4IOCS

Crystal structure of compound 4f bound to large ribosomal subunit (50s) from deinococcus radiodurans
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
175
structure length
175
Chain Sequence
MELTAKPRTPKQKLDESMIAAVAYNKENNVSFALDRKAFDRAFRQQSTTGLFDITVEGGETFPALVKAVQMDKRKRAPIHVDFYMVTYGEPVEVSVPVHTTGRSQGEVQGGLVDIVVHNLQIVAPGPRRIPQELVVDVTKMNIGDHITAGDIKLPEGCTLAADPELTVVSVLPPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Novel 3-O-carbamoyl erythromycin A derivatives (carbamolides) with activity against resistant staphylococcal and streptococcal isolates.
pubmed doi rcsb
molecule tags Ribosome/ribosome inhibitor
molecule keywords 23S ribosomal RNA
total genus 21
structure length 175
sequence length 175
ec nomenclature
pdb deposition date 2013-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF01386 Ribosomal_L25p Ribosomal L25p family
S PF14693 Ribosomal_TL5_C Ribosomal protein TL5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.240.10 Mainly Beta Beta Barrel Ribosomal Protein L25; Chain P Ribosomal Protein L25; Chain P 4iocS01
2.170.120.20 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 Ribosomal protein L25, beta domain 4iocS02
4JXXA 3CF5S 2ZJRS 5DM6S 4JYZA 1D6KA 1ZJWA 3DLLS 4WFNS 4IO9S 1QRTA 5GAEW 4P2BA 2ZJQS 1QTQA 5HL7S 3AIIA 3PIPS 2ZJPS 1GTRA 1GTSA 4IOAS 4WFBS 5JVHS 2RD2A 5GADW 4H3SA 1QRSA 4WF9S 5BNZA 1DFUP 1NYLA 4WCES 4WFAS 1EUYA 3PIOS 2RE8A 4JXZA 1EXDA 2HZ7A 1O0CA 4U67S 1EUQA 1B75A 3J7ZV 4IOCS 5GAHW 5JVGS 5IZNA 5GAGW 1O0BA 4UY88 1QRUA 1FEUA 5DM7S
chains in the Genus database with same CATH superfamily
4JXXA 4LLGA 3CF5S 2ZJRS 5TMCA 4JYZA 1Y1VC 1K83C 1ZJWA 3LYWA 4XLPA 4Q4ZA 2A68A 4IO9S 2YU9C 5FLMC 2Y0SD 1SMYA 1WCMC 3W2VB 2KPUA 3PO2C 5HL7S 3AIIA 3PIPS 2BE5A 2WB1D 2NVQC 1R9TC 2E2JC 4A93C 2PPBA 2VUMC 2RD2A 5GADW 1QRSA 2PA8D 5C3EC 2JA6C 3W2WB 1Y1WC 4BY1C 3CZBA 4WCES 4H4KA 4WFAS 4LK0A 4OIRA 3S17C 3HKZD 2JA8C 4JXZA 2JA7C 5C4XC 2EGWA 1TWGC 2HZ7A 4A3FC 2PNWA 5GAHW 5JVGS 4UY88 4C3HC 3GTPC 1BDFA 2R92C 1FEUA 5IYCC 4G7OA 5IP9C 4L69A 2A69A 3HOUC 1VHKA 3H3VD 3M4OC 4BBSC 4A3GC 2PICA 4BY7C 4GZYA 2KXYA 3WODA 4C3IC 3S1MC 5GAEW 2GAEA 2ZJQS 3K7AC 5IP7C 1GTRA 4OIPA 1GTSA 1V6ZA 5IYBC 1SFOC 2NVTC 4OIOA 4QIWD 3I4MC 2PI8A 1IW7A 3PO3C 1VHYA 1EUYA 4XSZA 3X1LB 2A6HA 4ZH4A 4A3JC 2O5JA 2AE0X 4LJZA 5TMFA 4QJVA 3RZDC 4X6AC 1HQMA 4A3IC 1ZYRA 4BXXC 4J3CA 5IZNA 2CX8A 3H0GC 3CQZC 3EQLA 1I3QC 3GTLC 4OINA 4E8BA 4LK1A 4C3JC 1TWFC 4Y7NC 5DM6S 5HQHA 1NXZA 4NOIA 4KN4A 3DLLS 1TWHC 5C44C 3GTOC 3S2HC 4WFNS 1QRTA 4C2MC 1Z85A 3RZOC 2G6GA 2G5DA 2ZJPS 4YG2A 2PMZD 4OIQA 4KN7A 3GTGC 3M3YC 4WFBS 1TWCC 1DFUP 1NYLA 2NWAA 1I50C 3S2DC 4V194 4MEYA 2A6EA 4A3LC 4Q5SA 2R93C 2RE8A 3DXJA 4G7ZA 1YNJA 4XSXA 3S1RC 3GTQC 1EUQA 3J7ZV 2L3UA 2Z0YA 5GAGW 3S14C 3S1NC 1YNNA 1QRUA 2E2IC 2B63C 3GTJC 2NVXC 3HOXC 1D6KA 3FKIC 4KMUA 3HOZC 2O5IA 3HOYC 4A3CC 3HOWC 4XLNA 2CW0A 4MEXA 4P2BA 4YFNA 5C4JC 1TWAC 1QTQA 4YFXA 4IOAS 3HOVC 5IYDC 4A3KC 3S15C 4A3BC 5JVHS 4JK1A 4MQ9A 1I6VA 4H3SA 3I4NC 4WF9S 1I6HC 2EGVA 5BNZA 3KW2A 2E2HC 3S16C 3GTKC 2L5NA 3PIOS 4A3EC 4BBRC 2NVYC 1EXDA 5D4DA 2KQ1A 4YFKA 4A3MC 1O0CA 4U67S 1B75A 2R7ZC 2JA5C 1UDXA 4AYBD 2PJJA 4IOCS 3GTMC 4A3DC 1O0BA 4G7HA 3S1QC 5DM7S 2WAQD 4Y52C
chains in the Genus database with same CATH topology
4JXXA 3CF5S 2ZJRS 5DM6S 4JYZA 1D6KA 1ZJWA 3DLLS 4WFNS 4IO9S 1QRTA 5GAEW 4P2BA 3W2VB 2ZJQS 1QTQA 5HL7S 3AIIA 3PIPS 2ZJPS 1GTRA 1GTSA 4IOAS 4WFBS 5JVHS 2RD2A 5GADW 4H3SA 1QRSA 4WF9S 3W2WB 5BNZA 1DFUP 1NYLA 4WCES 4H4KA 4WFAS 1EUYA 3PIOS 4V194 3X1LB 2RE8A 4JXZA 1EXDA 2HZ7A 1O0CA 4U67S 1EUQA 1B75A 3J7ZV 1UDXA 4IOCS 5GAHW 5JVGS 5IZNA 5GAGW 1O0BA 4UY88 1QRUA 1FEUA 5DM7S
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JXX A;  3CF5 S;  2ZJR S;  5DM6 S;  4JYZ A;  1D6K A;  1ZJW A;  3DLL S;  4WFN S;  4IO9 S;  1QRT A;  5GAE W;  4P2B A;  2ZJQ S;  1QTQ A;  5HL7 S;  3AII A;  3PIP S;  2ZJP S;  1GTR A;  1GTS A;  4IOA S;  4WFB S;  5JVH S;  2RD2 A;  5GAD W;  4H3S A;  1QRS A;  4WF9 S;  5BNZ A;  1DFU P;  1NYL A;  4WCE S;  4WFA S;  1EUY A;  3PIO S;  2RE8 A;  4JXZ A;  1EXD A;  2HZ7 A;  1O0C A;  4U67 S;  1EUQ A;  1B75 A;  3J7Z V;  4IOC S;  5GAH W;  5JVG S;  5IZN A;  5GAG W;  1O0B A;  4UY8 8;  1QRU A;  1FEU A;  5DM7 S; 
#chains in the Genus database with same CATH topology
 4JXX A;  4LLG A;  3CF5 S;  2ZJR S;  5TMC A;  4JYZ A;  1Y1V C;  1K83 C;  1ZJW A;  3LYW A;  4XLP A;  4Q4Z A;  2A68 A;  4IO9 S;  2YU9 C;  5FLM C;  2Y0S D;  1SMY A;  1WCM C;  3W2V B;  2KPU A;  3PO2 C;  5HL7 S;  3AII A;  3PIP S;  2BE5 A;  2WB1 D;  2NVQ C;  1R9T C;  2E2J C;  4A93 C;  2PPB A;  2VUM C;  2RD2 A;  5GAD W;  1QRS A;  2PA8 D;  5C3E C;  2JA6 C;  3W2W B;  1Y1W C;  4BY1 C;  3CZB A;  4WCE S;  4H4K A;  4WFA S;  4LK0 A;  4OIR A;  3S17 C;  3HKZ D;  2JA8 C;  4JXZ A;  2JA7 C;  5C4X C;  2EGW A;  1TWG C;  2HZ7 A;  4A3F C;  2PNW A;  5GAH W;  5JVG S;  4UY8 8;  4C3H C;  3GTP C;  1BDF A;  2R92 C;  1FEU A;  5IYC C;  4G7O A;  5IP9 C;  4L69 A;  2A69 A;  3HOU C;  1VHK A;  3H3V D;  3M4O C;  4BBS C;  4A3G C;  2PIC A;  4BY7 C;  4GZY A;  2KXY A;  3WOD A;  4C3I C;  3S1M C;  5GAE W;  2GAE A;  2ZJQ S;  3K7A C;  5IP7 C;  1GTR A;  4OIP A;  1GTS A;  1V6Z A;  5IYB C;  1SFO C;  2NVT C;  4OIO A;  4QIW D;  3I4M C;  2PI8 A;  1IW7 A;  3PO3 C;  1VHY A;  1EUY A;  4XSZ A;  3X1L B;  2A6H A;  4ZH4 A;  4A3J C;  2O5J A;  2AE0 X;  4LJZ A;  5TMF A;  4QJV A;  3RZD C;  4X6A C;  1HQM A;  4A3I C;  1ZYR A;  4BXX C;  4J3C A;  5IZN A;  2CX8 A;  3H0G C;  3CQZ C;  3EQL A;  1I3Q C;  3GTL C;  4OIN A;  4E8B A;  4LK1 A;  4C3J C;  1TWF C;  4Y7N C;  5DM6 S;  5HQH A;  1NXZ A;  4NOI A;  4KN4 A;  3DLL S;  1TWH C;  5C44 C;  3GTO C;  3S2H C;  4WFN S;  1QRT A;  4C2M C;  1Z85 A;  3RZO C;  2G6G A;  2G5D A;  2ZJP S;  4YG2 A;  2PMZ D;  4OIQ A;  4KN7 A;  3GTG C;  3M3Y C;  4WFB S;  1TWC C;  1DFU P;  1NYL A;  2NWA A;  1I50 C;  3S2D C;  4V19 4;  4MEY A;  2A6E A;  4A3L C;  4Q5S A;  2R93 C;  2RE8 A;  3DXJ A;  4G7Z A;  1YNJ A;  4XSX A;  3S1R C;  3GTQ C;  1EUQ A;  3J7Z V;  2L3U A;  2Z0Y A;  5GAG W;  3S14 C;  3S1N C;  1YNN A;  1QRU A;  2E2I C;  2B63 C;  3GTJ C;  2NVX C;  3HOX C;  1D6K A;  3FKI C;  4KMU A;  3HOZ C;  2O5I A;  3HOY C;  4A3C C;  3HOW C;  4XLN A;  2CW0 A;  4MEX A;  4P2B A;  4YFN A;  5C4J C;  1TWA C;  1QTQ A;  4YFX A;  4IOA S;  3HOV C;  5IYD C;  4A3K C;  3S15 C;  4A3B C;  5JVH S;  4JK1 A;  4MQ9 A;  1I6V A;  4H3S A;  3I4N C;  4WF9 S;  1I6H C;  2EGV A;  5BNZ A;  3KW2 A;  2E2H C;  3S16 C;  3GTK C;  2L5N A;  3PIO S;  4A3E C;  4BBR C;  2NVY C;  1EXD A;  5D4D A;  2KQ1 A;  4YFK A;  4A3M C;  1O0C A;  4U67 S;  1B75 A;  2R7Z C;  2JA5 C;  1UDX A;  4AYB D;  2PJJ A;  4IOC S;  3GTM C;  4A3D C;  1O0B A;  4G7H A;  3S1Q C;  5DM7 S;  2WAQ D;  4Y52 C; 
#chains in the Genus database with same CATH homology
 4JXX A;  3CF5 S;  2ZJR S;  5DM6 S;  4JYZ A;  1D6K A;  1ZJW A;  3DLL S;  4WFN S;  4IO9 S;  1QRT A;  5GAE W;  4P2B A;  3W2V B;  2ZJQ S;  1QTQ A;  5HL7 S;  3AII A;  3PIP S;  2ZJP S;  1GTR A;  1GTS A;  4IOA S;  4WFB S;  5JVH S;  2RD2 A;  5GAD W;  4H3S A;  1QRS A;  4WF9 S;  3W2W B;  5BNZ A;  1DFU P;  1NYL A;  4WCE S;  4H4K A;  4WFA S;  1EUY A;  3PIO S;  4V19 4;  3X1L B;  2RE8 A;  4JXZ A;  1EXD A;  2HZ7 A;  1O0C A;  4U67 S;  1EUQ A;  1B75 A;  3J7Z V;  1UDX A;  4IOC S;  5GAH W;  5JVG S;  5IZN A;  5GAG W;  1O0B A;  4UY8 8;  1QRU A;  1FEU A;  5DM7 S; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...