PG5B 3KK1B 3MTKA 2KVIA 2CKWA 4ECYA 3GMGA 2ZC3A 3LW5C 2WRMA 2XMTA 4PEOA 4KGXB 4DN0A 1H2VZ 4LR7A 1R7IA 2RB7A 1T3OA 4M5LA 3MM9A 4ZVQB 5K8OA 3U1LA 5LSOA 1HNIA 1L3TA 1WORA 4ZVFA 2KB2A 3CSKA 1NMEB 2KXHA 1ZZNA 1N34F 1R27B 4DN9A 4B9NA 2R7XA 5GADI 2LXFA 3OL6A 1T03A 2I2YA 3NGDA 4LF7F 2BXJA 3CJ2A 3S8SA 3CE8A 5DG9A 2W25A 2DBBA 3H2UB 5E0OA 5KFZA 1H7XA 1E6YB 3GCXP 1RT4A 2LEAA 4B02A 3D54A 3IGVA 4I7FB 4HL9A 3OLAA 2HNZB 1GT8A 2V8DA 2HGMA 3RB3A 3AJ2A 3W2WB 1K44A 1WDTA 4FKXA 4ED3A 4I2PB 2XG8A 3K89A 5F8MA 4Y0FA 1BGXT 2HAIA 1TR0A 2DNLA 1D3WA 2APOA 2BW2A 4H4KA 4OI3A 2DJWA 4BC7A 2CQCA 2JEFA 1S9EA 1WD6A 3Q86A 3SCKE 2JL9A 3UR3C 3E01B 3IRXA 4ZS6A 4DV1F 1U26A 1VISA 3FK4A 4IFVA 4R5PB 1KFDA 1VMBA 1S0MA 1S57A 3AQOA 3MEGA 4IFYB 2HQ3A 2H65B 4NLQA 2HS3A 3H98A 1U02A 2C3UA 2EKYA 1NDLA 2XNQA 1IKVA 4M5NA 4GVBB 3KLHA 5A6PA 3EPIA 4B9LA 2LLZA 3CD6S 4C48A 3KNAA 1KS2A 1XNQJ 1YRXA 2G9OA 2AKWB 1SBRA 1S1UB 2YKMB 4U96A 2RRAA 2EKNA 3IO1A 3N6NA 4DX8H 3CD7A 4IFVB 2KJVA 2MSSA 1NSQA 1RWOB 1HI1A 2WBMA 2RSQA 2YVSA 4G6VB 4CLUA 2R3VA 1S0OA 2YKPA 3CC7S 2MKKA 4EZ9A 4C9DA 4FYWB 1X9SA 3ILIA 1VGYA 4C8YA 1FX2A 4DF8A 1A7GE 1YRTA 2PI5A 1SCJB 2ZHOA 4JI7F 2QA1A 1RT2A 1S6UA 2XZDB 3TQEA 2WONA 2G0JA 4N56A 1F5CA 3GPAA 3J7ZT 5L8RC 2Z4PA 3P6YC 3MM8A 2IY5B 1RWKB 1YZ7A 2FZGB 2XSJA 5DGAA 3R1LA 1YSJA 3W2VB 1KONA 4CH0S 2DHXA 2YKQA 4ZN1A 4L73A 4ES2A 1HWUA 1HL6A 2N7CA 3TARA 1YIJS 5KFEA 3MWBA 2AX1A 5F0WA 1FFWB 4AYBD 3WX4A 4C4WA 3OFFA 5E33A 3SIPB 1I6JA 3TX0A 3LOUA 2EC0A 2AJ2A 3AB2B 2FDNA 1N32F 1UZHA 2WSEC 5DDQC 2VQFF 2CQ0A 2NCKL 3KHHA 3HO1A 4U6PA 3L3CA 1Q79A 1Y5NB 2WVBA 2VBZA 3DLGB 4WIIA 4WXWA 3BBBA 4DFJA 5ETTA 3Q8YA 2ZDPA 3GR1A 3MECB 4PXEA 2WHOA 3OSPA 3OBIA 1KQFB 4ZCIA 2K7KA 1RT1B 1VIOA 4TY9A 1IR1A 2RRNA 4OZ1A 5ETLA 1RAHB 1Q4RA 3IG1A 3MEDA 2FZKB 5IQ6A 1RLCL 1TKXA 3OTBA 3M9MB 1TQLA 2HBQB 4WP9A 2DKOB 2JEJA 2YKAA 1BQMA 1WOPA 1HWLA 5D77A 2XS7A 3J7A1 4K0KF 1FWLA 2CJAA 1YJTA 3LAMA 3GQCA 1RHQB 1YLXA 3HD1A 4LR8A 4TN2A 2W9CB 2IYGA 4ED6A 3DRRB 4ECWA 1NK9A 2HYIB 4M5MA 5DS7A 3TWZA 1N0VC 4UTGA 3IWNC 4OYPA 4RWXA 4Z37A 5JVHQ 4K4VA 2BQRA 3CT9A 3GV7B 2VIHA 4Y2CA 1AZSA 1FA0A 5M2PA 4DUYF 3OSNA 1LWEB 3ET6A 4DUZJ 1HNWF 1NJWA 4OJHA 3MMCA 4MK9A 3J80Y 4J9NA 4CO2A 1HFEL 3MUTP 3ZXWA 1S7HA 2MKHA 2HWTA 3EJMA 5L1JA 1SV5B 2DNZA 4P7VA 4URSA 1Q81T 2KFNA 1XMOJ 3HHDA 1BXNA 1FE0A 3GG0A 1EX8A 1FERA 1UW4A 5KFRA 4MTPA 4OJ1A 4E98A 2WAQD 2DY9A 1T9TA 4OI1A 1NK4A 5RUBA 2A2DA 3EGVA 3VCDA 3DU5A 4N41A 1RTIA 4NLPA 2VPZB 2YQ1A 4BCAA 2GA7A 3OR1B 3ENVA 8ATCB 4WFAQ 2ZE2A 3GZ7A 4FXWA 3CJ5A 5E7OB 4J9PA 4GC6A 4L72B 6AT1B 1H38A 1ZH5A 2NYHA 3NWRA 1S59A 2GAGC 2L9WA 4LF4J 1FJGF 1FTRA 2CQ4A 2CPJA 2HVHA 1OYDA 1NAQA 2CJBA 4PPZA 3KJVB 4DG1A 3A8EA 1LFWA 3MM9B 3G6VA 3MPDA 1WTBA 4QZVB 4DSJA 1R3NA 1UZDA 4DR4F 1D9AA 2UXDF 3P4UB 2JLGA 3BGRA 1VJQA 4FF3A 1XMQF 1GTHA 4CO0A 2XS5A 2QL9B 4XAKA 4X2BA 2PEHA 1VK8A 1VYAA 1FRMA 4J9VA 3L7OA 2JVRA 1SH3A 3VAFA 5IT9U 1ZM3A 4C3MA 4QIGA 3IR7B 1FKOA 1HHSA 3HVRA 2G0IA 2UV8A 3KHRA 3OD2A 2GQQA 4P2XA 2MQPA 5EGYA 4Q44A 4WCEQ 2EFOA 2CNOB 2YNFB 1HR0J 3QAUA 3QT5A 1ZBTA 3C46A 1IVZA 1DARA 3OL7A 4EYIB 3C3LA 1MMNA 1B0VA 4ZHRA 2R7WA 3B6BA 1Q7LB 5K8NA 5L46A 2A18A 1X0FA 4ANCA 4XIUA 3CIZA 3J7AN 4WKRA 4DX5A 1YBUA 2BKPA 4ECVA 4FS1A 2R7SA 3I32A 2ZC4A 2R7VA 2BJ3A 2JDJA 4K2JA 5IC6B 2M88A 8RUCA 9RUBA 1LK7A 3HSGA 2VPWB 1Y5LB 3LA0A 4USUA 1RK8A 4WJBA 2YKOA 2LA6A 2H5JB 3POTA 2HIYA 1S1WB 3MPYA 3NEKA 4NOHA 3HKWA 2XO6A 3OJUA 4JI0J 4L3KA 2G4BA 1S1UA 4QWDA 1RWMB 1HQEA 4DV5F 1R0CB 1S6OA 3AFGA 4YFUA 1K8AT 2J0SD 4LRBA 3GSDA 4ID5A 1IJEB 1HWIA 5B7WA 1ZAXA 2C2EA 4JV2A 1P9YA 2HFUA 4F0HA 1A6LA 1J2VA 5B0FA 3W9IA 1TV6A 2GIFA 3AOBA 3PHTA 1YBTA 1IKYA 3R5BA 1JLEB 2NZCA 3U7JA 4DV2J 3DLBA 2AHOB 4QIFA 3OTEA 2ZEJA 1YJNS 2HQDA 2AGOA 4EMDA 3QLHB 5I3UB 1KQGB 1Y0HA 2QIFA 5K20B 2B4PA 1WOOA 3BH6B 4NA3A 5ADZA 1NDPA 2Z8QA 5B0EA 5ETPA 1W25A 2XM3A 3MGJA 3GONA 3L9ZA 4ZA1A 1RJJA 3M8PB 4X4QA 4IR1A 3R7SB 2ZH5A 1Y3KA 3ZNJ1 2N3OA 4O0IA 2GW8A 5KFMA 4LQ9A 4YN3B 2CWXA 4UOFA 2QN6B 3D28A 4WE1A 2R8HA 1RT6B 2PC6A 2X51A 4ERDA 5A76A 3BEGB 1RHKB 1S9GB 2RE1A 2RQKA 1JJ4A 1LQ9A 1YK9A 4B9MA 1BQNB 1IKWA 5DLGA 4F2RA 4LF7J 2LQ5A 2F4VJ 2J7WA 4DPYA 4B9TA 2V2VA 3R9LA 1TKXB 2HKEA 3DNCA 2WVCA 2Q1LA 1YTYA 1BQMB 4V1Ak 3HT3A 2IC3B 1QAYA 3B54A 2B9YA 4LFBF 3D5MA 1VRTA 1S9GA 4JI3F 4USWA 4XDDA 4RBUA 5FDLB 4HDGA 2J9CA 2QL7B 3QGHA 3ENAA 3ITHB 5H9FJ 4ED0A 4J9UE 2MZRA 1UPMB 2HRUA 2ADCA 2UZAA 4IDKA 4WWSA 4OHYA 1ZPVA 3TAPA 1F0XA 1J27A 3TEGA 4NRTA 1OO0B 3UD5A 4X64F 4ZITA 1J5EJ 3SCLE 3N0VA 2A0FB 3AHPA 2HQFA 2RNEA 2OEKA 1UCNA 1UFLA 3NGKA 1KLNA 1EQMA 1X31C 2HK3A 3LP0A 3VAKA 3CC2S 1SXLA 5L9XA 4RBTA 2POKA 4RW7A 1CJUB 2DGUA 1Q1KA 2AX0A 2HWIA 3PG9A 3EX7B 4L6V3 4ELTA 5K8PA 1EZZB 4G3IA 3NMAA 1BE4A 1HBOB 2R7RA 2DK2A 3R6GB 4F25A 2QZ8A 4B3SF 4O3SA 4M5KA 3LANA 5KFJA 4NA1A 4HT5A 2XWYA 1TKZA 4CNZA 3MUMP 3M05A 4CRJA 2IFXA 3GFHA 4DEZA 2FVPA 2J0QD 4HEA9 3LP0B 1OSCA 2F8EX 2VD3A 3GIIA 2GJFA 4UF4A 2D3UA 3ISZA 3H40A 2CQ2A 4RW7B 3MAHA 2JRSA 4CLFA 4CLYA 5IXUA 1JXLA 4DCPB 1WC4A 2QLWA 3D3CJ 5F8GA 4N77A 3CCQS 2BABA 2QSWA 3D0GE 1R8BA 1L3KA 1WC3A 4I6WA 3TJ8A 5KT2A 1U1PA 4OX6A 4FYVB 4RW4A 5B0GA 1LOUA 1SIZA 2LQ8A 3G8QA 3CJKA 1I94J 1T02A 3NS5A 5HVGA 3MCMA 3F73A 3FVYA 3PXGa 3BPDA 3TZXA 5D4NA 1RTJB 2NS1B 2E29A 5H9EJ 4Q45A 3IFEA 2MZJA 5EX3A 3PX4A 3NAIA 4Z2XA 1HARA 1L5UA 2Z2ZA 1E6VB 2L08A 5J1EB 5F9LA 1U09A 1IBKF 2KT5A 3I5BA 1QUVA 4I7FA 5D0RA 3EYZA 2QEXS 2UUCF 3THTA 1CG2A 3M2RB 1SC4B 4KQZA 4USKA 2B3TB 4KE5A 4DU7A 3VAHA 2EI5A 2ALYB 3WDOA 3I31A 4QWEA 3PYGA 1JLGB 3TO8A 1WC6A 1BY9A 4EUVA 4A8YA 3M2VB 2C42A 2MPUA 2Z2LA 4O4RA 4LFAJ 2Y9HA 4QIWD 5J1NA 1T8EA 1LWXA 1UJ5A 2YWWA 4O4GA 2ZM6J 1U45A 2QMUB 3M8RA 3M4XA 2L48A 3IBCB 1UJ6A 2HNZA 5IQQA 5KG0A 4C3KA 4DG1B 2OPRA 3NXZA 1T05B 3BYPA 3M2UB 4KBIA 1NK0A 2UUTA 4K4ZA 1ZA1B 4RX6A 5HATA 1CLFA 4OZLA 4WIQA 3HM9A 2YBVA 4CTAB 4PYDA 4DV7J 3T5KA 3SI8A 2ROEA 3DXBA 4QR1A 3QZ7A 1DTQA 4ED4A 3R6LB 5MAOA 1XN9A 3B4MA 3W66A 2WVEA 2IM1A 4TQRA 1IXKA 3T6JA 4C0OC 2ZH8A 2FJWA 1GX6A 3BKUA 2CPEA 4KY3A 2OELA 3V6KA 1JLBA 4KKOB 1M5HA 4IOBA 3CPWR 5ETMA 4G1QB 3IAM9 1N5SA 4HHJA 3L09A 4P2MA 5D6GA 2NR0A 1XR5A 2UUBF 2OIHA 4RW9B 5KFGA 1S9EB 3AODA 2VOOA 2MEWA 1VC6A 4F2SA 5LXYA 4ECRA 3BQ0A 3VAJA 4OLOA 4JI0F 3W64A 3KLEB 2KG1A 4H4MB 4QYZJ 2M8DB 3TVZA 1N0UA 1PSDA 3TZYA 1HPZA 2VJVA 1C0UA 1R43A 3V81B 1N6QB 2XEXA 3FDSA 4O44B 2V50A 2QYGA 1NSPA 3D7SB 1RHRB 3AH6A 3I0SB 4X4NA 1C0TA 2LP4A 3T9ZA 1SI9A 1XWLA 2K8GA 4OI4A 4P73A 2OI2A 4MYTA 5GADU 2GQ2A 2FHJA 3O8WA 4ZP7A 4JBCA 3NNCA 1S99A 5HANA 1BMQB 3R3TA 2BANB 4H4MA 2QA4G 1C0UB 1KLMA 3H5SA 2F8HA 3GB0A 3QGGA 5HVFA 2FYXA 3W9HA 4AL6A 4RNHA 3R5GA 2I9SA 4WU3A 3HFKA 3HD2A
chains in the Genus database with same CATH topology
3N5FA 3C6TA 1JLEA 4JYAF 5F8JA 3ZZ0A 4IG0B 4MJKA 3IG1B 3MEDB 3Q0AA 4DQQA 1J5OA 2BANA 4GO7X 2ZH3A 3PKMA 3HVTA 3NCPA 1KLMB 4ED3A 2X3GA 1ZAWA 3DOLA 5HLFB 1UJ4A 2BBEA 3Q8RB 4K4TA 3CD0A 4JI6F 1RYRA 4YDXA 2BM1A 3CMES 2JLFA 1VRUB 4ECZA 1HWKA 3M32A 2WOMB 5AE2A 2ZDOA 1S4FA 3B4DA 2V2KA 3EUNA 2O01C 3SSRA 3M8QA 1HMVA 5D4OA 1K1QA 3MM7B 2ZD1A 4OJGA 1N5QA 2K2PA 2Q79A 1SKRA 3DRSA 1R8HA 4I6AA 2FVSA 2R8JA 2LQJA 1VLYA 2YKNB 4LSLB 1JLAB 5A0YA 1VQYA 1FDDA 1NJXA 4NXNF 4WYLA 1SH2A 4KGMA 1OPIA 1WG4A 2JLEA 1SIWB 2ZH4A 4D3HA 3RRGA 1LK5A 1UA1A 4IFYA 1IUJA 2UUWA 2LECA 4J37A 1ZM2A 4ZPTR 2CVIA 5EHHA 1LWEA 3Q23A 3ZZRA 1X9MA 2VOPA 2EWHA 5DQGA 4OHWA 2K1RA 3BGRB 4YB7A 3LF0A 4A8MP 4DLEA 4OHVA 2CIMA 1LV5A 3VAMA 3I9ZA 1TZ0A 2WSCC 1VQ6S 1RTDA 1SKSA 1G3OA 2KHCA 4DS4A 2DNNA 2NPIA 1VQ5S 2MHEA 4JOUA 2IMWP 4ZPWR 1OIAA 2E5JA 4NLSA 3LWLA 3K5NA 1GAOA 1U25A 1X5SA 4N47A 4WFZA 4H54A 4O3PA 2HHTA 2EG1A 5I4MA 2ZH6A 5G0RA 2QSFA 3BF4A 4LF6F 1KHWA 5L1IA 1APSA 2MQLA 4ECTA 2DRBA 4OIXA 2VG7A 3PR4A 4K4UA 4X4RA 2ZZNA 5I3QA 1X4HA 1C1CA 3Q8SB 3TX8A 1W2BR 4L3NA 4B3MF 2K3IA 2OJ3A 2D1CA 3NBPB 2XS2A 3K58A 4TKTA 4EBDA 4ILRA 4Y34A 3UI3A 3BSOA 3HDSA 3X3UA 1ZTWA 1HQUA 2CQGA 3GILA 2M4MA 1H0HB 3KG4A 5HMZA 1C1BA 5A8RA 3AJ1A 1REVB 2HFZA 1Y4ZB 4DV6F 5JJBA 3TANA 1M5PC 2JEGA 1FT8A 1S1XA 4DPOA 4FP9A 2B7BB 3I4PA 4NL5A 3T5HA 3K0JA 4X4OA 2ZVSA 1M5OC 4TLQA 2EG2A 4PG8A 5ITHA 1P9QC 1SC6A 2D41A 4UW2A 2AF6A 4AFFA 5D78A 3LP2A 1XK8A 3OR2B 2O67A 4M95A 2HNYB 4DFPA 1X4EA 3DDNA 4NLDA 2D9OA 2ZH9A 3WC0A 2MKJA 4MAKA 1HR0F 2BDPA 1JLQB 2DH9A 5F41A 4A8SA 2OO4A 1JLCA 3IGNA 4YB6A 5DGBA 4B9VA 2OP5A 4PXBA 5KT6A 2BJDA 3VTIA 3BDPA 2PFFB 2QFJA 2CZ4A 2NSCA 5D4PA 1MWZA 5F9NA 1LWFB 3MOJB 2C2DA 2CDQA 1WG5A 2LYVA 3MMCB 1S1WA 4H4KC 5FJ4A 3CVKA 3K5LA 3RR7A 4R8UA 4NZ6A 4EGLA 5KFQA 2J6SA 5KFSA 4WYWA 3O5TB 4OJ3A 5IT4A 2XSJB 3CDAA 4FN5A 3DCAA 3TA2A 3PW4A 3H5YA 4AE5A 1IKWB 4I6YA 3DLHA 3HHNB 3RZAA 1URNA 4PQAA 1U1MA 4LFAF 4DV0F 3CCSS 4V19J 2KM8C 2RS2A 2VA2A 3EGNA 5E2QA 3U1MA 1AROP 2XMUA 3OV7A 5I3UA 2AGQA 3AQPA 1LXJA 4IOAQ 1S0NA 2ZZMA 2R8KA 2HW3A 2HVIA 1UVKA 3AA9A 4ELUA 4K50A 3MF5A 5J2NB 2LEPA 2MY7A 3MM6B 3U27A 2MDAA 1G1XA 3GYXB 3I82A 2F9JA 3FFIA 4TLRA 3M8QB 1IKXA 2V5HG 4KPYA 3G9CA 4JI4F 3H5XA 4ILMA 5HQ8A 1XNQF 3I5CA 1KEKA 2JZ5A 3TAMB 3VQTA 5BR8F 4R5PA 4LIWA 5J2NA 2MZSA 5KFAA 4N76A 3P3DA 1HBOA 4ATNA 2M5YA 2M2BA 3PFOA 1S1TB 2B5JB 1YVFA 1WF2A 3TA1A 5KT7A 3HVTB 1KR4A 4EO8A 3GIJA 5JVGQ 2ZOGA 4KB7A 2R8IA 1U7LA 2DGXA 1MNEA 1FK9B 2RIJA 2DH8A 1RT4B 3QWUA 4Q43A 3DLKB 3KK3B 2FLLA 3V6DB 2ZBIA 2GFFA 2MZQA 2P6SA 2YH1A 2FPHX 1K1SA 1Q82T 4FBUA 4YDDB 1BWEA 3HX9A 1U47A 5CXTA 2COLA 2QA2A 3PDNA 1ULRA 3ZZOA 5GAGU 4BS2A 2GJIA 2IAJA 3G96A 5KFHA 3FJ2A 1UL3A 3PR5B 4ZCMA 3NMRA 1TAUA 2FVRA 3O1LA 5E3AA 3LO3A 1F5AA 2PIIA 2L9NA 2L41A 2VFUA 4A8XA 5CYQB 4C7QA 2YTCA 5GVQA 4J9SA 1BD6A 1Q86T 4X4PA 3PW2A 3PKYA 4PRFA 2IVYA 4A47A 4CT8A 4MFBA 3CJ3A 2ZH2A 4EBEA 4DL2A 1D9DA 5SUHA 5IFMA 2YNHA 3UQSA 2DPJA 3E51A 1U1OA 3MURP 1S49A 1EETB 1RAJA 1W2IA 1Q53A 2O66A 2OSQA 3QWPA 4C8NA 5KOWA 3MFHA 1ZTTA 5KFYA 3IN5A 4Q2MA 5F3TA 5DM6Q 3TAQA 1WI6A 2SXLA 3DDKA 5F8IA 2MZTA 4ALZA 5J2QB 4F4ZA 3KMSA 2FC9A 3CDEA 2YWGA 2YWKA 1JLBB 1N33F 3M2UA 2EBGA 2QYCA 1F2GA 1T95A 2BVZA 4C8KA 1RI7A 3V2UC 5A8WA 4IG3A 4DL3A 4F26A 1OPZA 2CQDA 3IA0A 3PX6A 1DLOA 4LVOP 2BR0A 2NUHA 5CCLA 1QSLA 4X66F 3PACA 3RR8A 3OJSA 1FJCA 2FJBB 3MEEB 2H9ZA 2QV6A 1WTFA 3GYNA 5C24A 3DC2A 4NLWA 3HHLA 1N5YA 1UAWA 2LQBA 4CO1A 5BJRA 5HO4A 3JSRA 2PA3A 2GX8A 4QW9A 4ZVGA 1FEEA 1HBMB 4CT9A 2FGOA 3DFEA 3GG1A 1OQ6A 2IM3A 1FXDA 4IKAA 1U49A 4B9UA 4WFXA 4ED8A 2F40A 2CPIA 1HBNB 4HDHA 4N5SA 5E3RA 5C24B 2OD4A 5DLFA 2B4UA 4DMZA 3PW0A 3I96A 2EFNA 4DOZA 3UWTA 4ZMMA 3C6TB 1NJIT 2MGZA 1JLFB 3DM2B 4YP3A 1X4BA 3ZZTA 3DOKA 3UD4P 1IBLF 2PI4A 5T14A 2R2SA 2GHVC 1WF0A 5KFVA 1UVIA 4K59A 3GFZA 2LQ9A 3V6JA 1B0PA 2ZNYA 3AA8A 2QO3A 2EPIA 4TYAA 2DGWA 2KH9A 5FLXY 4RW4B 4LF5F 4IO9Q 3T3FA 5LXRA 2A1BA 5DM7Q 3CCUS 3S6EA 4YB5A 1IQZA 2W9AA 1KQSR 2UU9F 4IRDA 3J7YU 4KFBB 5DQIA 2JEIA 2ZJPQ 5LJ5Y 3DRXA 5F8LA 4RU9A 5KFDA 4X62F 5LJ3Y 3H2LA 2ZUGA 1VRUA 2QMWA 4TY8B 5C42A 1XR6A 3SV4A 5FIIA 2CPDA 1U2FA 1HNXF 2M0GB 5LMUF 4LIRA 1S76D 4ZKAA 1RA6A 2E7XA 2YX7A 4DSKA 1TK5A 1P1LA 1FKOB 3CCRS 4F3MA 5T7LB 1ZETA 3NBPA 1Q78A 1Y3JA 1S79A 3M1VB 3CDUA 3SFGA 2VASA 2J9EA 3FRZA 2KYXA 4USIA 4Y00A 1N56A 1UA0A 1TFWA 1REVA 1DTQB 1N52B 4RZRA 2W4DA 2VC1A 4ZPVR 2O5DA 1M1KT 5GAHI 4AXIA 4LUBA 3K5PA 4I69A 5EWEA 5KOXA 3BR9A 2E66A 2BV3A 5HL7Q 1S1TA 4BBYA 4J9RA 5KFBA 3HVAA 2WB4A 4R0EA 2CJQA 2EFGA 1NHVA 2LU2A 4RNFA 4RUCA 3G8TA 4A8WA 3NLCA 3C6UA 2OH2A 4A8FA 1IKVB 2JX2A 4CZCA 1N5TA 3KLFB 3DHWC 4W92B 3H59A 1F5BA 1MMDA 2NXUA 1X4CA 2RRBA 4X4TA 4K5SA 2CQ3A 1HQUB 4CH1A 2CFXA 4FYDA 1H2UX 1JLGA