4IU6A

Human methionine aminopeptidase in complex with fz1: pyridinylquinazolines selectively inhibit human methionine aminopeptidase-1
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
304
structure length
304
Chain Sequence
YRYTGKLRPHYPLMPTRPVPSYIQRPDYADHPLGMSESEQALKGTSQIKLLSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCYPSPLNYYNFPKSCCTSVNEVICHGIPDRRPLQEGDIVNVDITLYRNGYHGDLNETFFVGEVDDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQANGFSVVRSYCGHGIHKLFHTAPNVPHYAKNKAVGVMKSGHVFTIEPMICEGGWQDETWPDGWTAVTRDGKRSAQFEHTLLVTDTGCEILTRRLDSARPHFMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Pyridinylquinazolines selectively inhibit human methionine aminopeptidase-1 in cells.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Methionine aminopeptidase 1
total genus 99
structure length 304
sequence length 304
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2013-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
A PF15801 zf-C6H2 zf-MYND-like zinc finger, mRNA-binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 4iu6A00
2V3YA 1YW8A 3IG4A 2GG0A 4U6WA 4RGZ1 5JFRA 1W2MA 4IKUA 5D6FA 4FLLA 4IKSA 2ADUA 2GGBA 2HOWA 4PNCA 4ZWUA 4RZZA 2Q8KA 4A6VA 1QXZA 3FM3A 3IU8A 2BHDA 4B28A 2BB7A 4QR8A 1BOAA 3CB6A 4Z7MA 2BWYA 1N51A 2V3XA 5CE6A 2BWWA 2V6CA 4U6CA 1C24A 2OAZA 3PKAA 2BWXA 2P98A 2OKNA 2DFIA 4PV4A 2GU5A 1JAWA 2BWSA 3CB5A 1B59A 5CDEA 3FMQA 2BHBA 3L24A 2GA2A 2BHCA 4FLIA 4IU6A 4ZWOA 1WN1A 4HXXA 3IU7A 2ZSGA 2GTXA 2EA4A 1Y1NA 2B3HA 3BITA 4A6WA 2GG5A 3RVAA 3S6BA 1WL6A 2GG3A 1XNZA 1XGSA 5FCFA 4FO7A 4EGEA 4U69A 3Q6DA 4IPAA 5CNXA 2GG2A 1CHMA 1W7VA 3MX6A 2NQ7A 1QZYA 3IU9A 3PKCA 4U71A 3MATA 1MATA 3L7GA 5FCHA 4IF7A 5JHUA 2GU6A 4S00A 4ZNGA 5D6EA 2BN7A 3D27A 1XGOA 5JI6A 4U70A 4U1BA 1C23A 1WY2A 3CTZA 4KM3A 4JUQA 2G6PA 2MATA 1R5GA 4U76A 2BH3A 4FLJA 2Q96A 1KQ0A 2GU4A 2GU7A 2Q92A 3PKEA 4FLKA 4S2RP 3BIPA 4U75A 5CIKA 1XGMA 1YVMA 4IKTA 1WLRA 2EVOA 2GGCA 4ZWPA 4RZYA 4FUKA 1O0XA 2EVMA 4S01A 5CDVA 2EVCA 2GG8A 2Q95A 2GG9A 2P99A 4IECA 1M35A 3TAVA 2IW2A 2P9AA 2V3ZA 2BHAA 1WKMA 1KP0A 1R58A 1WL9A 2B3LA 4U6JA 2B3KA 4U6ZA 2Q94A 3TB5A 4U6EA 5E5BA 3FMRA 1B6AA 1BN5A 2NQ6A 5CLSA 2GZ5A 3PKDA 1C27A 1YW9A 1YJ3A 2EA2A 2Q93A 4IKRA 1KQ9A 4S2TP 3BIQA 4OOKA 2BWTA 1C22A 3MR1A 1C21A 3RORA 2GG7A 4FKCA 1YW7A 2BWUA 2BWVA 1WBQA 4FO8A 4U73A 4IDYA 4R60A 5CDLA 1QXWA 1A16A 1QXYA 1XGNA 1PV9A 3PKBA 4MATA 1R5HA
chains in the Genus database with same CATH superfamily
2V3YA 1YW8A 3IG4A 2GG0A 4U6WA 4RGZ1 5JFRA 1W2MA 4IKUA 5D6FA 4FLLA 4IKSA 2ADUA 2GGBA 2HOWA 4PNCA 4ZWUA 4RZZA 2Q8KA 4A6VA 1QXZA 3FM3A 3IU8A 2BHDA 4B28A 2BB7A 4QR8A 1BOAA 3CB6A 4Z7MA 2BWYA 1N51A 2V3XA 5CE6A 2BWWA 2V6CA 4U6CA 1C24A 2OAZA 3PKAA 2BWXA 2P98A 2OKNA 2DFIA 4PV4A 2GU5A 1JAWA 2BWSA 3CB5A 1B59A 5CDEA 3FMQA 2BHBA 3L24A 2GA2A 2BHCA 4FLIA 4IU6A 4ZWOA 1WN1A 4HXXA 3IU7A 2ZSGA 2GTXA 2EA4A 1Y1NA 2B3HA 3BITA 4A6WA 2GG5A 3RVAA 3S6BA 1WL6A 2GG3A 1XNZA 1XGSA 5FCFA 4FO7A 4EGEA 4U69A 3Q6DA 4IPAA 5CNXA 2GG2A 1CHMA 1W7VA 3MX6A 2NQ7A 1QZYA 3IU9A 3PKCA 4U71A 3MATA 1MATA 3L7GA 5FCHA 4IF7A 5JHUA 2GU6A 4S00A 4ZNGA 5D6EA 2BN7A 3D27A 1XGOA 5JI6A 4U70A 4U1BA 1C23A 1WY2A 3CTZA 4KM3A 4JUQA 2G6PA 2MATA 1R5GA 4U76A 2BH3A 4FLJA 2Q96A 1KQ0A 2GU4A 2GU7A 2Q92A 3PKEA 4FLKA 4S2RP 3BIPA 4U75A 5CIKA 1XGMA 1YVMA 4IKTA 1WLRA 2EVOA 2GGCA 4ZWPA 4RZYA 4FUKA 1O0XA 2EVMA 4S01A 5CDVA 2EVCA 2GG8A 2Q95A 2GG9A 2P99A 4IECA 1M35A 3TAVA 2IW2A 2P9AA 2V3ZA 2BHAA 1WKMA 1KP0A 1R58A 1WL9A 2B3LA 4U6JA 2B3KA 4U6ZA 2Q94A 3TB5A 4U6EA 5E5BA 3FMRA 1B6AA 1BN5A 2NQ6A 5CLSA 2GZ5A 3PKDA 1C27A 1YW9A 1YJ3A 2EA2A 2Q93A 4IKRA 1KQ9A 4S2TP 3BIQA 4OOKA 2BWTA 1C22A 3MR1A 1C21A 3RORA 2GG7A 4FKCA 1YW7A 2BWUA 2BWVA 1WBQA 4FO8A 4U73A 4IDYA 4R60A 5CDLA 1QXWA 1A16A 1QXYA 1XGNA 1PV9A 3PKBA 4MATA 1R5HA
chains in the Genus database with same CATH topology
2V3YA 1YW8A 3IG4A 2GG0A 4U6WA 4RGZ1 5JFRA 1W2MA 4IKUA 5D6FA 4FLLA 4IKSA 2ADUA 2GGBA 2HOWA 4PNCA 4ZWUA 4RZZA 2Q8KA 4A6VA 1QXZA 3FM3A 3IU8A 2BHDA 4B28A 2BB7A 4QR8A 1BOAA 3CB6A 4Z7MA 2BWYA 1N51A 2V3XA 5CE6A 2BWWA 2V6CA 4U6CA 1C24A 2OAZA 3PKAA 2BWXA 2P98A 2OKNA 2DFIA 4PV4A 2GU5A 1JAWA 2BWSA 3CB5A 1B59A 5CDEA 3FMQA 2BHBA 3L24A 2GA2A 2BHCA 4FLIA 4IU6A 4ZWOA 1WN1A 4HXXA 3IU7A 2ZSGA 2GTXA 2EA4A 1Y1NA 2B3HA 3BITA 4A6WA 2GG5A 3RVAA 3S6BA 1WL6A 2GG3A 1XNZA 1XGSA 5FCFA 4FO7A 4EGEA 4U69A 3Q6DA 4IPAA 5CNXA 2GG2A 1CHMA 1W7VA 3MX6A 2NQ7A 1QZYA 3IU9A 3PKCA 4U71A 3MATA 1MATA 3L7GA 5FCHA 4IF7A 5JHUA 2GU6A 4S00A 4ZNGA 5D6EA 2BN7A 3D27A 1XGOA 5JI6A 4U70A 4U1BA 1C23A 1WY2A 3CTZA 4KM3A 4JUQA 2G6PA 2MATA 1R5GA 4U76A 2BH3A 4FLJA 2Q96A 1KQ0A 2GU4A 2GU7A 2Q92A 3PKEA 4FLKA 4S2RP 3BIPA 4U75A 5CIKA 1XGMA 1YVMA 4IKTA 1WLRA 2EVOA 2GGCA 4ZWPA 4RZYA 4FUKA 1O0XA 2EVMA 4S01A 5CDVA 2EVCA 2GG8A 2Q95A 2GG9A 2P99A 4IECA 1M35A 3TAVA 2IW2A 2P9AA 2V3ZA 2BHAA 1WKMA 1KP0A 1R58A 1WL9A 2B3LA 4U6JA 2B3KA 4U6ZA 2Q94A 3TB5A 4U6EA 5E5BA 3FMRA 1B6AA 1BN5A 2NQ6A 5CLSA 2GZ5A 3PKDA 1C27A 1YW9A 1YJ3A 2EA2A 2Q93A 4IKRA 1KQ9A 4S2TP 3BIQA 4OOKA 2BWTA 1C22A 3MR1A 1C21A 3RORA 2GG7A 4FKCA 1YW7A 2BWUA 2BWVA 1WBQA 4FO8A 4U73A 4IDYA 4R60A 5CDLA 1QXWA 1A16A 1QXYA 1XGNA 1PV9A 3PKBA 4MATA 1R5HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V3Y A;  1YW8 A;  3IG4 A;  2GG0 A;  4U6W A;  4RGZ 1;  5JFR A;  1W2M A;  4IKU A;  5D6F A;  4FLL A;  4IKS A;  2ADU A;  2GGB A;  2HOW A;  4PNC A;  4ZWU A;  4RZZ A;  2Q8K A;  4A6V A;  1QXZ A;  3FM3 A;  3IU8 A;  2BHD A;  4B28 A;  2BB7 A;  4QR8 A;  1BOA A;  3CB6 A;  4Z7M A;  2BWY A;  1N51 A;  2V3X A;  5CE6 A;  2BWW A;  2V6C A;  4U6C A;  1C24 A;  2OAZ A;  3PKA A;  2BWX A;  2P98 A;  2OKN A;  2DFI A;  4PV4 A;  2GU5 A;  1JAW A;  2BWS A;  3CB5 A;  1B59 A;  5CDE A;  3FMQ A;  2BHB A;  3L24 A;  2GA2 A;  2BHC A;  4FLI A;  4IU6 A;  4ZWO A;  1WN1 A;  4HXX A;  3IU7 A;  2ZSG A;  2GTX A;  2EA4 A;  1Y1N A;  2B3H A;  3BIT A;  4A6W A;  2GG5 A;  3RVA A;  3S6B A;  1WL6 A;  2GG3 A;  1XNZ A;  1XGS A;  5FCF A;  4FO7 A;  4EGE A;  4U69 A;  3Q6D A;  4IPA A;  5CNX A;  2GG2 A;  1CHM A;  1W7V A;  3MX6 A;  2NQ7 A;  1QZY A;  3IU9 A;  3PKC A;  4U71 A;  3MAT A;  1MAT A;  3L7G A;  5FCH A;  4IF7 A;  5JHU A;  2GU6 A;  4S00 A;  4ZNG A;  5D6E A;  2BN7 A;  3D27 A;  1XGO A;  5JI6 A;  4U70 A;  4U1B A;  1C23 A;  1WY2 A;  3CTZ A;  4KM3 A;  4JUQ A;  2G6P A;  2MAT A;  1R5G A;  4U76 A;  2BH3 A;  4FLJ A;  2Q96 A;  1KQ0 A;  2GU4 A;  2GU7 A;  2Q92 A;  3PKE A;  4FLK A;  4S2R P;  3BIP A;  4U75 A;  5CIK A;  1XGM A;  1YVM A;  4IKT A;  1WLR A;  2EVO A;  2GGC A;  4ZWP A;  4RZY A;  4FUK A;  1O0X A;  2EVM A;  4S01 A;  5CDV A;  2EVC A;  2GG8 A;  2Q95 A;  2GG9 A;  2P99 A;  4IEC A;  1M35 A;  3TAV A;  2IW2 A;  2P9A A;  2V3Z A;  2BHA A;  1WKM A;  1KP0 A;  1R58 A;  1WL9 A;  2B3L A;  4U6J A;  2B3K A;  4U6Z A;  2Q94 A;  3TB5 A;  4U6E A;  5E5B A;  3FMR A;  1B6A A;  1BN5 A;  2NQ6 A;  5CLS A;  2GZ5 A;  3PKD A;  1C27 A;  1YW9 A;  1YJ3 A;  2EA2 A;  2Q93 A;  4IKR A;  1KQ9 A;  4S2T P;  3BIQ A;  4OOK A;  2BWT A;  1C22 A;  3MR1 A;  1C21 A;  3ROR A;  2GG7 A;  4FKC A;  1YW7 A;  2BWU A;  2BWV A;  1WBQ A;  4FO8 A;  4U73 A;  4IDY A;  4R60 A;  5CDL A;  1QXW A;  1A16 A;  1QXY A;  1XGN A;  1PV9 A;  3PKB A;  4MAT A;  1R5H A; 
#chains in the Genus database with same CATH topology
 2V3Y A;  1YW8 A;  3IG4 A;  2GG0 A;  4U6W A;  4RGZ 1;  5JFR A;  1W2M A;  4IKU A;  5D6F A;  4FLL A;  4IKS A;  2ADU A;  2GGB A;  2HOW A;  4PNC A;  4ZWU A;  4RZZ A;  2Q8K A;  4A6V A;  1QXZ A;  3FM3 A;  3IU8 A;  2BHD A;  4B28 A;  2BB7 A;  4QR8 A;  1BOA A;  3CB6 A;  4Z7M A;  2BWY A;  1N51 A;  2V3X A;  5CE6 A;  2BWW A;  2V6C A;  4U6C A;  1C24 A;  2OAZ A;  3PKA A;  2BWX A;  2P98 A;  2OKN A;  2DFI A;  4PV4 A;  2GU5 A;  1JAW A;  2BWS A;  3CB5 A;  1B59 A;  5CDE A;  3FMQ A;  2BHB A;  3L24 A;  2GA2 A;  2BHC A;  4FLI A;  4IU6 A;  4ZWO A;  1WN1 A;  4HXX A;  3IU7 A;  2ZSG A;  2GTX A;  2EA4 A;  1Y1N A;  2B3H A;  3BIT A;  4A6W A;  2GG5 A;  3RVA A;  3S6B A;  1WL6 A;  2GG3 A;  1XNZ A;  1XGS A;  5FCF A;  4FO7 A;  4EGE A;  4U69 A;  3Q6D A;  4IPA A;  5CNX A;  2GG2 A;  1CHM A;  1W7V A;  3MX6 A;  2NQ7 A;  1QZY A;  3IU9 A;  3PKC A;  4U71 A;  3MAT A;  1MAT A;  3L7G A;  5FCH A;  4IF7 A;  5JHU A;  2GU6 A;  4S00 A;  4ZNG A;  5D6E A;  2BN7 A;  3D27 A;  1XGO A;  5JI6 A;  4U70 A;  4U1B A;  1C23 A;  1WY2 A;  3CTZ A;  4KM3 A;  4JUQ A;  2G6P A;  2MAT A;  1R5G A;  4U76 A;  2BH3 A;  4FLJ A;  2Q96 A;  1KQ0 A;  2GU4 A;  2GU7 A;  2Q92 A;  3PKE A;  4FLK A;  4S2R P;  3BIP A;  4U75 A;  5CIK A;  1XGM A;  1YVM A;  4IKT A;  1WLR A;  2EVO A;  2GGC A;  4ZWP A;  4RZY A;  4FUK A;  1O0X A;  2EVM A;  4S01 A;  5CDV A;  2EVC A;  2GG8 A;  2Q95 A;  2GG9 A;  2P99 A;  4IEC A;  1M35 A;  3TAV A;  2IW2 A;  2P9A A;  2V3Z A;  2BHA A;  1WKM A;  1KP0 A;  1R58 A;  1WL9 A;  2B3L A;  4U6J A;  2B3K A;  4U6Z A;  2Q94 A;  3TB5 A;  4U6E A;  5E5B A;  3FMR A;  1B6A A;  1BN5 A;  2NQ6 A;  5CLS A;  2GZ5 A;  3PKD A;  1C27 A;  1YW9 A;  1YJ3 A;  2EA2 A;  2Q93 A;  4IKR A;  1KQ9 A;  4S2T P;  3BIQ A;  4OOK A;  2BWT A;  1C22 A;  3MR1 A;  1C21 A;  3ROR A;  2GG7 A;  4FKC A;  1YW7 A;  2BWU A;  2BWV A;  1WBQ A;  4FO8 A;  4U73 A;  4IDY A;  4R60 A;  5CDL A;  1QXW A;  1A16 A;  1QXY A;  1XGN A;  1PV9 A;  3PKB A;  4MAT A;  1R5H A; 
#chains in the Genus database with same CATH homology
 2V3Y A;  1YW8 A;  3IG4 A;  2GG0 A;  4U6W A;  4RGZ 1;  5JFR A;  1W2M A;  4IKU A;  5D6F A;  4FLL A;  4IKS A;  2ADU A;  2GGB A;  2HOW A;  4PNC A;  4ZWU A;  4RZZ A;  2Q8K A;  4A6V A;  1QXZ A;  3FM3 A;  3IU8 A;  2BHD A;  4B28 A;  2BB7 A;  4QR8 A;  1BOA A;  3CB6 A;  4Z7M A;  2BWY A;  1N51 A;  2V3X A;  5CE6 A;  2BWW A;  2V6C A;  4U6C A;  1C24 A;  2OAZ A;  3PKA A;  2BWX A;  2P98 A;  2OKN A;  2DFI A;  4PV4 A;  2GU5 A;  1JAW A;  2BWS A;  3CB5 A;  1B59 A;  5CDE A;  3FMQ A;  2BHB A;  3L24 A;  2GA2 A;  2BHC A;  4FLI A;  4IU6 A;  4ZWO A;  1WN1 A;  4HXX A;  3IU7 A;  2ZSG A;  2GTX A;  2EA4 A;  1Y1N A;  2B3H A;  3BIT A;  4A6W A;  2GG5 A;  3RVA A;  3S6B A;  1WL6 A;  2GG3 A;  1XNZ A;  1XGS A;  5FCF A;  4FO7 A;  4EGE A;  4U69 A;  3Q6D A;  4IPA A;  5CNX A;  2GG2 A;  1CHM A;  1W7V A;  3MX6 A;  2NQ7 A;  1QZY A;  3IU9 A;  3PKC A;  4U71 A;  3MAT A;  1MAT A;  3L7G A;  5FCH A;  4IF7 A;  5JHU A;  2GU6 A;  4S00 A;  4ZNG A;  5D6E A;  2BN7 A;  3D27 A;  1XGO A;  5JI6 A;  4U70 A;  4U1B A;  1C23 A;  1WY2 A;  3CTZ A;  4KM3 A;  4JUQ A;  2G6P A;  2MAT A;  1R5G A;  4U76 A;  2BH3 A;  4FLJ A;  2Q96 A;  1KQ0 A;  2GU4 A;  2GU7 A;  2Q92 A;  3PKE A;  4FLK A;  4S2R P;  3BIP A;  4U75 A;  5CIK A;  1XGM A;  1YVM A;  4IKT A;  1WLR A;  2EVO A;  2GGC A;  4ZWP A;  4RZY A;  4FUK A;  1O0X A;  2EVM A;  4S01 A;  5CDV A;  2EVC A;  2GG8 A;  2Q95 A;  2GG9 A;  2P99 A;  4IEC A;  1M35 A;  3TAV A;  2IW2 A;  2P9A A;  2V3Z A;  2BHA A;  1WKM A;  1KP0 A;  1R58 A;  1WL9 A;  2B3L A;  4U6J A;  2B3K A;  4U6Z A;  2Q94 A;  3TB5 A;  4U6E A;  5E5B A;  3FMR A;  1B6A A;  1BN5 A;  2NQ6 A;  5CLS A;  2GZ5 A;  3PKD A;  1C27 A;  1YW9 A;  1YJ3 A;  2EA2 A;  2Q93 A;  4IKR A;  1KQ9 A;  4S2T P;  3BIQ A;  4OOK A;  2BWT A;  1C22 A;  3MR1 A;  1C21 A;  3ROR A;  2GG7 A;  4FKC A;  1YW7 A;  2BWU A;  2BWV A;  1WBQ A;  4FO8 A;  4U73 A;  4IDY A;  4R60 A;  5CDL A;  1QXW A;  1A16 A;  1QXY A;  1XGN A;  1PV9 A;  3PKB A;  4MAT A;  1R5H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...