4JL3A

Crystal structure of ms6564-dna complex
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
179
structure length
179
Chain Sequence
b'SEKSRVAIVEATRALLLERGFDGLSIEAVAAKAGVGKQTIYRWWPSRHALVADVLLEDADKILARMPKTDDVTADLASWAGTLAAALTTRRGHAMLKTLMAASLEHEDTAARLREGFSRPLIESVRDRLRDEDIDADHAQAAADALLGAVVNAVLSEGRSYSRQRAETSARIIVAGLRP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator, TetR family
publication title Structural basis for interaction between M. smegmatis Ms6564, a TetR family master regulator, and its target DNA.
rcsb
source organism Mycobacterium smegmatis
molecule tags Transcription/dna
total genus 62
structure length 179
sequence length 179
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF16859 TetR_C_11 Tetracyclin repressor-like, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 4jl3A00
4DW6A 3Q3SA 5FKNA 2O7OA 5J3LA 2PBXA 3VP5A 2RASA 4W1UA 2ZCXA 2DTZA 3GZIA 5EZGA 3FIWA 2X6OA 3NRGA 4PXIA 2YVHA 3HTIA 3PASA 2XDNA 3VVYA 2Q24A 3LSPA 4JL3A 1BJZA 3Q0VA 4V2FA 3QBMA 4D7NA 2XPVA 5F0HA 4D5FA 2XPWA 4AC6A 3BR0A 4GFLA 3T6NA 3CWRA 4MK6A 2WV1A 5FKOA 2V57A 2GENA 3V78A 3KNWA 2RAEA 2UXHA 2RHAA 1Z77A 3VW0A 1UI5A 2XGCA 3ANGA 3BJBA 4M3FA 1ZK8A 2OF7A 3F0CA 1JUMA 2ZCNA 5DAJA 1T33A 2TCTA 3HTJA 4I6ZA 3ZQIA 2QOPA 3BCGA 3PPBA 1U9NA 4ACIA 1RPWA 2ZOZA 2HYJA 3BQYA 3EGQA 2IU5A 2WGBA 2NS8A 2ZOYA 5FKKA 3C07A 2XPUA 3MVPA 5FHPA 2OPTA 3KZ9A 3NI7A 1RKWA 2GFNA 5HBUA 1JTYA 5GPCA 2PZ9A 3DPJA 5F0FA 3HTAA 3HGYA 1JTXA 2W53A 3BR2A 2JJ7A 2Y30A 2QCOA 3LSRA 3DCFA 4X1EA 3BHQA 3QKXA 1UI6A 3BTCA 3WHBA 5HSZA 3BR3A 3VIBA 2ID6A 4AC0A 5GPAA 4NN1A 3VW1A 5FGLA 2HKUA 2G7SA 3AQTA 2UXUA 2ZB9A 5CXIA 2XB5A 5IP6A 4JNNA 3BQZA 3VPRA 2OI8A 2FBQA 4ME9A 3CDLA 1U9OA 3VOKA 3BR6A 5K7ZA 2NP5A 2DG8A 1QVTA 3CRJA 3VW2A 2D6YA 4GFKA 3G1MA 3MNLA 2ZCMA 2VPRA 5CW8A 1ZKGA 5FKLA 2XGEA 2Y31A 4AF5A 3FK7A 3BTLA 4ABZA 3ON2A 2IBDA 3EUPA 3G1LA 3DEWA 5CXGA 3IH2A 5C4YA 3B6CA 2Y2ZA 4NELA 2G7GA 2HXIA 3AQSA 4GCLA 3KKDA 3VOXA 5IOYA 2XGDA 3LOCA 2G0EA 5D19A 3FK6A 4MXMA 1RKTA 3VUQA 3HGGA 4UDSA 3BT9A 2UXIA 5K58A 5D1RA 1A6IA 2QIBA 3E7QA 2UXPA 2FD5A 3KKCA 5F0CA 2IAIA 3CCYA 5J1RA 4JKZA 2NX4A 2HYTA 2REKA 5J1UA 3P9TA 4G12A 3CJDA 4M3GA 2EH3A 4XK4A 3HTHA 2ID3A 4V2GA 4I76A 5IOZA 3BRUA 3ANPA 3QQAA 5FMPA 3S5RA 4JYKA 3VVXA 3BR1A 3Q0WA 3G7RA 5H9TA 2JK3A 5IPAA 2QKOA 3GEUA 5HAWA 1QVUA 3SDGA 2HQ5A 5EYRA 3HE0A 2NP3A 3B6AA 4GCKA 3QPSA 2G7LA 1JT6A 5F08A 3QPLA 2GBYA 3IUVA 4MO7A 2YVEA 4ICHA 1JUSA 5J1YA 3ON4A 2X9DA 4D5CA 4KWAA 3LWJA 3B81A 4B1RA 2QTQA 2FQ4A 3RH2A 4L62A 4M3BA 5F27A 2I10A 2UXOA 3FRQA 3Q0UA 3TP0A 4M3EA 2O7TA 1JUPA 4CGRA 3ZQLA 3TP3A 3HIMA 3JSJA 2NS7A 3BTJA 2XRLA 3C2BA 2DG7A 3ZQHA 1ORKA 2WUIA 2FX0A 3BTIA 3LJLA 5F1JA 4YZEA 3NNRA 5EZHA 3ZQFA 4B3AA 3BR5A 5FKMA 4AUXA 3NPIA 3IH3A 3IH4A 4W97A 3G56A 5EFYA 3PM1A 2HXOA 2VKVA 1SGMA 5K7HA 3BNIA 2IEKA 4D7MA 3COLA 2VKEA 3ZQGA 4HKUA 2QWTA 3VVZA 3LSJA 3O8HA 2F07A 2OERA 3SFIA 2GUHA 1T56A 5F04A 5GP9A 3RD3A 3WHCA 3NXCA 1JT0A 1QPIA 2TRTA 3G1OA 2G3BA 3O60A 3O8GA 5D18A 4M3DA 5K7FA 3LHQA 5AQCA 3V6GA 4GCTA 1Z0XA 3F1BA 2FJ1A 1VI0A
chains in the Genus database with same CATH superfamily
4DW6A 3Q3SA 4U9NA 5FKNA 2O7OA 5J3LA 2PBXA 3VP5A 4U9LA 2RASA 4W1UA 2ZCXA 2DTZA 3GZIA 5EZGA 3FIWA 2X6OA 3NRGA 4PXIA 2YVHA 3HTIA 3PASA 2XDNA 3VVYA 2Q24A 3LSPA 4JL3A 1BJZA 3Q0VA 4V2FA 3QBMA 4D7NA 2XPVA 5F0HA 4D5FA 2XPWA 4AC6A 3BR0A 4GFLA 3T6NA 3CWRA 4MK6A 2WV1A 4C2MA 5FKOA 2V57A 2GENA 2R7UA 3V78A 3KNWA 2RAEA 2UXHA 2RHAA 1Z77A 2R7QA 1UI5A 3VW0A 2XGCA 3ANGA 3BJBA 4M3FA 1ZK8A 2OF7A 3F0CA 1JUMA 2ZCNA 5DAJA 1T33A 2TCTA 3HTJA 4I6ZA 3ZQIA 2QOPA 3BCGA 3PPBA 1U9NA 4ACIA 1RPWA 2ZOZA 2HYJA 3BQYA 3EGQA 2IU5A 5CQGA 2WGBA 2NS8A 2ZOYA 5FKKA 3C07A 2XPUA 3MVPA 5FHPA 2OPTA 3KZ9A 3NI7A 1RKWA 2GFNA 5HBUA 1JTYA 5GPCA 2PZ9A 3DPJA 5F0FA 3HTAA 3HGYA 1JTXA 2W53A 3BR2A 2JJ7A 2Y30A 2QCOA 3LSRA 3DCFA 2R7OA 4X1EA 3BHQA 3QKXA 1UI6A 4IRVA 3BTCA 3WHBA 5HSZA 3BR3A 3VIBA 2ID6A 4AC0A 5GPAA 4NN1A 3VW1A 5FGLA 2HKUA 2PFVA 2G7SA 3AQTA 2UXUA 2ZB9A 5CXIA 2XB5A 3FHNA 5IP6A 4JNNA 3BQZA 2ZY9A 3VPRA 2OI8A 2FBQA 4ME9A 3CDLA 1U9OA 3VOKA 3BR6A 5K7ZA 2NP5A 2DG8A 1QVTA 3CRJA 3VW2A 2D6YA 4GFKA 3G1MA 3MNLA 3K8PC 2ZCMA 2VPRA 5CW8A 1ZKGA 5FKLA 2XGEA 2Y31A 4AF5A 3FK7A 3BTLA 4ABZA 3ON2A 2IBDA 3EUPA 3G1LA 3DEWA 5CXGA 3IH2A 5C4YA 3B6CA 2Y2ZA 4NELA 2G7GA 2HXIA 3NS4A 3AQSA 4GCLA 3KKDA 3VOXA 5IOYA 2XGDA 3LOCA 2G0EA 5D19A 3FK6A 4MXMA 1RKTA 3VUQA 3HGGA 2YVXA 4UDSA 2R7VA 3BT9A 2UXIA 5K58A 5D1RA 1A6IA 2B1EA 2QIBA 3E7QA 2UXPA 2FD5A 3KKCA 5F0CA 2IAIA 3CCYA 5J1RA 4JKZA 2R7TA 2NX4A 2HYTA 2REKA 5J1UA 3P9TA 4G12A 3CJDA 4M3GA 2EH3A 4XK4A 3HTHA 2ID3A 4OD4A 2B3WA 4V2GA 4I76A 5IOZA 3BRUA 3ANPA 3QQAA 5FMPA 3S5RA 4JYKA 3VVXA 3BR1A 3Q0WA 3VTIA 3G7RA 5H9TA 2JK3A 5IPAA 2QKOA 3GEUA 5HAWA 1QVUA 3SDGA 2HQ5A 5EYRA 3HE0A 2NP3A 3B6AA 4GCKA 3QPSA 2G7LA 1JT6A 5F08A 3QPLA 2GBYA 3IUVA 4MO7A 2YVEA 4ICHA 1JUSA 5J1YA 4WIBA 3ON4A 2X9DA 4D5CA 4KWAA 3LWJA 2FJI1 3B81A 4B1RA 2QTQA 2FQ4A 3RH2A 4L62A 4M3BA 4OD5A 2A2FX 5F27A 2I10A 2UXOA 3DU6A 3FRQA 3Q0UA 3TP0A 2R7SA 4M3EA 2O7TA 1JUPA 4CGRA 3ZQLA 3TP3A 3HIMA 3JSJA 2NS7A 3BTJA 2XRLA 3C2BA 3DU5A 2DG7A 3ZQHA 1ORKA 2WUIA 2FX0A 3BTIA 2R7RA 3LJLA 5F1JA 4YZEA 3KYLA 3NNRA 5EZHA 3ZQFA 4B3AA 3BR5A 5FKMA 4AUXA 3NPIA 3IH3A 3IH4A 4W97A 3G56A 5EFYA 3PM1A 2HXOA 2VKVA 1SGMA 5K7HA 3BNIA 2IEKA 4D7MA 3COLA 2VKEA 3ZQGA 4HKUA 2QWTA 3VVZA 3LSJA 3O8HA 2F07A 2OERA 3SWHA 3SFIA 2GUHA 1T56A 5F04A 5GP9A 3RD3A 3WHCA 3NXCA 4DVYP 1JT0A 1QPIA 2TRTA 3G1OA 2G3BA 3O60A 2R7WA 3O8GA 5D18A 4M3DA 5K7FA 3LHQA 5AQCA 3V6GA 4GCTA 1Z0XA 3F1BA 2FJ1A 1VI0A 2R7XA
chains in the Genus database with same CATH topology
4DW6A 3Q3SA 5FKNA 2O7OA 5J3LA 2PBXA 3VP5A 2RASA 4W1UA 2ZCXA 2DTZA 3GZIA 5EZGA 3FIWA 2X6OA 3NRGA 4PXIA 2YVHA 3HTIA 3PASA 2XDNA 3VVYA 2Q24A 3LSPA 4JL3A 1BJZA 3Q0VA 4V2FA 3QBMA 4D7NA 2XPVA 5F0HA 4D5FA 2XPWA 4AC6A 3BR0A 4GFLA 3T6NA 3CWRA 4MK6A 2WV1A 5FKOA 2V57A 2GENA 3V78A 3KNWA 2RAEA 2UXHA 2RHAA 1Z77A 3VW0A 1UI5A 2XGCA 3ANGA 3BJBA 4M3FA 1ZK8A 2OF7A 3F0CA 1JUMA 2ZCNA 5DAJA 1T33A 2TCTA 3HTJA 4I6ZA 3ZQIA 2QOPA 3BCGA 3PPBA 1U9NA 4ACIA 1RPWA 2ZOZA 2HYJA 3BQYA 3EGQA 2IU5A 2WGBA 2NS8A 2ZOYA 5FKKA 3C07A 2XPUA 3MVPA 5FHPA 2OPTA 3KZ9A 3NI7A 1RKWA 2GFNA 5HBUA 1JTYA 5GPCA 2PZ9A 3DPJA 5F0FA 3HTAA 3HGYA 1JTXA 2W53A 3BR2A 2JJ7A 2Y30A 2QCOA 3LSRA 3DCFA 4X1EA 3BHQA 3QKXA 1UI6A 3BTCA 3WHBA 5HSZA 3BR3A 3VIBA 2ID6A 4AC0A 5GPAA 4NN1A 3VW1A 5FGLA 2HKUA 2G7SA 3AQTA 2UXUA 2ZB9A 5CXIA 2XB5A 5IP6A 4JNNA 3BQZA 3VPRA 2OI8A 2FBQA 4ME9A 3CDLA 1U9OA 3VOKA 3BR6A 5K7ZA 2NP5A 2DG8A 1QVTA 3CRJA 3VW2A 2D6YA 4GFKA 3G1MA 3MNLA 2ZCMA 2VPRA 5CW8A 1ZKGA 5FKLA 2XGEA 2Y31A 4AF5A 3FK7A 3BTLA 4ABZA 3ON2A 2IBDA 3EUPA 3G1LA 3DEWA 5CXGA 3IH2A 5C4YA 3B6CA 2Y2ZA 4NELA 2G7GA 2HXIA 3AQSA 4GCLA 3KKDA 3VOXA 5IOYA 2XGDA 3LOCA 2G0EA 5D19A 3FK6A 4MXMA 1RKTA 3VUQA 3HGGA 4UDSA 3BT9A 2UXIA 5K58A 5D1RA 1A6IA 2QIBA 3E7QA 2UXPA 2FD5A 3KKCA 5F0CA 2IAIA 3CCYA 5J1RA 4JKZA 2NX4A 2HYTA 2REKA 5J1UA 3P9TA 4G12A 3CJDA 4M3GA 2EH3A 4XK4A 3HTHA 2ID3A 4V2GA 4I76A 5IOZA 3BRUA 3ANPA 3QQAA 5FMPA 3S5RA 4JYKA 3VVXA 3BR1A 3Q0WA 3G7RA 5H9TA 2JK3A 5IPAA 2QKOA 3GEUA 5HAWA 1QVUA 3SDGA 2HQ5A 5EYRA 3HE0A 2NP3A 3B6AA 4GCKA 3QPSA 2G7LA 1JT6A 5F08A 3QPLA 2GBYA 3IUVA 4MO7A 2YVEA 4ICHA 1JUSA 5J1YA 3ON4A 2X9DA 4D5CA 4KWAA 3LWJA 3B81A 4B1RA 2QTQA 2FQ4A 3RH2A 4L62A 4M3BA 5F27A 2I10A 2UXOA 3FRQA 3Q0UA 3TP0A 4M3EA 2O7TA 1JUPA 4CGRA 3ZQLA 3TP3A 3HIMA 3JSJA 2NS7A 3BTJA 2XRLA 3C2BA 2DG7A 3ZQHA 1ORKA 2WUIA 2FX0A 3BTIA 3LJLA 5F1JA 4YZEA 3NNRA 5EZHA 3ZQFA 4B3AA 3BR5A 5FKMA 4AUXA 3NPIA 3IH3A 3IH4A 4W97A 3G56A 5EFYA 3PM1A 2HXOA 2VKVA 1SGMA 5K7HA 3BNIA 2IEKA 4D7MA 3COLA 2VKEA 3ZQGA 4HKUA 2QWTA 3VVZA 3LSJA 3O8HA 2F07A 2OERA 3SFIA 2GUHA 1T56A 5F04A 5GP9A 3RD3A 3WHCA 3NXCA 1JT0A 1QPIA 2TRTA 3G1OA 2G3BA 3O60A 3O8GA 5D18A 4M3DA 5K7FA 3LHQA 5AQCA 3V6GA 4GCTA 1Z0XA 3F1BA 2FJ1A 1VI0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DW6 A;  3Q3S A;  5FKN A;  2O7O A;  5J3L A;  2PBX A;  3VP5 A;  2RAS A;  4W1U A;  2ZCX A;  2DTZ A;  3GZI A;  5EZG A;  3FIW A;  2X6O A;  3NRG A;  4PXI A;  2YVH A;  3HTI A;  3PAS A;  2XDN A;  3VVY A;  2Q24 A;  3LSP A;  4JL3 A;  1BJZ A;  3Q0V A;  4V2F A;  3QBM A;  4D7N A;  2XPV A;  5F0H A;  4D5F A;  2XPW A;  4AC6 A;  3BR0 A;  4GFL A;  3T6N A;  3CWR A;  4MK6 A;  2WV1 A;  5FKO A;  2V57 A;  2GEN A;  3V78 A;  3KNW A;  2RAE A;  2UXH A;  2RHA A;  1Z77 A;  3VW0 A;  1UI5 A;  2XGC A;  3ANG A;  3BJB A;  4M3F A;  1ZK8 A;  2OF7 A;  3F0C A;  1JUM A;  2ZCN A;  5DAJ A;  1T33 A;  2TCT A;  3HTJ A;  4I6Z A;  3ZQI A;  2QOP A;  3BCG A;  3PPB A;  1U9N A;  4ACI A;  1RPW A;  2ZOZ A;  2HYJ A;  3BQY A;  3EGQ A;  2IU5 A;  2WGB A;  2NS8 A;  2ZOY A;  5FKK A;  3C07 A;  2XPU A;  3MVP A;  5FHP A;  2OPT A;  3KZ9 A;  3NI7 A;  1RKW A;  2GFN A;  5HBU A;  1JTY A;  5GPC A;  2PZ9 A;  3DPJ A;  5F0F A;  3HTA A;  3HGY A;  1JTX A;  2W53 A;  3BR2 A;  2JJ7 A;  2Y30 A;  2QCO A;  3LSR A;  3DCF A;  4X1E A;  3BHQ A;  3QKX A;  1UI6 A;  3BTC A;  3WHB A;  5HSZ A;  3BR3 A;  3VIB A;  2ID6 A;  4AC0 A;  5GPA A;  4NN1 A;  3VW1 A;  5FGL A;  2HKU A;  2G7S A;  3AQT A;  2UXU A;  2ZB9 A;  5CXI A;  2XB5 A;  5IP6 A;  4JNN A;  3BQZ A;  3VPR A;  2OI8 A;  2FBQ A;  4ME9 A;  3CDL A;  1U9O A;  3VOK A;  3BR6 A;  5K7Z A;  2NP5 A;  2DG8 A;  1QVT A;  3CRJ A;  3VW2 A;  2D6Y A;  4GFK A;  3G1M A;  3MNL A;  2ZCM A;  2VPR A;  5CW8 A;  1ZKG A;  5FKL A;  2XGE A;  2Y31 A;  4AF5 A;  3FK7 A;  3BTL A;  4ABZ A;  3ON2 A;  2IBD A;  3EUP A;  3G1L A;  3DEW A;  5CXG A;  3IH2 A;  5C4Y A;  3B6C A;  2Y2Z A;  4NEL A;  2G7G A;  2HXI A;  3AQS A;  4GCL A;  3KKD A;  3VOX A;  5IOY A;  2XGD A;  3LOC A;  2G0E A;  5D19 A;  3FK6 A;  4MXM A;  1RKT A;  3VUQ A;  3HGG A;  4UDS A;  3BT9 A;  2UXI A;  5K58 A;  5D1R A;  1A6I A;  2QIB A;  3E7Q A;  2UXP A;  2FD5 A;  3KKC A;  5F0C A;  2IAI A;  3CCY A;  5J1R A;  4JKZ A;  2NX4 A;  2HYT A;  2REK A;  5J1U A;  3P9T A;  4G12 A;  3CJD A;  4M3G A;  2EH3 A;  4XK4 A;  3HTH A;  2ID3 A;  4V2G A;  4I76 A;  5IOZ A;  3BRU A;  3ANP A;  3QQA A;  5FMP A;  3S5R A;  4JYK A;  3VVX A;  3BR1 A;  3Q0W A;  3G7R A;  5H9T A;  2JK3 A;  5IPA A;  2QKO A;  3GEU A;  5HAW A;  1QVU A;  3SDG A;  2HQ5 A;  5EYR A;  3HE0 A;  2NP3 A;  3B6A A;  4GCK A;  3QPS A;  2G7L A;  1JT6 A;  5F08 A;  3QPL A;  2GBY A;  3IUV A;  4MO7 A;  2YVE A;  4ICH A;  1JUS A;  5J1Y A;  3ON4 A;  2X9D A;  4D5C A;  4KWA A;  3LWJ A;  3B81 A;  4B1R A;  2QTQ A;  2FQ4 A;  3RH2 A;  4L62 A;  4M3B A;  5F27 A;  2I10 A;  2UXO A;  3FRQ A;  3Q0U A;  3TP0 A;  4M3E A;  2O7T A;  1JUP A;  4CGR A;  3ZQL A;  3TP3 A;  3HIM A;  3JSJ A;  2NS7 A;  3BTJ A;  2XRL A;  3C2B A;  2DG7 A;  3ZQH A;  1ORK A;  2WUI A;  2FX0 A;  3BTI A;  3LJL A;  5F1J A;  4YZE A;  3NNR A;  5EZH A;  3ZQF A;  4B3A A;  3BR5 A;  5FKM A;  4AUX A;  3NPI A;  3IH3 A;  3IH4 A;  4W97 A;  3G56 A;  5EFY A;  3PM1 A;  2HXO A;  2VKV A;  1SGM A;  5K7H A;  3BNI A;  2IEK A;  4D7M A;  3COL A;  2VKE A;  3ZQG A;  4HKU A;  2QWT A;  3VVZ A;  3LSJ A;  3O8H A;  2F07 A;  2OER A;  3SFI A;  2GUH A;  1T56 A;  5F04 A;  5GP9 A;  3RD3 A;  3WHC A;  3NXC A;  1JT0 A;  1QPI A;  2TRT A;  3G1O A;  2G3B A;  3O60 A;  3O8G A;  5D18 A;  4M3D A;  5K7F A;  3LHQ A;  5AQC A;  3V6G A;  4GCT A;  1Z0X A;  3F1B A;  2FJ1 A;  1VI0 A; 
#chains in the Genus database with same CATH topology
 4DW6 A;  3Q3S A;  4U9N A;  5FKN A;  2O7O A;  5J3L A;  2PBX A;  3VP5 A;  4U9L A;  2RAS A;  4W1U A;  2ZCX A;  2DTZ A;  3GZI A;  5EZG A;  3FIW A;  2X6O A;  3NRG A;  4PXI A;  2YVH A;  3HTI A;  3PAS A;  2XDN A;  3VVY A;  2Q24 A;  3LSP A;  4JL3 A;  1BJZ A;  3Q0V A;  4V2F A;  3QBM A;  4D7N A;  2XPV A;  5F0H A;  4D5F A;  2XPW A;  4AC6 A;  3BR0 A;  4GFL A;  3T6N A;  3CWR A;  4MK6 A;  2WV1 A;  4C2M A;  5FKO A;  2V57 A;  2GEN A;  2R7U A;  3V78 A;  3KNW A;  2RAE A;  2UXH A;  2RHA A;  1Z77 A;  2R7Q A;  1UI5 A;  3VW0 A;  2XGC A;  3ANG A;  3BJB A;  4M3F A;  1ZK8 A;  2OF7 A;  3F0C A;  1JUM A;  2ZCN A;  5DAJ A;  1T33 A;  2TCT A;  3HTJ A;  4I6Z A;  3ZQI A;  2QOP A;  3BCG A;  3PPB A;  1U9N A;  4ACI A;  1RPW A;  2ZOZ A;  2HYJ A;  3BQY A;  3EGQ A;  2IU5 A;  5CQG A;  2WGB A;  2NS8 A;  2ZOY A;  5FKK A;  3C07 A;  2XPU A;  3MVP A;  5FHP A;  2OPT A;  3KZ9 A;  3NI7 A;  1RKW A;  2GFN A;  5HBU A;  1JTY A;  5GPC A;  2PZ9 A;  3DPJ A;  5F0F A;  3HTA A;  3HGY A;  1JTX A;  2W53 A;  3BR2 A;  2JJ7 A;  2Y30 A;  2QCO A;  3LSR A;  3DCF A;  2R7O A;  4X1E A;  3BHQ A;  3QKX A;  1UI6 A;  4IRV A;  3BTC A;  3WHB A;  5HSZ A;  3BR3 A;  3VIB A;  2ID6 A;  4AC0 A;  5GPA A;  4NN1 A;  3VW1 A;  5FGL A;  2HKU A;  2PFV A;  2G7S A;  3AQT A;  2UXU A;  2ZB9 A;  5CXI A;  2XB5 A;  3FHN A;  5IP6 A;  4JNN A;  3BQZ A;  2ZY9 A;  3VPR A;  2OI8 A;  2FBQ A;  4ME9 A;  3CDL A;  1U9O A;  3VOK A;  3BR6 A;  5K7Z A;  2NP5 A;  2DG8 A;  1QVT A;  3CRJ A;  3VW2 A;  2D6Y A;  4GFK A;  3G1M A;  3MNL A;  3K8P C;  2ZCM A;  2VPR A;  5CW8 A;  1ZKG A;  5FKL A;  2XGE A;  2Y31 A;  4AF5 A;  3FK7 A;  3BTL A;  4ABZ A;  3ON2 A;  2IBD A;  3EUP A;  3G1L A;  3DEW A;  5CXG A;  3IH2 A;  5C4Y A;  3B6C A;  2Y2Z A;  4NEL A;  2G7G A;  2HXI A;  3NS4 A;  3AQS A;  4GCL A;  3KKD A;  3VOX A;  5IOY A;  2XGD A;  3LOC A;  2G0E A;  5D19 A;  3FK6 A;  4MXM A;  1RKT A;  3VUQ A;  3HGG A;  2YVX A;  4UDS A;  2R7V A;  3BT9 A;  2UXI A;  5K58 A;  5D1R A;  1A6I A;  2B1E A;  2QIB A;  3E7Q A;  2UXP A;  2FD5 A;  3KKC A;  5F0C A;  2IAI A;  3CCY A;  5J1R A;  4JKZ A;  2R7T A;  2NX4 A;  2HYT A;  2REK A;  5J1U A;  3P9T A;  4G12 A;  3CJD A;  4M3G A;  2EH3 A;  4XK4 A;  3HTH A;  2ID3 A;  4OD4 A;  2B3W A;  4V2G A;  4I76 A;  5IOZ A;  3BRU A;  3ANP A;  3QQA A;  5FMP A;  3S5R A;  4JYK A;  3VVX A;  3BR1 A;  3Q0W A;  3VTI A;  3G7R A;  5H9T A;  2JK3 A;  5IPA A;  2QKO A;  3GEU A;  5HAW A;  1QVU A;  3SDG A;  2HQ5 A;  5EYR A;  3HE0 A;  2NP3 A;  3B6A A;  4GCK A;  3QPS A;  2G7L A;  1JT6 A;  5F08 A;  3QPL A;  2GBY A;  3IUV A;  4MO7 A;  2YVE A;  4ICH A;  1JUS A;  5J1Y A;  4WIB A;  3ON4 A;  2X9D A;  4D5C A;  4KWA A;  3LWJ A;  2FJI 1;  3B81 A;  4B1R A;  2QTQ A;  2FQ4 A;  3RH2 A;  4L62 A;  4M3B A;  4OD5 A;  2A2F X;  5F27 A;  2I10 A;  2UXO A;  3DU6 A;  3FRQ A;  3Q0U A;  3TP0 A;  2R7S A;  4M3E A;  2O7T A;  1JUP A;  4CGR A;  3ZQL A;  3TP3 A;  3HIM A;  3JSJ A;  2NS7 A;  3BTJ A;  2XRL A;  3C2B A;  3DU5 A;  2DG7 A;  3ZQH A;  1ORK A;  2WUI A;  2FX0 A;  3BTI A;  2R7R A;  3LJL A;  5F1J A;  4YZE A;  3KYL A;  3NNR A;  5EZH A;  3ZQF A;  4B3A A;  3BR5 A;  5FKM A;  4AUX A;  3NPI A;  3IH3 A;  3IH4 A;  4W97 A;  3G56 A;  5EFY A;  3PM1 A;  2HXO A;  2VKV A;  1SGM A;  5K7H A;  3BNI A;  2IEK A;  4D7M A;  3COL A;  2VKE A;  3ZQG A;  4HKU A;  2QWT A;  3VVZ A;  3LSJ A;  3O8H A;  2F07 A;  2OER A;  3SWH A;  3SFI A;  2GUH A;  1T56 A;  5F04 A;  5GP9 A;  3RD3 A;  3WHC A;  3NXC A;  4DVY P;  1JT0 A;  1QPI A;  2TRT A;  3G1O A;  2G3B A;  3O60 A;  2R7W A;  3O8G A;  5D18 A;  4M3D A;  5K7F A;  3LHQ A;  5AQC A;  3V6G A;  4GCT A;  1Z0X A;  3F1B A;  2FJ1 A;  1VI0 A;  2R7X A; 
#chains in the Genus database with same CATH homology
 4DW6 A;  3Q3S A;  5FKN A;  2O7O A;  5J3L A;  2PBX A;  3VP5 A;  2RAS A;  4W1U A;  2ZCX A;  2DTZ A;  3GZI A;  5EZG A;  3FIW A;  2X6O A;  3NRG A;  4PXI A;  2YVH A;  3HTI A;  3PAS A;  2XDN A;  3VVY A;  2Q24 A;  3LSP A;  4JL3 A;  1BJZ A;  3Q0V A;  4V2F A;  3QBM A;  4D7N A;  2XPV A;  5F0H A;  4D5F A;  2XPW A;  4AC6 A;  3BR0 A;  4GFL A;  3T6N A;  3CWR A;  4MK6 A;  2WV1 A;  5FKO A;  2V57 A;  2GEN A;  3V78 A;  3KNW A;  2RAE A;  2UXH A;  2RHA A;  1Z77 A;  3VW0 A;  1UI5 A;  2XGC A;  3ANG A;  3BJB A;  4M3F A;  1ZK8 A;  2OF7 A;  3F0C A;  1JUM A;  2ZCN A;  5DAJ A;  1T33 A;  2TCT A;  3HTJ A;  4I6Z A;  3ZQI A;  2QOP A;  3BCG A;  3PPB A;  1U9N A;  4ACI A;  1RPW A;  2ZOZ A;  2HYJ A;  3BQY A;  3EGQ A;  2IU5 A;  2WGB A;  2NS8 A;  2ZOY A;  5FKK A;  3C07 A;  2XPU A;  3MVP A;  5FHP A;  2OPT A;  3KZ9 A;  3NI7 A;  1RKW A;  2GFN A;  5HBU A;  1JTY A;  5GPC A;  2PZ9 A;  3DPJ A;  5F0F A;  3HTA A;  3HGY A;  1JTX A;  2W53 A;  3BR2 A;  2JJ7 A;  2Y30 A;  2QCO A;  3LSR A;  3DCF A;  4X1E A;  3BHQ A;  3QKX A;  1UI6 A;  3BTC A;  3WHB A;  5HSZ A;  3BR3 A;  3VIB A;  2ID6 A;  4AC0 A;  5GPA A;  4NN1 A;  3VW1 A;  5FGL A;  2HKU A;  2G7S A;  3AQT A;  2UXU A;  2ZB9 A;  5CXI A;  2XB5 A;  5IP6 A;  4JNN A;  3BQZ A;  3VPR A;  2OI8 A;  2FBQ A;  4ME9 A;  3CDL A;  1U9O A;  3VOK A;  3BR6 A;  5K7Z A;  2NP5 A;  2DG8 A;  1QVT A;  3CRJ A;  3VW2 A;  2D6Y A;  4GFK A;  3G1M A;  3MNL A;  2ZCM A;  2VPR A;  5CW8 A;  1ZKG A;  5FKL A;  2XGE A;  2Y31 A;  4AF5 A;  3FK7 A;  3BTL A;  4ABZ A;  3ON2 A;  2IBD A;  3EUP A;  3G1L A;  3DEW A;  5CXG A;  3IH2 A;  5C4Y A;  3B6C A;  2Y2Z A;  4NEL A;  2G7G A;  2HXI A;  3AQS A;  4GCL A;  3KKD A;  3VOX A;  5IOY A;  2XGD A;  3LOC A;  2G0E A;  5D19 A;  3FK6 A;  4MXM A;  1RKT A;  3VUQ A;  3HGG A;  4UDS A;  3BT9 A;  2UXI A;  5K58 A;  5D1R A;  1A6I A;  2QIB A;  3E7Q A;  2UXP A;  2FD5 A;  3KKC A;  5F0C A;  2IAI A;  3CCY A;  5J1R A;  4JKZ A;  2NX4 A;  2HYT A;  2REK A;  5J1U A;  3P9T A;  4G12 A;  3CJD A;  4M3G A;  2EH3 A;  4XK4 A;  3HTH A;  2ID3 A;  4V2G A;  4I76 A;  5IOZ A;  3BRU A;  3ANP A;  3QQA A;  5FMP A;  3S5R A;  4JYK A;  3VVX A;  3BR1 A;  3Q0W A;  3G7R A;  5H9T A;  2JK3 A;  5IPA A;  2QKO A;  3GEU A;  5HAW A;  1QVU A;  3SDG A;  2HQ5 A;  5EYR A;  3HE0 A;  2NP3 A;  3B6A A;  4GCK A;  3QPS A;  2G7L A;  1JT6 A;  5F08 A;  3QPL A;  2GBY A;  3IUV A;  4MO7 A;  2YVE A;  4ICH A;  1JUS A;  5J1Y A;  3ON4 A;  2X9D A;  4D5C A;  4KWA A;  3LWJ A;  3B81 A;  4B1R A;  2QTQ A;  2FQ4 A;  3RH2 A;  4L62 A;  4M3B A;  5F27 A;  2I10 A;  2UXO A;  3FRQ A;  3Q0U A;  3TP0 A;  4M3E A;  2O7T A;  1JUP A;  4CGR A;  3ZQL A;  3TP3 A;  3HIM A;  3JSJ A;  2NS7 A;  3BTJ A;  2XRL A;  3C2B A;  2DG7 A;  3ZQH A;  1ORK A;  2WUI A;  2FX0 A;  3BTI A;  3LJL A;  5F1J A;  4YZE A;  3NNR A;  5EZH A;  3ZQF A;  4B3A A;  3BR5 A;  5FKM A;  4AUX A;  3NPI A;  3IH3 A;  3IH4 A;  4W97 A;  3G56 A;  5EFY A;  3PM1 A;  2HXO A;  2VKV A;  1SGM A;  5K7H A;  3BNI A;  2IEK A;  4D7M A;  3COL A;  2VKE A;  3ZQG A;  4HKU A;  2QWT A;  3VVZ A;  3LSJ A;  3O8H A;  2F07 A;  2OER A;  3SFI A;  2GUH A;  1T56 A;  5F04 A;  5GP9 A;  3RD3 A;  3WHC A;  3NXC A;  1JT0 A;  1QPI A;  2TRT A;  3G1O A;  2G3B A;  3O60 A;  3O8G A;  5D18 A;  4M3D A;  5K7F A;  3LHQ A;  5AQC A;  3V6G A;  4GCT A;  1Z0X A;  3F1B A;  2FJ1 A;  1VI0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...