4J3CA

Crystal structure of 16s ribosomal rna methyltransferase rsme
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
Knots found
sequence length
239
structure length
232
Chain Sequence
MQRLFIENALHAGAKHEATREQFNVLRLGEGSSLLVFNGRDGEWRAEIAMPSRQAVLVAVEQTRPQPAPCDLVYLFAPLKVGRLDYLVQKAVEMGAGVLQPVMTQHVQGKIGSLERVRANVIEAAEQCGVLGIPAVEEPRKLEDLLIDWPRDRRIVFCDEGSQNPLPILEGIAERRLALLIGPEGGFSEAERDLLRSRDFVTAIPLGPRILRADTAAVAAMAVIQATLGDWR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of 16S ribosomal RNA methyltransferase RsmE
rcsb
source organism Sinorhizobium meliloti
molecule tags Transferase
molecule keywords Ribosomal RNA small subunit methyltransferase E
total genus 55
structure length 232
sequence length 239
chains with identical sequence B
other databases KnotProt 2.0: K +31
ec nomenclature ec 2.1.1.193: 16S rRNA (uracil(1498)-N(3))-methyltransferase.
pdb deposition date 2013-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04452 Methyltrans_RNA RNA methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.240.20 Mainly Beta Beta Barrel Ribosomal Protein L25; Chain P Hypothetical PUA domain-like; domain 1 4j3cA01
3.40.1280.10 Alpha Beta 3-Layer(aba) Sandwich Alpha/beta knot Alpha/beta knot 4j3cA02
3OIJA 5GM8A 3BBHA 4YQ6A 1V6ZA 4YQ4A 3ILKA 1GZ0A 4YPZA 4YVIA 2CX8A 1VHKA 3NK6A 4YQ3A 4MCCA 5CO4A 4KGNA 3KY7A 4YQJA 1NXZA 1MXIA 4MCDA 1NS5A 2QWVA 4YQTA 4YPWA 2HA8A 4X3LA 1P9PA 4YQCA 3AI9X 3OIIA 4PZKA 1UAKA 4RG1A 4CNGA 3NK7A 4JAKA 1ZJRA 2O3AA 4YVGA 5GMBA 3E5YA 4YQPA 4JALA 4YQLA 4YQ0A 1X7PA 2QMMA 4YQDA 4YQ1A 1VH0A 3IEFA 1J85A 4YQBA 3IC6A 3O7BA 4YQSA 3DCMX 5FAIA 3ONPA 4CNDA 4MCBA 4H3ZA 1UAMA 4L69A 2V3JA 4CNFA 1K3RA 3GYQA 4YQIA 4YQ5A 2YY8A 1IPAA 4YQRA 5D9FA 3QUVA 4YQKA 3L8UA 4FAKA 4YPYA 1TO0A 5GMCA 4YQ2A 4IG6A 4J3CA 4YQNA 4H3YA 4YQOA 4YQGA 4YVKA 1O6DA 1VHYA 2Z0YA 4XBOA 4YQ7A 1OY5A 3N4JA 1UALA 4YVJA 3KNUA 4E8BA 4YQ8A 2V3KA 2EGVA 1UAJA 4YPXA 1V2XA 4YQ9A 4YVHA 3AIAA 4KDZA 4X3MA 1X7OA 4YQQA 3N4KA 4CNEA 4YQAA 3OINA 3KW2A 3BBDA 3BBEA 3AXZA 2EGWA 2I6DA 1Z85A 2NWAA 3KTYA
chains in the Genus database with same CATH superfamily
3OIJA 1FEUA 5GM8A 4JWHA 3BBHA 4YQ6A 1V6ZA 4YQ4A 3ILKA 1GZ0A 4P2BA 4YPZA 4YVIA 2CX8A 2AE0X 1VHKA 3PIPS 3J7ZV 3NK6A 4YQ3A 4MCCA 5CO4A 4KGNA 3KY7A 4WFAS 4YQJA 1NXZA 1MXIA 1O0BA 1NS5A 4MCDA 3CF5S 2QWVA 5BNZA 4WCES 5GAHW 4YQTA 4YPWA 2HA8A 2RE8A 4X3LA 1P9PA 2GAEA 4FMWA 4YQCA 3AI9X 3OIIA 4PZKA 1UAKA 2ZJQS 4RG1A 4CNGA 3NK7A 4JAKA 1ZJRA 2O3AA 4YVGA 5GMBA 3E5YA 4UY88 4YQPA 4JALA 1QRTA 4YQLA 5JVHS 4JWFA 1EUQA 2HZ7A 4YQ0A 3AIIA 2G6GA 1X7PA 2PI8A 2QMMA 4JWJA 5GAEW 4WFNS 1B75A 4YQDA 4YQ1A 2RD2A 1VH0A 3IEFA 1J85A 4YQBA 3IC6A 3O7BA 4H3SA 4IOAS 4JYZA 4YQSA 3DCMX 5FAIA 3ONPA 4V194 4CNDA 4MCBA 1QRUA 4H3ZA 1UAMA 3W2VB 1DFUP 2G5DA 4L69A 2V3JA 4CNFA 1K3RA 4JWGA 3GYQA 4YQIA 3W2WB 4YQ5A 2YY8A 4U67S 1IPAA 4YQRA 5D9FA 3QUVA 4WF9S 4YQKA 5HL7S 4IO9S 3L8UA 4FAKA 4YPYA 1TO0A 5GMCA 4YQ2A 4IG6A 2ZJPS 4J3CA 2ZJRS 4YQNA 4H3YA 5GAGW 4YQOA 1QTQA 4WFBS 4YQGA 4YVKA 1O0CA 1O6DA 1VHYA 2Z0YA 5JVGS 4XBOA 3X1LB 4YQ7A 5DM6S 1OY5A 3N4JA 1ZJWA 4H4KA 5IZNA 1UALA 4YVJA 3KNUA 4E8BA 4YQ8A 1GTRA 3PIOS 1EXDA 2V3KA 2EGVA 1UAJA 4YPXA 1QRSA 1V2XA 4YQ9A 5GADW 1NYLA 4YVHA 1UDXA 3AIAA 4JXZA 4KDZA 1GTSA 1D6KA 1X7OA 4X3MA 4YQQA 3N4KA 4CNEA 4YQAA 2PICA 1EUYA 3OINA 3KW2A 3BBDA 3BBEA 3AXZA 4IOCS 2EGWA 5DM7S 2I6DA 1Z85A 2NWAA 3DLLS 2PJJA 4JXXA 3CZBA 2PNWA 3KTYA
chains in the Genus database with same CATH topology
3OIJA 5GM8A 4JWHA 3BBHA 4YQ6A 1V6ZA 4YQ4A 3ILKA 1GZ0A 4YPZA 4YVIA 2CX8A 1VHKA 3NK6A 4YQ3A 4MCCA 5CO4A 4KGNA 3KY7A 4YQJA 1NXZA 1MXIA 4MCDA 1NS5A 2QWVA 4YQTA 4YPWA 2HA8A 4X3LA 1P9PA 4FMWA 4YQCA 3AI9X 3OIIA 4PZKA 1UAKA 4RG1A 4CNGA 3NK7A 4JAKA 1ZJRA 2O3AA 4YVGA 5GMBA 3E5YA 4YQPA 4JALA 4YQLA 4JWFA 4YQ0A 1X7PA 4JWJA 2QMMA 4YQDA 4YQ1A 1VH0A 3IEFA 1J85A 4YQBA 3IC6A 3O7BA 4YQSA 3DCMX 5FAIA 3ONPA 4CNDA 4MCBA 4H3ZA 1UAMA 4L69A 2V3JA 4CNFA 1K3RA 4JWGA 3GYQA 4YQIA 4YQ5A 2YY8A 1IPAA 4YQRA 5D9FA 3QUVA 4YQKA 3L8UA 4FAKA 4YPYA 1TO0A 5GMCA 4YQ2A 4IG6A 4J3CA 4YQNA 4H3YA 4YQOA 4YQGA 4YVKA 1O6DA 1VHYA 2Z0YA 4XBOA 4YQ7A 1OY5A 3N4JA 1UALA 4YVJA 3KNUA 4E8BA 4YQ8A 2V3KA 2EGVA 1UAJA 4YPXA 1V2XA 4YQ9A 4YVHA 3AIAA 4KDZA 4X3MA 1X7OA 4YQQA 3N4KA 4CNEA 4YQAA 3OINA 3KW2A 3BBDA 3BBEA 3AXZA 2EGWA 2I6DA 1Z85A 2NWAA 3KTYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OIJ A;  5GM8 A;  3BBH A;  4YQ6 A;  1V6Z A;  4YQ4 A;  3ILK A;  1GZ0 A;  4YPZ A;  4YVI A;  2CX8 A;  1VHK A;  3NK6 A;  4YQ3 A;  4MCC A;  5CO4 A;  4KGN A;  3KY7 A;  4YQJ A;  1NXZ A;  1MXI A;  4MCD A;  1NS5 A;  2QWV A;  4YQT A;  4YPW A;  2HA8 A;  4X3L A;  1P9P A;  4YQC A;  3AI9 X;  3OII A;  4PZK A;  1UAK A;  4RG1 A;  4CNG A;  3NK7 A;  4JAK A;  1ZJR A;  2O3A A;  4YVG A;  5GMB A;  3E5Y A;  4YQP A;  4JAL A;  4YQL A;  4YQ0 A;  1X7P A;  2QMM A;  4YQD A;  4YQ1 A;  1VH0 A;  3IEF A;  1J85 A;  4YQB A;  3IC6 A;  3O7B A;  4YQS A;  3DCM X;  5FAI A;  3ONP A;  4CND A;  4MCB A;  4H3Z A;  1UAM A;  4L69 A;  2V3J A;  4CNF A;  1K3R A;  3GYQ A;  4YQI A;  4YQ5 A;  2YY8 A;  1IPA A;  4YQR A;  5D9F A;  3QUV A;  4YQK A;  3L8U A;  4FAK A;  4YPY A;  1TO0 A;  5GMC A;  4YQ2 A;  4IG6 A;  4J3C A;  4YQN A;  4H3Y A;  4YQO A;  4YQG A;  4YVK A;  1O6D A;  1VHY A;  2Z0Y A;  4XBO A;  4YQ7 A;  1OY5 A;  3N4J A;  1UAL A;  4YVJ A;  3KNU A;  4E8B A;  4YQ8 A;  2V3K A;  2EGV A;  1UAJ A;  4YPX A;  1V2X A;  4YQ9 A;  4YVH A;  3AIA A;  4KDZ A;  4X3M A;  1X7O A;  4YQQ A;  3N4K A;  4CNE A;  4YQA A;  3OIN A;  3KW2 A;  3BBD A;  3BBE A;  3AXZ A;  2EGW A;  2I6D A;  1Z85 A;  2NWA A;  3KTY A; 
#chains in the Genus database with same CATH topology
 3OIJ A;  1FEU A;  5GM8 A;  4JWH A;  3BBH A;  4YQ6 A;  1V6Z A;  4YQ4 A;  3ILK A;  1GZ0 A;  4P2B A;  4YPZ A;  4YVI A;  2CX8 A;  2AE0 X;  1VHK A;  3PIP S;  3J7Z V;  3NK6 A;  4YQ3 A;  4MCC A;  5CO4 A;  4KGN A;  3KY7 A;  4WFA S;  4YQJ A;  1NXZ A;  1MXI A;  1O0B A;  1NS5 A;  4MCD A;  3CF5 S;  2QWV A;  5BNZ A;  4WCE S;  5GAH W;  4YQT A;  4YPW A;  2HA8 A;  2RE8 A;  4X3L A;  1P9P A;  2GAE A;  4FMW A;  4YQC A;  3AI9 X;  3OII A;  4PZK A;  1UAK A;  2ZJQ S;  4RG1 A;  4CNG A;  3NK7 A;  4JAK A;  1ZJR A;  2O3A A;  4YVG A;  5GMB A;  3E5Y A;  4UY8 8;  4YQP A;  4JAL A;  1QRT A;  4YQL A;  5JVH S;  4JWF A;  1EUQ A;  2HZ7 A;  4YQ0 A;  3AII A;  2G6G A;  1X7P A;  2PI8 A;  2QMM A;  4JWJ A;  5GAE W;  4WFN S;  1B75 A;  4YQD A;  4YQ1 A;  2RD2 A;  1VH0 A;  3IEF A;  1J85 A;  4YQB A;  3IC6 A;  3O7B A;  4H3S A;  4IOA S;  4JYZ A;  4YQS A;  3DCM X;  5FAI A;  3ONP A;  4V19 4;  4CND A;  4MCB A;  1QRU A;  4H3Z A;  1UAM A;  3W2V B;  1DFU P;  2G5D A;  4L69 A;  2V3J A;  4CNF A;  1K3R A;  4JWG A;  3GYQ A;  4YQI A;  3W2W B;  4YQ5 A;  2YY8 A;  4U67 S;  1IPA A;  4YQR A;  5D9F A;  3QUV A;  4WF9 S;  4YQK A;  5HL7 S;  4IO9 S;  3L8U A;  4FAK A;  4YPY A;  1TO0 A;  5GMC A;  4YQ2 A;  4IG6 A;  2ZJP S;  4J3C A;  2ZJR S;  4YQN A;  4H3Y A;  5GAG W;  4YQO A;  1QTQ A;  4WFB S;  4YQG A;  4YVK A;  1O0C A;  1O6D A;  1VHY A;  2Z0Y A;  5JVG S;  4XBO A;  3X1L B;  4YQ7 A;  5DM6 S;  1OY5 A;  3N4J A;  1ZJW A;  4H4K A;  5IZN A;  1UAL A;  4YVJ A;  3KNU A;  4E8B A;  4YQ8 A;  1GTR A;  3PIO S;  1EXD A;  2V3K A;  2EGV A;  1UAJ A;  4YPX A;  1QRS A;  1V2X A;  4YQ9 A;  5GAD W;  1NYL A;  4YVH A;  1UDX A;  3AIA A;  4JXZ A;  4KDZ A;  1GTS A;  1D6K A;  1X7O A;  4X3M A;  4YQQ A;  3N4K A;  4CNE A;  4YQA A;  2PIC A;  1EUY A;  3OIN A;  3KW2 A;  3BBD A;  3BBE A;  3AXZ A;  4IOC S;  2EGW A;  5DM7 S;  2I6D A;  1Z85 A;  2NWA A;  3DLL S;  2PJJ A;  4JXX A;  3CZB A;  2PNW A;  3KTY A; 
#chains in the Genus database with same CATH homology
 3OIJ A;  5GM8 A;  4JWH A;  3BBH A;  4YQ6 A;  1V6Z A;  4YQ4 A;  3ILK A;  1GZ0 A;  4YPZ A;  4YVI A;  2CX8 A;  1VHK A;  3NK6 A;  4YQ3 A;  4MCC A;  5CO4 A;  4KGN A;  3KY7 A;  4YQJ A;  1NXZ A;  1MXI A;  4MCD A;  1NS5 A;  2QWV A;  4YQT A;  4YPW A;  2HA8 A;  4X3L A;  1P9P A;  4FMW A;  4YQC A;  3AI9 X;  3OII A;  4PZK A;  1UAK A;  4RG1 A;  4CNG A;  3NK7 A;  4JAK A;  1ZJR A;  2O3A A;  4YVG A;  5GMB A;  3E5Y A;  4YQP A;  4JAL A;  4YQL A;  4JWF A;  4YQ0 A;  1X7P A;  4JWJ A;  2QMM A;  4YQD A;  4YQ1 A;  1VH0 A;  3IEF A;  1J85 A;  4YQB A;  3IC6 A;  3O7B A;  4YQS A;  3DCM X;  5FAI A;  3ONP A;  4CND A;  4MCB A;  4H3Z A;  1UAM A;  4L69 A;  2V3J A;  4CNF A;  1K3R A;  4JWG A;  3GYQ A;  4YQI A;  4YQ5 A;  2YY8 A;  1IPA A;  4YQR A;  5D9F A;  3QUV A;  4YQK A;  3L8U A;  4FAK A;  4YPY A;  1TO0 A;  5GMC A;  4YQ2 A;  4IG6 A;  4J3C A;  4YQN A;  4H3Y A;  4YQO A;  4YQG A;  4YVK A;  1O6D A;  1VHY A;  2Z0Y A;  4XBO A;  4YQ7 A;  1OY5 A;  3N4J A;  1UAL A;  4YVJ A;  3KNU A;  4E8B A;  4YQ8 A;  2V3K A;  2EGV A;  1UAJ A;  4YPX A;  1V2X A;  4YQ9 A;  4YVH A;  3AIA A;  4KDZ A;  4X3M A;  1X7O A;  4YQQ A;  3N4K A;  4CNE A;  4YQA A;  3OIN A;  3KW2 A;  3BBD A;  3BBE A;  3AXZ A;  2EGW A;  2I6D A;  1Z85 A;  2NWA A;  3KTY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...