4KUDK

Crystal structure of n-terminal acetylated sir3 bah domain d205n mutant in complex with yeast nucleosome core particle
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
212
structure length
212
Chain Sequence
b'KTLKDLDGWQVIITDDQGRVIDDNNRRRSRKRGGENVFLKRISDGLSFGKGESVIFNDNVTETYSVYLIHEIRLNTLNNVVEIWVFSYLRWFELKPKLYYEQFRPDLIKEDHPLEFYKDKFFNEVNKSELYLTAELSEIWLKDFIAVGQILPESQWNDSSIDKIEDRDFLVRYACEPTAEKFVPIDIFQIIRRVKEMEPKQSNEYLKRVSVP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3
publication title N alpha-acetylated Sir3 stabilizes the conformation of a nucleosome-binding loop in the BAH domain
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Structural protein/transcription/dna
total genus 45
structure length 212
sequence length 212
chains with identical sequence L
ec nomenclature
pdb deposition date 2013-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF01426 BAH BAH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.490 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4kudK00
4FSXA 1ZBXA 4KULA 4KUIA 2FVUA 4LD9K 3PTAA 4KUDK 1W4SA 2FL7A 1M4ZA 4DA4A 4FT4A 3PT9A 4BB7A 4DOVA 4DOWA 4FT2A 3TU4K 1ZHIA 4JJNK
chains in the Genus database with same CATH superfamily
2FZCB 2BE7D 4E7IA 4XTYA 2M9UA 2CZ6B 2A28A 1OOTA 3EGDA 4J9HA 3CC2A 3UT1A 2LCSA 3LLRA 4M78G 3FJPA 4J9CA 3QXEB 5FU7B 1YJ9A 2DZ9A 4C8QA 2GQIA 4M77A 3G7ZA 2KNBB 1PG5B 3INZA 2D6FA 1P92A 2V8KA 1BIAA 3L1AA 5C6SA 1NJIU 2COZA 4FL6A 4FYWB 2E6NA 2CP5A 3CCJA 1I07A 2FHDA 3EGXA 5J3BA 4IURA 2A0FB 2PUKB 3GP8A 1NEBA 3ZL7C 2GFUA 3M59A 2V8IA 2KXDA 3CCQT 3RMQA 3CXCS 1SF9A 4VUBA 2QTXA 4LDYA 4DBHA 2FPDA 3CEYA 4M78D 1AEYA 2DIQA 4PJOC 1Q81C 3BE3A 2MCNA 3HHTB 5D6WA 2VXEA 1PKTA 2CS7A 4QW2A 4ZN3A 1B34B 1YN8A 3FRNA 1M90U 2F2VA 3G1JA 2KGTA 1MNEA 3AHUA 5FU6B 3EG2A 4OF1A 5I2SA 3UF4A 4AG2C 4C8QG 1M1KC 3BDLA 2K9GA 4OB0B 4R56A 3C12A 3VUZA 1I5LA 2RQWA 1TWBA 4A4HA 5GAN5 3OYGA 4NL2A 2DL8A 5LJ3f 2FPEA 3I56A 5GAN3 1VQNA 1PSFA 2KT8A 3JB9G 5DM7R 4M7AA 2KYBA 4XU0A 2V8JA 3FLGA 1Z9QA 4AFUC 3OMGA 4M77C 2RH2A 1UHFA 2H3JA 2PUOB 4C8QD 4JJNK 5KYXA 1K8AU 3CCEQ 3ER0A 4FM4B 3A8GB 2LTOA 2JVVA 3ZBDA 3EG9A 3LYIA 1WX6A 1I8FA 3QIIA 3I35A 1M2OA 1PNJA 1T3LA 2GNCA 4EMGA 2WSEE 1FMKA 3DLMA 2LNVA 4C0FA 2RJFA 2QGFB 3CMEA 4C0DB 2MOXA 3HRSA 4OMFB 1X2KA 3HRUA 1QVGP 3JB9D 4EMKA 3OYJA 1YJNA 2HCKA 4YTLA 1PSEA 1VQKA 3CCET 1S72Q 2JMCA 4HCBA 5DLOA 1I4K1 4M78B 4P5NA 2ABLA 2EWNA 3L2RA 2DTIA 2K79A 2KRSA 3E19A 2O2OA 5GJWB 1KIKA 2RMOA 1QVGA 2HSEB 4D6WA 1D0XA 3CCMA 1XNIA 4M7AG 4PL6A 5HK3A 3CCRQ 3H0FA 2BE9B 1M9SA 3A1PA 4A54A 1TUDA 1K0XA 2QQRA 3M57A 3NTHA 3A5ZB 4UC4A 3OS1A 1RAHB 2JN0A 1NJIR 2XDBA 1AD5A 1W6XA 3JCMf 2XIDA 1HSQA 4ZTFA 5GAMj 3G6EQ 4JRQA 1W4SA 3CCRT 1QP3A 3VS4A 5FLXE 1M30A 5GAN2 4M7DG 3CCLA 2CH4W 1CKBA 3MKDA 2M0OA 3OS5A 3R6OA 3VKIA 1AVZC 1OZ2A 2JOYA 1VIFA 4M7AD 3EGDB 5CVIA 2Y4YA 1KJWA 3EFOA 2BUDA 2K57A 3ZEHA 3G6ET 2NUPA 1JU5C 4M7DF 1E7OA 3OYLA 5LJ3h 3OYBA 1AT1B 2DE0X 2L3QA 3LWHA 4C5HA 4C8QB 1KD1R 2DL4A 1BI3A 3UPUA 4KGVB 3EG0A 2C0IA 4PJNA 3JCMQ 1N27A 1VQ8A 2HMAA 3PTAA 2PVDB 3LGLA 3BY7A 4O5VA 1B3QA 1H641 2SRCA 1VQOA 5CKDA 3A8OB 1YJWQ 2OTLA 3OYFA 2LCCA 1KQSS 4BY6B 1VQ9A 4J7FA 3URGA 3TQ7P 4C0GA 3JCMJ 1I1JA 2VASA 4Y92A 3SWNA 2AK5A 3M56A 4QQGA 1IB8A 1YITQ 4JZ3A 1UGQB 4QVCA 3QDFA 2XDDA 2EKHA 1VYVA 1YJWT 3G4SQ 2DL3A 1PD0A 2QGGA 1O9SA 2A08A 2WACA 1YI2Q 1VQ4Q 1ABQA 1G3SA 1RAGB 1U1SA 3SFMA 1OV3A 3PFSA 5GAN4 3EH1A 4QVZA 1K9MR 1YITT 1MGQA 1X01A 2L3PA 3VS5A 4XTZA 5GANj 1UECA 1M4ZA 1UUEA 2VGMA 1N6AA 3OYEA 3S3MA 3I55A 2JTMA 4C92A 1MV3A 1NJIC 3RDVA 1YI2T 8ATCB 2D1XA 1VQ4T 2C06A 2VUBA 3CMAQ 2YT6A 1W1FA 2JM8A 3DLLA 1JEGA 4Q5WA 1GBQA 2LZ6B 5KE2A 4M7AB 1OI1A 1W2BP 2EPDA 2XI9A 1NM7A 1YIJA 1Q81U 2CZ1B 2KROA 1M8MA 2XU8A 3OYIA 2EIFA 1PD1A 1Y0MA 2H8HA 3F70A 1FWZA 3TEEA 1TUCA 4RTYA 2G3RA 4DBQA 2KSSA 3OYKA 1RAAB 1ZUYA 4PKCC 1W2BA 2XD0A 3CMAT 2AIRB 4OMLA 2JMAA 2VC8A 2K4YA 1UHCA 3MP6A 1A0NB 2FZGB 2V26A 1M1KU 4DBFA 3WXMB 3L2QA 4M7DB 4TVRA 2JZ2A 2JNGA 4NL3A 1M3CA 1KD1C 1HYOA 1LVKA 5KH6A 1VQPT 3CBOA 2EGAA 3UA7A 2RF0A 3TU4K 4EMKB 1VQ5T 2IVWA 5D6YA 4F7UF 5LJ5f 2ROLA 1UGSB 1OU8A 4OB2B 2FVUA 4RTVA 1DJ7B 2LCLA 4WCIA 3V8KA 1UGPB 2DL7A 2X3XD 1NE8A 3JCMe 1NBEB 2CGHA 5FROA 4OMMA 2LP5A 4C92G 3MHXA 1D0YA 4M75A 4LDXA 1VYUA 4RTTA 1VQ7Q 1U06A 1H3ZA 2CP0A 4RG2A 3A98A 3NTKA 3UWNA 4OB1B 3A8MB 4KBMB 3E1SA 5GAMf 4OMOA 3ASKA 4IIMA 4GY5A 4R0KA 3RKXA 2VV5A 2B86A 1X75C 1R0CB 3CPWS 2EQMA 4JLIA 3CBMA 1WNLA 4N0AA 1G8XA 4J9GA 3JCMg 1VQ7T 3HSBA 2J7IA 1QMCA 3FIFA 3RKWA 4IUTA 3EG3A 4JS5A 1WYXA 3P8BB 3GF5A 1NZ9A 3H6ZA 1M1GA 4RTUA 4IUUA 4RTXA 4C92D 1X2QA 5CCAA 1K9MC 2MIOA 1NYGA 3LH0A 3M0PA 3MEWA 2AHJB 4KUDK 2D0NA 5IAYA 1YWPA 5J39A 1YHQA 3WVEB 1QCFA 4BE2A 3RBBB 3CCVQ 4FYYB 1SEMA 4LDWA 4M75G 3LW5E 4EIKA 3FEOA 2M51A 3NHNA 2HL5C 4ELZC 1TH7A 1WPYA 3QJYA 5D7UA 2DA9A 2BIVA 1WHMA 2FYKA 3QZ5B 4BE0A 5DY9A 1D1BA 2EQJA 1RABB 1KSWA 2VXFA 3NMZC 2QK0A 2CSIA 3VRYA 4HVUA 4FYVB 5KYWB 4C5GA 3M53A 3G71A 1QWFA 3CCVT 1YBYA 3I5SA 2RQVA 2ZPBB 1IGQA 4J6WA 2E5QA 2RHUA 2XK0A 2CKKA 4NS5A 4GLMA 1OQKA 4ATOA 2ZPGB 2YLCA 4R55A 4M75D 3E9GA 4LE9A 4X9DA 2EW3A 1VYTA 2XICA 3JCMd 1X43A 3VYGA 4DBRA 1PCXA 2KEAA 2Y4XA 3JCMW 5IHKA 3S6WA 1PM3A 1XQHA 3L2WA 2QAZA 1VQ6Q 5GANf 2RI2A 1K76A 2QTVA 4PFOA 2HQXA 4EPCA 2F69A 3CD6A 3OYHA 1X6GA 3SDZA 3OYAA 2COWA 2QEXA 2FPFA 1F1BB 1PWTA 2BTTA 3REBB 5KYYA 2HBWA 3UDCA 2CDTA 2K6DA 3QG1A 5GAMh 2H3EB 3T9NA 1VQ6T 1ABOA 1M27C 1U3OA 4C92B 5IXBA 2ZPHB 3QSUA 1WHJA 1WJSA 4ANJA 4JUVA 2GF7A 2O4XB 2R5AA 4M78E 3HRTA 1YNZA 3MEVA 5GMKe 1XOVA 3OYDA 2LJ3A 2HEQA 4KRTA 4C5EA 4HT9A 2JUFA 3X20B 3A8HB 4Z02A 3OA6A 4KULA 2FO0A 1JRIA 3FDRA 4EDUA 3KUFA 4RCBA 4A4EA 5AT1B 5KCHA 5GAOm 4ZTJA 2EJFA 3JRZA 2RHYA 1TUGB 5J26A 1MNDA 3CCQQ 1I5OB 1WHLA 1UTIA 5IXFA 5GAN8 5L23A 4N4HA 2J6OA 5GAOl 5LJ5g 4J8OA 2DZCA 3EH2A 3JSCA 4J9DA 4QVDA 3GNGA 3VUBA 4M75B 1ZUUA 1QVFS 1TS9A 4PJOG 1WJQA 1OEBA 3JCMb 2K2VA 1PRLC 4J9EA 2ZZDA 2YSQA 2DM1A 4M78C 5GAOr 2M1HA 1FMWA 1G5VA 4C8QE 4M77E 4PJOF 1I81A 3CC4Q 3EGUA 1R8OB 4JRPA 2YRCA 2GQVA 2LJ1A 5GANh 2E5KA 1Y7XA 4J9FA 1KD1U 1RLQC 3SEMA 3SD4A 1D3BB 1KC8R 2RD1A 3JCMX 4RTWA 4MZTA 3V8JA 3TREA 3CC4T 2RM4A 4ZGEB 3CQTA 3OW2S 4HCZA 4ELYC 5I11A 3SHWA 2DD4A 2ZPFB 5FWBA 3MEUA 4XTUA 2RHIA 2EGEA 2J05A 1ZSGA 1IXDA 4J5YA 2LJ0A 4BUGA 3M4YA 3VS2A 2FEIA 3REAB 1IHVA 2O01E 2KVQG 2O9VA 4DEXA 3SB2A 1FYNA 2F2WA 5LJ5d 3VS0A 2RJEA 4CRIA 1M2VB 1PC0A 1KHIA 1RADB 4BDZA 4DA4A 1CKAA 4C8QC 1QKXA 2HSPA 3THKA 1VIEA 4FCYA 2FG0A 4AFQC 4M77F 4BI3A 2K3BA 5DLQE 4KT0E 5GAN6 2HAXA 4F14A 3U23A 1K9MU 4JRKA 4JRIA 3DKMA 4M7DA 2HQEA 2GCXA 4BY6C 4M7AE 2KBTA 1SSFA 1ZX6A 3M4GA 5KE3A 2L0AA 1JJ2P 1UE9A 3HL8A 4MDWA 1ZLMA 4HVVA 3VYHB 1OZ3A 3CCEA 5FRMA 1MUZA 2K5IA 1D1AA 2ZPIB 1RACB 1QQJA 1NEGA 4ORZA 1N8RR 1JJ2A 3CMET 1GCQA 1GBRA 2IIMA 3HFNA 2PTKA 2MYSA 4BB7A 1YJNT 5KYYB 4OGEA 2DETA 4MZPA 1QW1A 2RHZA 3NTIA 3O8VA 3QYHB 4QQ6A 1S72A 3GNFB 3TVTA 4QKUA 4PJOB 2L8DA 4F04B 1K0SA 1LOJA 3C0CA 3OYYA 2QG9B 4E7KA 2DXTA 1VQMQ 1TOVA 3CCRA 2L5QA 2BZ8A 4DOWA 1BKBA 4J9BA 2A36A 3CCUQ 2KRNA 4NOYA 2DNUA 1ZBXA 2KXCA 1KC8C 2NUZA 1WXBA 4FYXB 2JTFA 2L3RA 4M7AC 1EIFA 4O6JA 3G6EA 3PMTA 3J7AF 2ED1A 2JS0A 4AT1B 2DRMA 4FT4A 4CC3A 1VQMT 1LJOA 4DOVA 2DIGA 3LGFA 1Y07A 3CCUT 2O88A 1J3TA 2E4HA 1LNXA 4KGZB 2AT1B 3BDUA 2X4XA 2YUPA 2LC4A 4PLLA 4IIOA 3HP9A 3OQ5A 3CCSQ 2F5KA 2QA4Q 2CP2A 4B9WA 3JCMP 2X51A 4AFZC 4M7DD 1UFFA 5KYWA 3UA6A 2RPNA 4EMKC 3EHQA 2I0NA 4CC4B 4A4GA 2PU9B 3E2UA 4CI0C 2O31A 4M4ZA 3VU3C 2I2LA 3RMSA 1S1NA 1VOMA 1KQ1A 1WXUA 5M9OA 3CCST 1GCQC 2F1LA 3C95A 2QA4T 1AZGB 1OULA 1YJWA 1K4US 2LVMA 2K7AA 4DQ2A 1IREB 3OSSC 5LJ3e 2GGRA 4BDYA 1UDLA 4F7UA 1RUWA 5FWCA 1VQLQ 3M0UA 2DXBA 5GAOp 1WXTA 1WI7A 3CBPA 1N8RC 1GFDA 1YITA 4JS4A 3EG1A 1QP2A 2DJQA 1H3HA 3G4SA 3X28B 2OTJQ 4MMKA 4PJJA 4ZNXA 3S3NA 5GMKi 2LX9A 3OBWA 2JW4A 1XJWB 1SPKA 1YI2A 1VQLT 1VQ4A 2M0YA 2PNIA 5LJ3g 2E65A 2DLPA 3OBYA 1BU1A 1TXQA 2O4XA 3BW1A 4XU2A 2COYA 2JM9A 2BZXA 4EMHA 4HXJA 2P0PA 2DX1A 2PZ1A 4E7LA 1GXIE 3VRZA 4AG1C 2Y90A 1VQPQ 5EC7A 3OS2A 3CC7Q 3JB9I 2OTJT 2X4JA 3V7RA 1OPKA 3H0HA 1ACMB 2QDLA 1VQ5Q 2CP7A 2EKOA 3OSVA 4XTVA 1JB0E 3CMAA 1I0CA 2CREA 4F7UG 3CXCP 3HKSA 4C92E 1WQ7A 2D9TA 2DMOA 2F2XA 1O75A 4HCKA 5GMKm 2EVRA 3CC7T 1ZHIA 2DILA 4XQ3A 2XHCA 4RUGA 2YUOA 3CXCA 2P0KA 2CYZB 3SWNC 5HKCA 2QDYB 2DXUA 5GMKl 4LXCA 2QI2A 3L2VA 5I21A 2VYTA 5KCOA 4L5GA 1TSFA 2VKNA 1SG5A 1AWXA 4XTXA 3OW2P 1YFNA 1MMGA 1C0MA 5GAOn 2DAQA 2V1QA 1FX7A 3L42A 2L3SA 2W10A 1G83A 4X9CA 5LJ3d 1R77A 1YCSB 1MMAA 1VQ7A 5I22A 2DYIA 2E6ZA 4WF2A 2VWFA 2DVEA 1EZZB 1G3YA 4KGXB 1PRMC 4M75E 4C92C 4L59A 4FSXA 2C0OA 2X35A 1D3BA 1N5ZA 1BBZA 2VVKA 3EAEA 4HCCA 1QVGS 4ZN1A 3V8LA 5IHNA 5CK9A 4Y28E 4Z8AA 4A4KA 3NGPA 4PNOA 2DL5A 3QDRB 3RNJA 3BFMA 1T3SA 1WQWA 2LNHB 2E64A 1BYMA 1UGRB 5CKBA 1M3AA 4ZGDB 4DEYA 1ZSZA 1XTDA 2YUQA 3HFOA 3JAME 3MJXA 3VS3A 1M2VA 5FU7C 5IH2A 5I2MA 4E7HA 1K73U 1NPPA 2K3XA 1QCOA 4RTZA 2L2PA 1U1TA 1KQ2A 3CCVA 2G6FX 3JB9H 2JXBA 1WDXA 4OMNA 2GBQA 3KBGA 4RKUE 3PE0A 4X1VA 4PFPA 1KC8U 4XU1A 4M75C 3VS1A 1X69A 4D8KA 2RJDA 2FB7A 2EYQA 2FL7A 1SHGA 2OI3A 3DB3A 3GLXA 2NYSA 3UATA 1IO6A 4F7UB 3QPHA 2ECZA 4WTOB 1RLPC 2QYZA 4FW2A 1H92A 2D8JA 4N0AC 2P0QA 5L8RE 1T0HA 2A3LA 2YRVA 2D0QB 2JT4A 2RI3A 3PMIA 2EJ9A 1ZBJA 4N4GA 2KDSA 5FU6C 1T0JA 2EJGA 1VQ6A 4D8DA 1Q82U 2ENMA 5IN1A 4LNPA 1RAFB 3EHRA 4QQDA 4AFSC 5ECAA 3QUIA 2KK4A 4Z89A 4PJOA 2CH4A 1UB4A 1WFWA 2X4YA 1FMVA 1MHNA 3C94A 3PVQA 1HD3A 2E10A 4PJLA 1TG0A 4A63B 5LJ5e 4FSSA 3PIPA 1KQSP 1BI2A 4MZMA 3CC2Q 4LN2A 5CO7A 1N8RU 1U8RA 2WSFE 3QWXX 1YJ9Q 2IG0A 3M9QA 5AYFA 2QQAA 5A0DA 1KQSA 2DRKA 5GAMe 1V76A 8AT1B 4J83A 4ME7A 4JLGA 3X26B 4OMPA 3CC2T 4JDSA 3CCJQ 2EBPA 2FZKB 2HKNA 2MK5A 4C0DC 4RMOA 2J6KA 1QCNA 2DK3A 6AT1B 1YJ9T 2JJ9A 2ZCFB 2MWOA 3LWIA 5FRNA 3GBQA 2LT4A 5KYNA 2LT1A 2MAMA 3CCQA 1BK2A 1AHJB 1V29B 1W2BS 4M78F 3VJPA 1C1AA 2M16A 1SHFA 1M8VA 5GAMg 4LDUA 4LUDA 3CCJT 5CKEA 3A8LB 4C5IA 2KY9A 1PHTA 3M0RA 1RI0A 3PIOA 3JB9J 1K73R 1YCYA 2K3YA 1YP5A 5GAN7 2RB6A 2EQKA 2C0TA 4KH0B 1WHGA 3FJ5A 2QQSA 1R0BG 2CT4A 5A0GA 3QKJA 1EFNA 4L6V5 4JJBA 3RESA 4PJOD 2QQ9A 4IKFA 3CC4A 4E7JA 1B7TA 5HK0A 3H0IA 3L2ZA 2J06A 3O5ZA 4JPBW 3I56Q 3I9QA 3OB9A 3L2UA 2YXYA 1VQNQ 4XTWA 1SRMA 2ED0A 3PGGA 2CZ7B 4M77G 3QZ9B 3OS0A 1ZSZB 2QQBA 4LD9K 3N5BB 4FIBA 2HD0A 2DBMA 2EQUA 1FXXA 3EFSA 2P4RA 1OX9A 3OYMA 1Q86R 2DYBA 2OAUA 4V2SA 4KH1B 2NUTB 4C8QF 3I56T 2KR3A 3GIBA 3JCMc 1VQNT 1ZQ1A 1Q82R 5EG2A 5GANe 2QASA 4PLIA 2QXFA 1M3BA 2KRMA 3S3OA 1BIBA 9ATCB 1NLOC 2RJCA 5IT9E 1X6OA 2LMJA 1Y71A 5GAMd 4FW1A 3CMEQ 1GCPA 3CPWP 2A7YA 2ATCB 1M5Q1 1LPLA 3JB9F 1YJNQ 2R57A 2AZSA 3DB4A 4M77D 3OY9A 1KG1A 2LQNA 2HDAA 1QWEA 1IRXA 3LX7A 1VQKQ 2KMTA 2IPOB 2ZAEA 3H8ZA 3WVDB 2YDLA 1JO8A 5GANg 1NYFA 3M0TA 2ESWA 3CPWA 1Y57A 1WHHA 3M0QA 1RL2A 3MEAA 1WZOA 3CCMQ 1IGUA 1G2BA 3PT9A 1ARKA 2PVOB 2LQ8A 4B6MA 2OX7A 4C0ZA 4M7DE 3LH5A 1VQKT 1MMDA 2YWWA 3M54A 5GMKj 3RUXA 1K73C 3RKYA 1JQQA 5LJ5j 5CKHA 3X24B 4BE1A 4HA8A 3CCMT 2AZVA 1Y96B 2E1HA 1RI9A 2XG8D 3CCLQ 4XAXB 1S72T 5GJVB 5GAOq 2CSQA 2EYYA 1E6GA 1UJYA 4E47A 3RERA 2MPXC 2DJZA 4M7AF 2PVGB 1KFZA 2X9HA 4GLKA 2KQWA 2ZPEB 2AKLA 4FU6A 4E7ZA 5KYUA 4HKEA 3MP8A 1VQMA 3MCAB 3CCLT 3CCUA 2X4WA 4MDXA 3V7CA 4ZGJB 1NG2A 2CZ0B 1WJRA 3ULRB 2EQIA 2MMPA 1VQ8Q 1D09B 1VUBA 4M7DC 1Q86C 5GANd 1VQOQ 2OTLQ 4J7IA 1M90R 1ZA2B 1Z9ZA 1CSKA 1Q82C 3J81E 2WSCE 1VQ9Q 1GRIA 2AKKA 7AT1B 4M77B 1Q7YU 3RIRA 1WGSA 2HKQB 2DTHA 2SEMA 1AOJA 1WHKA 3KXTA 2RA2A 2RQUA 1JBMA 1VQ8T 1SSHA 3CCSA 2DXCA 2JTEA 2CP3A 2QA4A 3OYCA 3EGXB 1VQOT 2OTLT 3NFCA 1IZ6A 3QWYA 1NLPC 2CT3A 1K9AA 2E12A 5CR2A 2DFUA 1VQ9T 4PJMA 4LDVA 2O9SA 3M58A 3HPWA 3R6NA 4JJCA 1X6BA 4RCCA 5HY6A 2OJ2A 2D8HA 5CAIA 2K5LA 3QHSA 2GTJA 4II1A 2X3WD 2DTOA 2FRWA 2MF2A 2B8AA 2RNAA 4Y91A 2CUBA 2KAFA 4RG8A 3ME9A 3KFVA 3I55Q 1K8AR 1EX4A 1VQLA 5A2QE 1IHWA 1MMNA 4PK4A 2CUDA 2J6FA 2ROTA 3TCJA 1YWOA 2E41A 2K2MA 4F7UE 2E3IA 4Z88A 1AWJA 2DBKA 2LQWA 1G3WA 1YIJQ 3G4ST 2MWPA 2EYXA 1TTHB 2OTJA 3FC3A 1QVPA 3VS7A 5FW9A 3IQLA 3I55T 1QVFP 3NPFA 4KUIA 3X25B 3JCMh 2DEUA 3GOXA 2PQWA 2BZYA 3P8DA 5CKFA 3J80E 1OU9A 4IUQA 2RI5A 1YIJT 2XKOC 1QVFA 4IUPA 3OMCA 1TU0B 1OX8A 1VQPA 3CC7A 3M0SA 1BI1A 4K11A 1RAEB 1VQ5A 5KYXB 2EYWA 3PVLA 2VB6A 2W0ZA 2DPPB 3TSZA 3EG9B 5LL6S 2E3HA 3D7SB 1KK7A 2VGNA 5CQYA 2M02A 2R5MA 1M90C 5HCKA 2CP6A 2YLBA 2JS2A 2DERA 4B9XA 1GL5A 4CC2A 1JXMA 1JXOA 1HK9A 4BI4A 3VS6A 2BKDN 1BI0A 2DD5A 4BD3A 4J9IA 2KI7A 5CIUA 3H41A 3EFRA 2HQHA 2P84A 3QYGB 1MV0B 3H9NA 3P8HA 4X34A 2RO0A 2L89A 1V1CA 3OW2A 3C4SA 4A4FA 1W70A 2DEQA 1SRLA 4BI8B 1Q7YR 2LRQA 1AWWA 4MMLA 1GFCA 4BACA 4C92F 2RK2A 2A37A 1ZA1B 2ZGWA 1QKWA 1UGVA 2V1RA 1QLYA 1JJ2S 1N9SA 1B34A 4ESRA 2DF6A 3HTRA 1YHQQ 4CC7A 2Z0WA 2EGCA 4XK8E 5D6XA 4E7SA 1OYXA 4IUVA 1K8AC 5KYUB 1UEBA 2EAYA 2R58A 5IHIA 1UJ0A 4XU3A 3M55A 2LDMA 3I5RA 2RQRA 3E9FA 1WIEA 1B07A 2YHTA 3QO3A 3GPLA 3ZFJA 1K1ZA 2RQTA 1YHQT 1X27A 3EFOB 4JZ4A 2NUPB 4LUEA 3PNWC 3G71Q 2KYMA 1PKSA 2YRDA 2NUTA 4FT2A 2RK1A 4A53A 2LQKA 2GFAA 1SKUB 1WA7A 4GBQA 2HL3A 2K5FA 2HNIA 1M1FA 1WLPB 4QT7A 5LJ3j 1E6HA 3M5AA 1U5SA 4M75F 1D0ZA 2HBPA 1KHCA 2RN8A 3MP1A 2LX7A 3G71T 3JV3A 1HJDA 4N4IA 4OP0A 1VA7A 2FRYA 3MO8A 4OMQA 3CD6Q 2XDPA 1AZEA 2F5TX 2NLUA 3FB9A 1N9RA 4PFZA 2XMFA 1BB9A 5C0MA 3JCMV 2P4TA 3CPFA 3SWNB 2HZYA 2NWMA 2QEXQ 1Q81R 5GMKh 1G3TA 5A0LA 3QBYA 3V7SA 4J6YA 1Q95G 1H8KA 4J6XA 1RAIB 5LJ5h 3VV0A 4AMCA 1Q86U 2GTOA 5CQXA 4M78A 1NPRA 4F17A 2E70A 3CD6T 1BCMA 3MPUB 4HVWA 1M1KR 2YUNA 2QEXT 2MI6A 4HT8A 2DVJA 1Y96A 4OGCA 3QJ6A 1Q7YC 2RHXA 1BCOA 2EYZA 1D1CA 4E6RA 1LCKA 2KT1A 3RR6A 1OPLA 3META 2KE9A 1ZSZC 1ZUKA 1UG1A 3AT1B 4F16A 3OYNA 4E2FB 4JJDA 3Q1JA 2OAWA 3TSWA 2DO3A 1C6VX 4LD6A 1HXDA 4OB3B 4PJOE 2EFIA 2DKGA 1AWOA 4OVAA
chains in the Genus database with same CATH topology
4E7IA 3H6ZA 1M1GA 4XTYA 3LX7A 2KMTA 4IUUA 4C92D 2DXBA 5GAOp 2M9UA 5CCAA 1K9MC 3H8ZA 2CZ6B 3CBPA 3WVDB 1N8RC 3LH0A 5GANg 3CC2A 3MEWA 3UT1A 3CPWA 1YITA 2AHJB 3LLRA 4JS4A 4KUDK 4M78G 5IAYA 3FJPA 1QP2A 1RL2A 3MEAA 5J39A 1YHQA 3QXEB 3WVEB 5FU7B 4BE2A 1YJ9A 3G4SA 2DZ9A 3X28B 3PT9A 4C8QA 2PVOB 4MMKA 2LQ8A 3S3NA 4M77A 4LDWA 2LX9A 3G7ZA 3OBWA 3LW5E 4M75G 5GMKi 4C0ZA 4M7DE 1VQKT 1YI2A 3FEOA 1VQLT 1VQ4A 3INZA 2D6FA 1P92A 2V8KA 1BIAA 1TH7A 4ELZC 1WPYA 3QJYA 3L1AA 3M54A 5C6SA 5LJ3g 2E65A 5GMKj 2BIVA 1NJIU 2FYKA 4FL6A 3QZ5B 2E6NA 3OBYA 3RUXA 4BE0A 5DY9A 3CCJA 1K73C 2O4XA 3BW1A 2EQJA 3RKYA 5LJ5j 4XU2A 5CKHA 2FHDA 2VXFA 5J3BA 3X24B 4BE1A 4IURA 4EMHA 2P0PA 4E7LA 1GXIE 4HA8A 3CCMT 2PUKB 3GP8A 1Y96B 2GFUA 4C5GA 3M53A 3G71A 2Y90A 3OS2A 2OTJT 3M59A 3JB9I 2E1HA 2X4JA 2V8IA 2XG8D 3V7RA 3CCVT 3CCQT 1YBYA 4XAXB 3RMQA 3CXCS 4VUBA 1S72T 5GAOq 2QTXA 4LDYA 3CEYA 4M78D 2EKOA 3OSVA 4XTVA 2ZPBB 1JB0E 3CMAA 2DIQA 4J6WA 2E5QA 4E47A 4PJOC 2RHUA 2XK0A 1Q81C 2CKKA 3RERA 2DJZA 4F7UG 4M7AF 2PVGB 4NS5A 3HKSA 3HHTB 4C92E 5D6WA 1WQ7A 4ATOA 4GLKA 2KQWA 2ZPEB 2VXEA 2D9TA 2CS7A 2YLCA 2ZPGB 4M75D 1O75A 4QW2A 3E9GA 4FU6A 4ZN3A 1B34B 4R55A 4HKEA 4X9DA 3FRNA 3MP8A 1VQMA 1M90U 2XICA 3MCAB 5GMKm 3CC7T 3JCMd 3VYGA 1ZHIA 2Y4XA 4XQ3A 3CCLT 3JCMW 3S6WA 3CCUA 1XQHA 2X4WA 3AHUA 2XHCA 5FU6B 3L2WA 4MDXA 5GANf 3V7CA 2RI2A 4ZGJB 3CXCA 2HQXA 4EPCA 4OF1A 2P0KA 2CZ0B 5I2SA 2F69A 3CD6A 1WJRA 4C8QG 2MMPA 2CYZB 3OYHA 1M1KC 3SWNC 3BDLA 3SDZA 1VUBA 5HKCA 2QDYB 4OB0B 3OYAA 2DXUA 4R56A 3C12A 3VUZA 2QEXA 4M7DC 5GMKl 1I5LA 1Q86C 5GANd 2QI2A 3L2VA 4A4HA 4J7IA 5GAN5 3OYGA 4NL2A 5I21A 2VYTA 3UDCA 5KCOA 4L5GA 1Q82C 3QG1A 5GAMh 3J81E 2WSCE 5LJ3f 3T9NA 3I56A 4M77B 1Q7YU 5GAN3 3RIRA 1VQ6T 1WGSA 1VQNA 1PSFA 4XTXA 4C92B 2DTHA 3JB9G 2ZPHB 5GAOn 3QSUA 2DAQA 3KXTA 1FX7A 2RA2A 5DM7R 3L42A 4M7AA 1JBMA 1VQ8T 1WJSA 4XU0A 4JUVA 3CCSA 2DXCA 2V8JA 4X9CA 5LJ3d 2GF7A 2O4XB 2R5AA 4M78E 3FLGA 2QA4A 3HRTA 3OYCA 1VQOT 1VQ7A 2OTLT 3MEVA 3OMGA 5GMKe 3NFCA 1IZ6A 1XOVA 2E6ZA 3OYDA 4M77C 4WF2A 2RH2A 2E12A 2DVEA 5CR2A 2H3JA 2PUOB 1G3YA 4C5EA 4C8QD 4HT9A 1VQ9T 4M75E 2JUFA 4C92C 4JJNK 3X20B 4LDVA 3A8HB 4Z02A 4FSXA 4L59A 3OA6A 4KULA 2X35A 3ER0A 3HPWA 3M58A 3A8GB 1JRIA 4FM4B 4RCCA 1D3BA 2LTOA 2JVVA 5HY6A 3ZBDA 3FDRA 3LYIA 3EAEA 4EDUA 5CAIA 1I8FA 3KUFA 3QIIA 4HCCA 1QVGS 4RCBA 2K5LA 3QHSA 4A4EA 4EMGA 2WSEE 4ZN1A 3DLMA 4II1A 2LNVA 4C0FA 2DTOA 3V8LA 5KCHA 5GAOm 2RJFA 4ZTJA 2MF2A 3CMEA 4C0DB 5CK9A 4Y28E 2B8AA 3HRSA 4OMFB 4A4KA 2EJFA 3JRZA 4PNOA 4Y91A 3HRUA 2RHYA 3QDRB 3JB9D 4EMKA 5J26A 3OYJA 1YJNA 3BFMA 2KAFA 4RG8A 3ME9A 4YTLA 1WQWA 1PSEA 2E64A 1VQKA 3CCET 1BYMA 1UGRB 5GAN8 1VQLA 5A2QE 4N4HA 5CKBA 4HCBA 5DLOA 1I4K1 4M78B 4P5NA 4ZGDB 3TCJA 5LJ5g 2EWNA 4J8OA 5GAOl 2DZCA 1XTDA 2E41A 3L2RA 2DTIA 3E19A 4F7UE 3HFOA 3JAME 1QVGA 3JSCA 5FU7C 1G3WA 4QVDA 3GNGA 3VUBA 5I2MA 4D6WA 4M75B 4E7HA 3CCMA 1K73U 1QVFS 3G4ST 1XNIA 4PJOG 1NPPA 1WJQA 2K3XA 2MWPA 4PL6A 5HK3A 4M7AG 4BDYA 1U1TA 3JCMb 1KQ2A 2OTJA 2K2VA 3CCVA 3FC3A 1QVPA 2ZZDA 3I55T 3JB9H 1M9SA 4M78C 4A54A 5GAOr 2QQRA 4KUIA 3M57A 3X25B 3JCMh 3NTHA 2M1HA 3A5ZB 4UC4A 3OS1A 1G5VA 3KBGA 2JN0A 4RKUE 4C8QE 2PQWA 3GOXA 2XDBA 3P8DA 1KC8U 4M77E 5CKFA 3JCMf 4XU1A 1KG1A 3J80E 4PJOF 2XIDA 1I81A 4IUQA 4M75C 2RI5A 4ZTFA 5GAMj 4JRQA 1YIJT 2RJDA 1R8OB 2FB7A 1W4SA 2EYQA 2FL7A 3DB3A 4JRPA 2XKOC 1QVFA 2GQVA 3GLXA 4IUPA 3OMCA 3CCRT 1VQPA 1QP3A 3CC7A 5FLXE 5GANh 5GAN2 1BI1A 4M7DG 3CCLA 1Y7XA 1KD1U 1VQ5A 4F7UB 3QPHA 2M0OA 3SD4A 1D3BB 2DPPB 3OS5A 2RD1A 3R6OA 3VKIA 3JCMX 1OZ2A 5LL6S 2JOYA 1VIFA 4M7AD 5CVIA 2VGNA 5CQYA 4N0AC 2P0QA 4MZTA 3V8JA 3TREA 2Y4YA 2R5MA 5L8RE 1M90C 2A3LA 3CC4T 2YRVA 2BUDA 2K57A 2RM4A 3ZEHA 3G6ET 2YLBA 2D0QB 4ZGEB 4M7DF 2RI3A 3PMIA 2EJ9A 3OYLA 4HCZA 5LJ3h 4ELYC 4N4GA 3OYBA 3OW2S 2KDSA 3LWHA 2DD4A 2ZPFB 3MEUA 5FU6C 4C5HA 4B9XA 4XTUA 4C8QB 2RHIA 2EJGA 1VQ6A 1BI3A 3UPUA 1Q82U 1HK9A 4BI4A 5IN1A 4J5YA 2BKDN 1BI0A 2DD5A 4BD3A 3JCMQ 1N27A 4QQDA 3QUIA 4BUGA 2KK4A 1VQ8A 4PJOA 3M4YA 3OY9A 1K8AU 2O01E 2KVQG 2PVDB 5CIUA 3LGLA 1UB4A 3PTAA 3SB2A 5LJ5d 3BY7A 2RJEA 2X4YA 3EFRA 4CRIA 1KHIA 3QYGB 4O5VA 1H641 1VQOA 1MHNA 5CKDA 3A8OB 3C94A 2OTLA 3P8HA 4X34A 4BDZA 4DA4A 4C8QC 2RO0A 3OYFA 2L89A 3OW2A 3C4SA 1VIEA 2E10A 2LCCA 4A4FA 1KQSS 4BY6B 2DEQA 4M77F 4BI3A 4J7FA 4BI8B 1VQ9A 2LRQA 5DLQE 3URGA 4MMLA 5LJ5e 4BACA 4C92F 4C0GA 2RK2A 4KT0E 3JCMJ 5GAN6 3PIPA 2ZGWA 1BI2A 4MZMA 2HAXA 3SWNA 3M56A 4QQGA 1K9MU 1JJ2S 4JRKA 4JRIA 1UGQB 1N9SA 5CO7A 1B34A 4QVCA 3DKMA 4M7DA 1N8RU 2HQEA 2XDDA 1U8RA 2GCXA 2WSFE 1YJWT 5D6XA 4XK8E 4BY6C 4M7AE 1OYXA 4IUVA 1K8AC 2IG0A 1UEBA 1SSFA 5LJ3e 3M4GA 5KE3A 3M9QA 5AYFA 2EAYA 3HL8A 4MDWA 2QQAA 2R58A 5A0DA 1KQSA 1O9SA 2WACA 3VYHB 1OZ3A 3CCEA 5GAMe 5FRMA 2K5IA 4XU3A 4J83A 1G3SA 3M55A 4ME7A 2LDMA 1U1SA 4JLGA 2ZPIB 3X26B 3SFMA 3E9FA 3PFSA 5GAN4 3CC2T 4JDSA 4QVZA 2YHTA 1YITT 1MGQA 3QO3A 1X01A 4C0DC 3GPLA 3ZFJA 4RMOA 1JJ2A 3CMET 4XTZA 5GANj 1YHQT 2DK3A 1M4ZA 1YJ9T 3HFNA 2ZCFB 2VGMA 3PNWC 1N6AA 2MWOA 4BB7A 3LWIA 3OYEA 3S3MA 1YJNT 4FT2A 5FRNA 2LT4A 4OGEA 2RK1A 2LT1A 4MZPA 4A53A 1QW1A 2RHZA 2MAMA 3I55A 2JTMA 2LQKA 1AHJB 3NTIA 4C92A 3O8VA 3CCQA 2GFAA 1YI2T 1NJIC 1VQ4T 1V29B 3QYHB 4QQ6A 1W2BS 1S72A 4M78F 3VJPA 2C06A 2VUBA 3GNFB 2K5FA 2M16A 1M8VA 3DLLA 2HNIA 5GAMg 1M1FA 4Q5WA 5KE2A 4LDUA 3CCJT 4PJOB 4M7AB 5CKEA 5LJ3j 3A8LB 1OI1A 4C5IA 3M5AA 2KY9A 2L8DA 2XI9A 1LOJA 1YIJA 1Q81U 4M75F 1RI0A 2CZ1B 2HBPA 1KHCA 3OYYA 3PIOA 3JB9J 4E7KA 3MP1A 2DXTA 1YCYA 2K3YA 2XU8A 3OYIA 3CCRA 2L5QA 3G71T 2EIFA 4DOWA 2RB6A 1BKBA 5GAN7 2EQKA 4N4IA 4OP0A 3F70A 1FWZA 4NOYA 3TEEA 1ZBXA 1KC8C 3MO8A 2QQSA 2G3RA 2KSSA 3OYKA 4PKCC 2JTFA 2XDPA 1W2BA 2XD0A 2L3RA 3CMAT 2F5TX 2NLUA 4M7AC 3FB9A 1N9RA 5A0GA 3QKJA 2VC8A 5C0MA 3JCMV 4L6V5 2P4TA 3CPFA 3RESA 4PJOD 2K4YA 3MP6A 3SWNB 1EIFA 2QQ9A 4O6JA 4IKFA 3CC4A 1M1KU 5GMKh 1G3TA 5A0LA 3PMTA 3QBYA 3G6EA 3V7SA 3WXMB 3L2QA 4E7JA 3J7AF 4J6YA 4M7DB 4TVRA 2JZ2A 2JNGA 5HK0A 4NL3A 4J6XA 4FT4A 1VQMT 1KD1C 1VQPT 3L2ZA 5KH6A 3CBOA 5LJ5h 3VV0A 1LJOA 4DOVA 2DIGA 3LGFA 1Q86U 1Y07A 3TU4K 4EMKB 3CCUT 1VQ5T 5CQXA 2IVWA 3OB9A 3L2UA 5D6YA 4F7UF 5LJ5f 1UGSB 1LNXA 4M78A 4OB2B 4XTWA 3PGGA 1NPRA 2CZ7B 2FVUA 2E70A 3CD6T 1DJ7B 2LCLA 3BDUA 3V8KA 1UGPB 2X4XA 4M77G 2LC4A 1NE8A 4PLLA 3QZ9B 3JCMe 2CGHA 5FROA 3OS0A 3HP9A 3OQ5A 2QQBA 4C92G 4LD9K 3MHXA 2F5KA 2QEXT 2MI6A 3N5BB 4M75A 4LDXA 4FIBA 4B9WA 3JCMP 2HD0A 4HT8A 2EQUA 1Y96A 4OGCA 1FXXA 4RG2A 3QJ6A 4M7DD 3EFSA 1H3ZA 3OYMA 3NTKA 3UWNA 4EMKC 2RHXA 1Q7YC 2OAUA 4V2SA 4OB1B 3A8MB 4C8QF 4KBMB 4A4GA 3I56T 2PU9B 3E1SA 4CI0C 3GIBA 3JCMc 5GAMf 1ZQ1A 1VQNT 3ASKA 5EG2A 5GANe 3VU3C 2I2LA 3RMSA 3META 4GY5A 4PLIA 2QXFA 3RKXA 2VV5A 1KQ1A 1X75C 3CPWS 3OYNA 5M9OA 2EQMA 4JLIA 1BIBA 3CBMA 1WNLA 3CCST 3S3OA 2RJCA 3Q1JA 4N0AA 3C95A 2QA4T 1X6OA 5IT9E 1Y71A 3JCMg 5GAMd 1VQ7T 3HSBA 2DO3A 3FIFA 3RKWA 1YJWA 4IUTA 2A7YA 2LVMA 1HXDA 1M5Q1 4LD6A 4OB3B 4PJOE 2EFIA 2DKGA 4DQ2A 3JB9F 4JS5A 1IREB 3P8BB 3OSSC 4OVAA 2R57A 3GF5A 3DB4A 4M77D 1NZ9A 4F7UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FSX A;  1ZBX A;  4KUL A;  4KUI A;  2FVU A;  4LD9 K;  3PTA A;  4KUD K;  1W4S A;  2FL7 A;  1M4Z A;  4DA4 A;  4FT4 A;  3PT9 A;  4BB7 A;  4DOV A;  4DOW A;  4FT2 A;  3TU4 K;  1ZHI A;  4JJN K; 
#chains in the Genus database with same CATH topology
 2FZC B;  2BE7 D;  4E7I A;  4XTY A;  2M9U A;  2CZ6 B;  2A28 A;  1OOT A;  3EGD A;  4J9H A;  3CC2 A;  3UT1 A;  2LCS A;  3LLR A;  4M78 G;  3FJP A;  4J9C A;  3QXE B;  5FU7 B;  1YJ9 A;  2DZ9 A;  4C8Q A;  2GQI A;  4M77 A;  3G7Z A;  2KNB B;  1PG5 B;  3INZ A;  2D6F A;  1P92 A;  2V8K A;  1BIA A;  3L1A A;  5C6S A;  1NJI U;  2COZ A;  4FL6 A;  4FYW B;  2E6N A;  2CP5 A;  3CCJ A;  1I07 A;  2FHD A;  3EGX A;  5J3B A;  4IUR A;  2A0F B;  2PUK B;  3GP8 A;  1NEB A;  3ZL7 C;  2GFU A;  3M59 A;  2V8I A;  2KXD A;  3CCQ T;  3RMQ A;  3CXC S;  1SF9 A;  4VUB A;  2QTX A;  4LDY A;  4DBH A;  2FPD A;  3CEY A;  4M78 D;  1AEY A;  2DIQ A;  4PJO C;  1Q81 C;  3BE3 A;  2MCN A;  3HHT B;  5D6W A;  2VXE A;  1PKT A;  2CS7 A;  4QW2 A;  4ZN3 A;  1B34 B;  1YN8 A;  3FRN A;  1M90 U;  2F2V A;  3G1J A;  2KGT A;  1MNE A;  3AHU A;  5FU6 B;  3EG2 A;  4OF1 A;  5I2S A;  3UF4 A;  4AG2 C;  4C8Q G;  1M1K C;  3BDL A;  2K9G A;  4OB0 B;  4R56 A;  3C12 A;  3VUZ A;  1I5L A;  2RQW A;  1TWB A;  4A4H A;  5GAN 5;  3OYG A;  4NL2 A;  2DL8 A;  5LJ3 f;  2FPE A;  3I56 A;  5GAN 3;  1VQN A;  1PSF A;  2KT8 A;  3JB9 G;  5DM7 R;  4M7A A;  2KYB A;  4XU0 A;  2V8J A;  3FLG A;  1Z9Q A;  4AFU C;  3OMG A;  4M77 C;  2RH2 A;  1UHF A;  2H3J A;  2PUO B;  4C8Q D;  4JJN K;  5KYX A;  1K8A U;  3CCE Q;  3ER0 A;  4FM4 B;  3A8G B;  2LTO A;  2JVV A;  3ZBD A;  3EG9 A;  3LYI A;  1WX6 A;  1I8F A;  3QII A;  3I35 A;  1M2O A;  1PNJ A;  1T3L A;  2GNC A;  4EMG A;  2WSE E;  1FMK A;  3DLM A;  2LNV A;  4C0F A;  2RJF A;  2QGF B;  3CME A;  4C0D B;  2MOX A;  3HRS A;  4OMF B;  1X2K A;  3HRU A;  1QVG P;  3JB9 D;  4EMK A;  3OYJ A;  1YJN A;  2HCK A;  4YTL A;  1PSE A;  1VQK A;  3CCE T;  1S72 Q;  2JMC A;  4HCB A;  5DLO A;  1I4K 1;  4M78 B;  4P5N A;  2ABL A;  2EWN A;  3L2R A;  2DTI A;  2K79 A;  2KRS A;  3E19 A;  2O2O A;  5GJW B;  1KIK A;  2RMO A;  1QVG A;  2HSE B;  4D6W A;  1D0X A;  3CCM A;  1XNI A;  4M7A G;  4PL6 A;  5HK3 A;  3CCR Q;  3H0F A;  2BE9 B;  1M9S A;  3A1P A;  4A54 A;  1TUD A;  1K0X A;  2QQR A;  3M57 A;  3NTH A;  3A5Z B;  4UC4 A;  3OS1 A;  1RAH B;  2JN0 A;  1NJI R;  2XDB A;  1AD5 A;  1W6X A;  3JCM f;  2XID A;  1HSQ A;  4ZTF A;  5GAM j;  3G6E Q;  4JRQ A;  1W4S A;  3CCR T;  1QP3 A;  3VS4 A;  5FLX E;  1M30 A;  5GAN 2;  4M7D G;  3CCL A;  2CH4 W;  1CKB A;  3MKD A;  2M0O A;  3OS5 A;  3R6O A;  3VKI A;  1AVZ C;  1OZ2 A;  2JOY A;  1VIF A;  4M7A D;  3EGD B;  5CVI A;  2Y4Y A;  1KJW A;  3EFO A;  2BUD A;  2K57 A;  3ZEH A;  3G6E T;  2NUP A;  1JU5 C;  4M7D F;  1E7O A;  3OYL A;  5LJ3 h;  3OYB A;  1AT1 B;  2DE0 X;  2L3Q A;  3LWH A;  4C5H A;  4C8Q B;  1KD1 R;  2DL4 A;  1BI3 A;  3UPU A;  4KGV B;  3EG0 A;  2C0I A;  4PJN A;  3JCM Q;  1N27 A;  1VQ8 A;  2HMA A;  3PTA A;  2PVD B;  3LGL A;  3BY7 A;  4O5V A;  1B3Q A;  1H64 1;  2SRC A;  1VQO A;  5CKD A;  3A8O B;  1YJW Q;  2OTL A;  3OYF A;  2LCC A;  1KQS S;  4BY6 B;  1VQ9 A;  4J7F A;  3URG A;  3TQ7 P;  4C0G A;  3JCM J;  1I1J A;  2VAS A;  4Y92 A;  3SWN A;  2AK5 A;  3M56 A;  4QQG A;  1IB8 A;  1YIT Q;  4JZ3 A;  1UGQ B;  4QVC A;  3QDF A;  2XDD A;  2EKH A;  1VYV A;  1YJW T;  3G4S Q;  2DL3 A;  1PD0 A;  2QGG A;  1O9S A;  2A08 A;  2WAC A;  1YI2 Q;  1VQ4 Q;  1ABQ A;  1G3S A;  1RAG B;  1U1S A;  3SFM A;  1OV3 A;  3PFS A;  5GAN 4;  3EH1 A;  4QVZ A;  1K9M R;  1YIT T;  1MGQ A;  1X01 A;  2L3P A;  3VS5 A;  4XTZ A;  5GAN j;  1UEC A;  1M4Z A;  1UUE A;  2VGM A;  1N6A A;  3OYE A;  3S3M A;  3I55 A;  2JTM A;  4C92 A;  1MV3 A;  1NJI C;  3RDV A;  1YI2 T;  8ATC B;  2D1X A;  1VQ4 T;  2C06 A;  2VUB A;  3CMA Q;  2YT6 A;  1W1F A;  2JM8 A;  3DLL A;  1JEG A;  4Q5W A;  1GBQ A;  2LZ6 B;  5KE2 A;  4M7A B;  1OI1 A;  1W2B P;  2EPD A;  2XI9 A;  1NM7 A;  1YIJ A;  1Q81 U;  2CZ1 B;  2KRO A;  1M8M A;  2XU8 A;  3OYI A;  2EIF A;  1PD1 A;  1Y0M A;  2H8H A;  3F70 A;  1FWZ A;  3TEE A;  1TUC A;  4RTY A;  2G3R A;  4DBQ A;  2KSS A;  3OYK A;  1RAA B;  1ZUY A;  4PKC C;  1W2B A;  2XD0 A;  3CMA T;  2AIR B;  4OML A;  2JMA A;  2VC8 A;  2K4Y A;  1UHC A;  3MP6 A;  1A0N B;  2FZG B;  2V26 A;  1M1K U;  4DBF A;  3WXM B;  3L2Q A;  4M7D B;  4TVR A;  2JZ2 A;  2JNG A;  4NL3 A;  1M3C A;  1KD1 C;  1HYO A;  1LVK A;  5KH6 A;  1VQP T;  3CBO A;  2EGA A;  3UA7 A;  2RF0 A;  3TU4 K;  4EMK B;  1VQ5 T;  2IVW A;  5D6Y A;  4F7U F;  5LJ5 f;  2ROL A;  1UGS B;  1OU8 A;  4OB2 B;  2FVU A;  4RTV A;  1DJ7 B;  2LCL A;  4WCI A;  3V8K A;  1UGP B;  2DL7 A;  2X3X D;  1NE8 A;  3JCM e;  1NBE B;  2CGH A;  5FRO A;  4OMM A;  2LP5 A;  4C92 G;  3MHX A;  1D0Y A;  4M75 A;  4LDX A;  1VYU A;  4RTT A;  1VQ7 Q;  1U06 A;  1H3Z A;  2CP0 A;  4RG2 A;  3A98 A;  3NTK A;  3UWN A;  4OB1 B;  3A8M B;  4KBM B;  3E1S A;  5GAM f;  4OMO A;  3ASK A;  4IIM A;  4GY5 A;  4R0K A;  3RKX A;  2VV5 A;  2B86 A;  1X75 C;  1R0C B;  3CPW S;  2EQM A;  4JLI A;  3CBM A;  1WNL A;  4N0A A;  1G8X A;  4J9G A;  3JCM g;  1VQ7 T;  3HSB A;  2J7I A;  1QMC A;  3FIF A;  3RKW A;  4IUT A;  3EG3 A;  4JS5 A;  1WYX A;  3P8B B;  3GF5 A;  1NZ9 A;  3H6Z A;  1M1G A;  4RTU A;  4IUU A;  4RTX A;  4C92 D;  1X2Q A;  5CCA A;  1K9M C;  2MIO A;  1NYG A;  3LH0 A;  3M0P A;  3MEW A;  2AHJ B;  4KUD K;  2D0N A;  5IAY A;  1YWP A;  5J39 A;  1YHQ A;  3WVE B;  1QCF A;  4BE2 A;  3RBB B;  3CCV Q;  4FYY B;  1SEM A;  4LDW A;  4M75 G;  3LW5 E;  4EIK A;  3FEO A;  2M51 A;  3NHN A;  2HL5 C;  4ELZ C;  1TH7 A;  1WPY A;  3QJY A;  5D7U A;  2DA9 A;  2BIV A;  1WHM A;  2FYK A;  3QZ5 B;  4BE0 A;  5DY9 A;  1D1B A;  2EQJ A;  1RAB B;  1KSW A;  2VXF A;  3NMZ C;  2QK0 A;  2CSI A;  3VRY A;  4HVU A;  4FYV B;  5KYW B;  4C5G A;  3M53 A;  3G71 A;  1QWF A;  3CCV T;  1YBY A;  3I5S A;  2RQV A;  2ZPB B;  1IGQ A;  4J6W A;  2E5Q A;  2RHU A;  2XK0 A;  2CKK A;  4NS5 A;  4GLM A;  1OQK A;  4ATO A;  2ZPG B;  2YLC A;  4R55 A;  4M75 D;  3E9G A;  4LE9 A;  4X9D A;  2EW3 A;  1VYT A;  2XIC A;  3JCM d;  1X43 A;  3VYG A;  4DBR A;  1PCX A;  2KEA A;  2Y4X A;  3JCM W;  5IHK A;  3S6W A;  1PM3 A;  1XQH A;  3L2W A;  2QAZ A;  1VQ6 Q;  5GAN f;  2RI2 A;  1K76 A;  2QTV A;  4PFO A;  2HQX A;  4EPC A;  2F69 A;  3CD6 A;  3OYH A;  1X6G A;  3SDZ A;  3OYA A;  2COW A;  2QEX A;  2FPF A;  1F1B B;  1PWT A;  2BTT A;  3REB B;  5KYY A;  2HBW A;  3UDC A;  2CDT A;  2K6D A;  3QG1 A;  5GAM h;  2H3E B;  3T9N A;  1VQ6 T;  1ABO A;  1M27 C;  1U3O A;  4C92 B;  5IXB A;  2ZPH B;  3QSU A;  1WHJ A;  1WJS A;  4ANJ A;  4JUV A;  2GF7 A;  2O4X B;  2R5A A;  4M78 E;  3HRT A;  1YNZ A;  3MEV A;  5GMK e;  1XOV A;  3OYD A;  2LJ3 A;  2HEQ A;  4KRT A;  4C5E A;  4HT9 A;  2JUF A;  3X20 B;  3A8H B;  4Z02 A;  3OA6 A;  4KUL A;  2FO0 A;  1JRI A;  3FDR A;  4EDU A;  3KUF A;  4RCB A;  4A4E A;  5AT1 B;  5KCH A;  5GAO m;  4ZTJ A;  2EJF A;  3JRZ A;  2RHY A;  1TUG B;  5J26 A;  1MND A;  3CCQ Q;  1I5O B;  1WHL A;  1UTI A;  5IXF A;  5GAN 8;  5L23 A;  4N4H A;  2J6O A;  5GAO l;  5LJ5 g;  4J8O A;  2DZC A;  3EH2 A;  3JSC A;  4J9D A;  4QVD A;  3GNG A;  3VUB A;  4M75 B;  1ZUU A;  1QVF S;  1TS9 A;  4PJO G;  1WJQ A;  1OEB A;  3JCM b;  2K2V A;  1PRL C;  4J9E A;  2ZZD A;  2YSQ A;  2DM1 A;  4M78 C;  5GAO r;  2M1H A;  1FMW A;  1G5V A;  4C8Q E;  4M77 E;  4PJO F;  1I81 A;  3CC4 Q;  3EGU A;  1R8O B;  4JRP A;  2YRC A;  2GQV A;  2LJ1 A;  5GAN h;  2E5K A;  1Y7X A;  4J9F A;  1KD1 U;  1RLQ C;  3SEM A;  3SD4 A;  1D3B B;  1KC8 R;  2RD1 A;  3JCM X;  4RTW A;  4MZT A;  3V8J A;  3TRE A;  3CC4 T;  2RM4 A;  4ZGE B;  3CQT A;  3OW2 S;  4HCZ A;  4ELY C;  5I11 A;  3SHW A;  2DD4 A;  2ZPF B;  5FWB A;  3MEU A;  4XTU A;  2RHI A;  2EGE A;  2J05 A;  1ZSG A;  1IXD A;  4J5Y A;  2LJ0 A;  4BUG A;  3M4Y A;  3VS2 A;  2FEI A;  3REA B;  1IHV A;  2O01 E;  2KVQ G;  2O9V A;  4DEX A;  3SB2 A;  1FYN A;  2F2W A;  5LJ5 d;  3VS0 A;  2RJE A;  4CRI A;  1M2V B;  1PC0 A;  1KHI A;  1RAD B;  4BDZ A;  4DA4 A;  1CKA A;  4C8Q C;  1QKX A;  2HSP A;  3THK A;  1VIE A;  4FCY A;  2FG0 A;  4AFQ C;  4M77 F;  4BI3 A;  2K3B A;  5DLQ E;  4KT0 E;  5GAN 6;  2HAX A;  4F14 A;  3U23 A;  1K9M U;  4JRK A;  4JRI A;  3DKM A;  4M7D A;  2HQE A;  2GCX A;  4BY6 C;  4M7A E;  2KBT A;  1SSF A;  1ZX6 A;  3M4G A;  5KE3 A;  2L0A A;  1JJ2 P;  1UE9 A;  3HL8 A;  4MDW A;  1ZLM A;  4HVV A;  3VYH B;  1OZ3 A;  3CCE A;  5FRM A;  1MUZ A;  2K5I A;  1D1A A;  2ZPI B;  1RAC B;  1QQJ A;  1NEG A;  4ORZ A;  1N8R R;  1JJ2 A;  3CME T;  1GCQ A;  1GBR A;  2IIM A;  3HFN A;  2PTK A;  2MYS A;  4BB7 A;  1YJN T;  5KYY B;  4OGE A;  2DET A;  4MZP A;  1QW1 A;  2RHZ A;  3NTI A;  3O8V A;  3QYH B;  4QQ6 A;  1S72 A;  3GNF B;  3TVT A;  4QKU A;  4PJO B;  2L8D A;  4F04 B;  1K0S A;  1LOJ A;  3C0C A;  3OYY A;  2QG9 B;  4E7K A;  2DXT A;  1VQM Q;  1TOV A;  3CCR A;  2L5Q A;  2BZ8 A;  4DOW A;  1BKB A;  4J9B A;  2A36 A;  3CCU Q;  2KRN A;  4NOY A;  2DNU A;  1ZBX A;  2KXC A;  1KC8 C;  2NUZ A;  1WXB A;  4FYX B;  2JTF A;  2L3R A;  4M7A C;  1EIF A;  4O6J A;  3G6E A;  3PMT A;  3J7A F;  2ED1 A;  2JS0 A;  4AT1 B;  2DRM A;  4FT4 A;  4CC3 A;  1VQM T;  1LJO A;  4DOV A;  2DIG A;  3LGF A;  1Y07 A;  3CCU T;  2O88 A;  1J3T A;  2E4H A;  1LNX A;  4KGZ B;  2AT1 B;  3BDU A;  2X4X A;  2YUP A;  2LC4 A;  4PLL A;  4IIO A;  3HP9 A;  3OQ5 A;  3CCS Q;  2F5K A;  2QA4 Q;  2CP2 A;  4B9W A;  3JCM P;  2X51 A;  4AFZ C;  4M7D D;  1UFF A;  5KYW A;  3UA6 A;  2RPN A;  4EMK C;  3EHQ A;  2I0N A;  4CC4 B;  4A4G A;  2PU9 B;  3E2U A;  4CI0 C;  2O31 A;  4M4Z A;  3VU3 C;  2I2L A;  3RMS A;  1S1N A;  1VOM A;  1KQ1 A;  1WXU A;  5M9O A;  3CCS T;  1GCQ C;  2F1L A;  3C95 A;  2QA4 T;  1AZG B;  1OUL A;  1YJW A;  1K4U S;  2LVM A;  2K7A A;  4DQ2 A;  1IRE B;  3OSS C;  5LJ3 e;  2GGR A;  4BDY A;  1UDL A;  4F7U A;  1RUW A;  5FWC A;  1VQL Q;  3M0U A;  2DXB A;  5GAO p;  1WXT A;  1WI7 A;  3CBP A;  1N8R C;  1GFD A;  1YIT A;  4JS4 A;  3EG1 A;  1QP2 A;  2DJQ A;  1H3H A;  3G4S A;  3X28 B;  2OTJ Q;  4MMK A;  4PJJ A;  4ZNX A;  3S3N A;  5GMK i;  2LX9 A;  3OBW A;  2JW4 A;  1XJW B;  1SPK A;  1YI2 A;  1VQL T;  1VQ4 A;  2M0Y A;  2PNI A;  5LJ3 g;  2E65 A;  2DLP A;  3OBY A;  1BU1 A;  1TXQ A;  2O4X A;  3BW1 A;  4XU2 A;  2COY A;  2JM9 A;  2BZX A;  4EMH A;  4HXJ A;  2P0P A;  2DX1 A;  2PZ1 A;  4E7L A;  1GXI E;  3VRZ A;  4AG1 C;  2Y90 A;  1VQP Q;  5EC7 A;  3OS2 A;  3CC7 Q;  3JB9 I;  2OTJ T;  2X4J A;  3V7R A;  1OPK A;  3H0H A;  1ACM B;  2QDL A;  1VQ5 Q;  2CP7 A;  2EKO A;  3OSV A;  4XTV A;  1JB0 E;  3CMA A;  1I0C A;  2CRE A;  4F7U G;  3CXC P;  3HKS A;  4C92 E;  1WQ7 A;  2D9T A;  2DMO A;  2F2X A;  1O75 A;  4HCK A;  5GMK m;  2EVR A;  3CC7 T;  1ZHI A;  2DIL A;  4XQ3 A;  2XHC A;  4RUG A;  2YUO A;  3CXC A;  2P0K A;  2CYZ B;  3SWN C;  5HKC A;  2QDY B;  2DXU A;  5GMK l;  4LXC A;  2QI2 A;  3L2V A;  5I21 A;  2VYT A;  5KCO A;  4L5G A;  1TSF A;  2VKN A;  1SG5 A;  1AWX A;  4XTX A;  3OW2 P;  1YFN A;  1MMG A;  1C0M A;  5GAO n;  2DAQ A;  2V1Q A;  1FX7 A;  3L42 A;  2L3S A;  2W10 A;  1G83 A;  4X9C A;  5LJ3 d;  1R77 A;  1YCS B;  1MMA A;  1VQ7 A;  5I22 A;  2DYI A;  2E6Z A;  4WF2 A;  2VWF A;  2DVE A;  1EZZ B;  1G3Y A;  4KGX B;  1PRM C;  4M75 E;  4C92 C;  4L59 A;  4FSX A;  2C0O A;  2X35 A;  1D3B A;  1N5Z A;  1BBZ A;  2VVK A;  3EAE A;  4HCC A;  1QVG S;  4ZN1 A;  3V8L A;  5IHN A;  5CK9 A;  4Y28 E;  4Z8A A;  4A4K A;  3NGP A;  4PNO A;  2DL5 A;  3QDR B;  3RNJ A;  3BFM A;  1T3S A;  1WQW A;  2LNH B;  2E64 A;  1BYM A;  1UGR B;  5CKB A;  1M3A A;  4ZGD B;  4DEY A;  1ZSZ A;  1XTD A;  2YUQ A;  3HFO A;  3JAM E;  3MJX A;  3VS3 A;  1M2V A;  5FU7 C;  5IH2 A;  5I2M A;  4E7H A;  1K73 U;  1NPP A;  2K3X A;  1QCO A;  4RTZ A;  2L2P A;  1U1T A;  1KQ2 A;  3CCV A;  2G6F X;  3JB9 H;  2JXB A;  1WDX A;  4OMN A;  2GBQ A;  3KBG A;  4RKU E;  3PE0 A;  4X1V A;  4PFP A;  1KC8 U;  4XU1 A;  4M75 C;  3VS1 A;  1X69 A;  4D8K A;  2RJD A;  2FB7 A;  2EYQ A;  2FL7 A;  1SHG A;  2OI3 A;  3DB3 A;  3GLX A;  2NYS A;  3UAT A;  1IO6 A;  4F7U B;  3QPH A;  2ECZ A;  4WTO B;  1RLP C;  2QYZ A;  4FW2 A;  1H92 A;  2D8J A;  4N0A C;  2P0Q A;  5L8R E;  1T0H A;  2A3L A;  2YRV A;  2D0Q B;  2JT4 A;  2RI3 A;  3PMI A;  2EJ9 A;  1ZBJ A;  4N4G A;  2KDS A;  5FU6 C;  1T0J A;  2EJG A;  1VQ6 A;  4D8D A;  1Q82 U;  2ENM A;  5IN1 A;  4LNP A;  1RAF B;  3EHR A;  4QQD A;  4AFS C;  5ECA A;  3QUI A;  2KK4 A;  4Z89 A;  4PJO A;  2CH4 A;  1UB4 A;  1WFW A;  2X4Y A;  1FMV A;  1MHN A;  3C94 A;  3PVQ A;  1HD3 A;  2E10 A;  4PJL A;  1TG0 A;  4A63 B;  5LJ5 e;  4FSS A;  3PIP A;  1KQS P;  1BI2 A;  4MZM A;  3CC2 Q;  4LN2 A;  5CO7 A;  1N8R U;  1U8R A;  2WSF E;  3QWX X;  1YJ9 Q;  2IG0 A;  3M9Q A;  5AYF A;  2QQA A;  5A0D A;  1KQS A;  2DRK A;  5GAM e;  1V76 A;  8AT1 B;  4J83 A;  4ME7 A;  4JLG A;  3X26 B;  4OMP A;  3CC2 T;  4JDS A;  3CCJ Q;  2EBP A;  2FZK B;  2HKN A;  2MK5 A;  4C0D C;  4RMO A;  2J6K A;  1QCN A;  2DK3 A;  6AT1 B;  1YJ9 T;  2JJ9 A;  2ZCF B;  2MWO A;  3LWI A;  5FRN A;  3GBQ A;  2LT4 A;  5KYN A;  2LT1 A;  2MAM A;  3CCQ A;  1BK2 A;  1AHJ B;  1V29 B;  1W2B S;  4M78 F;  3VJP A;  1C1A A;  2M16 A;  1SHF A;  1M8V A;  5GAM g;  4LDU A;  4LUD A;  3CCJ T;  5CKE A;  3A8L B;  4C5I A;  2KY9 A;  1PHT A;  3M0R A;  1RI0 A;  3PIO A;  3JB9 J;  1K73 R;  1YCY A;  2K3Y A;  1YP5 A;  5GAN 7;  2RB6 A;  2EQK A;  2C0T A;  4KH0 B;  1WHG A;  3FJ5 A;  2QQS A;  1R0B G;  2CT4 A;  5A0G A;  3QKJ A;  1EFN A;  4L6V 5;  4JJB A;  3RES A;  4PJO D;  2QQ9 A;  4IKF A;  3CC4 A;  4E7J A;  1B7T A;  5HK0 A;  3H0I A;  3L2Z A;  2J06 A;  3O5Z A;  4JPB W;  3I56 Q;  3I9Q A;  3OB9 A;  3L2U A;  2YXY A;  1VQN Q;  4XTW A;  1SRM A;  2ED0 A;  3PGG A;  2CZ7 B;  4M77 G;  3QZ9 B;  3OS0 A;  1ZSZ B;  2QQB A;  4LD9 K;  3N5B B;  4FIB A;  2HD0 A;  2DBM A;  2EQU A;  1FXX A;  3EFS A;  2P4R A;  1OX9 A;  3OYM A;  1Q86 R;  2DYB A;  2OAU A;  4V2S A;  4KH1 B;  2NUT B;  4C8Q F;  3I56 T;  2KR3 A;  3GIB A;  3JCM c;  1VQN T;  1ZQ1 A;  1Q82 R;  5EG2 A;  5GAN e;  2QAS A;  4PLI A;  2QXF A;  1M3B A;  2KRM A;  3S3O A;  1BIB A;  9ATC B;  1NLO C;  2RJC A;  5IT9 E;  1X6O A;  2LMJ A;  1Y71 A;  5GAM d;  4FW1 A;  3CME Q;  1GCP A;  3CPW P;  2A7Y A;  2ATC B;  1M5Q 1;  1LPL A;  3JB9 F;  1YJN Q;  2R57 A;  2AZS A;  3DB4 A;  4M77 D;  3OY9 A;  1KG1 A;  2LQN A;  2HDA A;  1QWE A;  1IRX A;  3LX7 A;  1VQK Q;  2KMT A;  2IPO B;  2ZAE A;  3H8Z A;  3WVD B;  2YDL A;  1JO8 A;  5GAN g;  1NYF A;  3M0T A;  2ESW A;  3CPW A;  1Y57 A;  1WHH A;  3M0Q A;  1RL2 A;  3MEA A;  1WZO A;  3CCM Q;  1IGU A;  1G2B A;  3PT9 A;  1ARK A;  2PVO B;  2LQ8 A;  4B6M A;  2OX7 A;  4C0Z A;  4M7D E;  3LH5 A;  1VQK T;  1MMD A;  2YWW A;  3M54 A;  5GMK j;  3RUX A;  1K73 C;  3RKY A;  1JQQ A;  5LJ5 j;  5CKH A;  3X24 B;  4BE1 A;  4HA8 A;  3CCM T;  2AZV A;  1Y96 B;  2E1H A;  1RI9 A;  2XG8 D;  3CCL Q;  4XAX B;  1S72 T;  5GJV B;  5GAO q;  2CSQ A;  2EYY A;  1E6G A;  1UJY A;  4E47 A;  3RER A;  2MPX C;  2DJZ A;  4M7A F;  2PVG B;  1KFZ A;  2X9H A;  4GLK A;  2KQW A;  2ZPE B;  2AKL A;  4FU6 A;  4E7Z A;  5KYU A;  4HKE A;  3MP8 A;  1VQM A;  3MCA B;  3CCL T;  3CCU A;  2X4W A;  4MDX A;  3V7C A;  4ZGJ B;  1NG2 A;  2CZ0 B;  1WJR A;  3ULR B;  2EQI A;  2MMP A;  1VQ8 Q;  1D09 B;  1VUB A;  4M7D C;  1Q86 C;  5GAN d;  1VQO Q;  2OTL Q;  4J7I A;  1M90 R;  1ZA2 B;  1Z9Z A;  1CSK A;  1Q82 C;  3J81 E;  2WSC E;  1VQ9 Q;  1GRI A;  2AKK A;  7AT1 B;  4M77 B;  1Q7Y U;  3RIR A;  1WGS A;  2HKQ B;  2DTH A;  2SEM A;  1AOJ A;  1WHK A;  3KXT A;  2RA2 A;  2RQU A;  1JBM A;  1VQ8 T;  1SSH A;  3CCS A;  2DXC A;  2JTE A;  2CP3 A;  2QA4 A;  3OYC A;  3EGX B;  1VQO T;  2OTL T;  3NFC A;  1IZ6 A;  3QWY A;  1NLP C;  2CT3 A;  1K9A A;  2E12 A;  5CR2 A;  2DFU A;  1VQ9 T;  4PJM A;  4LDV A;  2O9S A;  3M58 A;  3HPW A;  3R6N A;  4JJC A;  1X6B A;  4RCC A;  5HY6 A;  2OJ2 A;  2D8H A;  5CAI A;  2K5L A;  3QHS A;  2GTJ A;  4II1 A;  2X3W D;  2DTO A;  2FRW A;  2MF2 A;  2B8A A;  2RNA A;  4Y91 A;  2CUB A;  2KAF A;  4RG8 A;  3ME9 A;  3KFV A;  3I55 Q;  1K8A R;  1EX4 A;  1VQL A;  5A2Q E;  1IHW A;  1MMN A;  4PK4 A;  2CUD A;  2J6F A;  2ROT A;  3TCJ A;  1YWO A;  2E41 A;  2K2M A;  4F7U E;  2E3I A;  4Z88 A;  1AWJ A;  2DBK A;  2LQW A;  1G3W A;  1YIJ Q;  3G4S T;  2MWP A;  2EYX A;  1TTH B;  2OTJ A;  3FC3 A;  1QVP A;  3VS7 A;  5FW9 A;  3IQL A;  3I55 T;  1QVF P;  3NPF A;  4KUI A;  3X25 B;  3JCM h;  2DEU A;  3GOX A;  2PQW A;  2BZY A;  3P8D A;  5CKF A;  3J80 E;  1OU9 A;  4IUQ A;  2RI5 A;  1YIJ T;  2XKO C;  1QVF A;  4IUP A;  3OMC A;  1TU0 B;  1OX8 A;  1VQP A;  3CC7 A;  3M0S A;  1BI1 A;  4K11 A;  1RAE B;  1VQ5 A;  5KYX B;  2EYW A;  3PVL A;  2VB6 A;  2W0Z A;  2DPP B;  3TSZ A;  3EG9 B;  5LL6 S;  2E3H A;  3D7S B;  1KK7 A;  2VGN A;  5CQY A;  2M02 A;  2R5M A;  1M90 C;  5HCK A;  2CP6 A;  2YLB A;  2JS2 A;  2DER A;  4B9X A;  1GL5 A;  4CC2 A;  1JXM A;  1JXO A;  1HK9 A;  4BI4 A;  3VS6 A;  2BKD N;  1BI0 A;  2DD5 A;  4BD3 A;  4J9I A;  2KI7 A;  5CIU A;  3H41 A;  3EFR A;  2HQH A;  2P84 A;  3QYG B;  1MV0 B;  3H9N A;  3P8H A;  4X34 A;  2RO0 A;  2L89 A;  1V1C A;  3OW2 A;  3C4S A;  4A4F A;  1W70 A;  2DEQ A;  1SRL A;  4BI8 B;  1Q7Y R;  2LRQ A;  1AWW A;  4MML A;  1GFC A;  4BAC A;  4C92 F;  2RK2 A;  2A37 A;  1ZA1 B;  2ZGW A;  1QKW A;  1UGV A;  2V1R A;  1QLY A;  1JJ2 S;  1N9S A;  1B34 A;  4ESR A;  2DF6 A;  3HTR A;  1YHQ Q;  4CC7 A;  2Z0W A;  2EGC A;  4XK8 E;  5D6X A;  4E7S A;  1OYX A;  4IUV A;  1K8A C;  5KYU B;  1UEB A;  2EAY A;  2R58 A;  5IHI A;  1UJ0 A;  4XU3 A;  3M55 A;  2LDM A;  3I5R A;  2RQR A;  3E9F A;  1WIE A;  1B07 A;  2YHT A;  3QO3 A;  3GPL A;  3ZFJ A;  1K1Z A;  2RQT A;  1YHQ T;  1X27 A;  3EFO B;  4JZ4 A;  2NUP B;  4LUE A;  3PNW C;  3G71 Q;  2KYM A;  1PKS A;  2YRD A;  2NUT A;  4FT2 A;  2RK1 A;  4A53 A;  2LQK A;  2GFA A;  1SKU B;  1WA7 A;  4GBQ A;  2HL3 A;  2K5F A;  2HNI A;  1M1F A;  1WLP B;  4QT7 A;  5LJ3 j;  1E6H A;  3M5A A;  1U5S A;  4M75 F;  1D0Z A;  2HBP A;  1KHC A;  2RN8 A;  3MP1 A;  2LX7 A;  3G71 T;  3JV3 A;  1HJD A;  4N4I A;  4OP0 A;  1VA7 A;  2FRY A;  3MO8 A;  4OMQ A;  3CD6 Q;  2XDP A;  1AZE A;  2F5T X;  2NLU A;  3FB9 A;  1N9R A;  4PFZ A;  2XMF A;  1BB9 A;  5C0M A;  3JCM V;  2P4T A;  3CPF A;  3SWN B;  2HZY A;  2NWM A;  2QEX Q;  1Q81 R;  5GMK h;  1G3T A;  5A0L A;  3QBY A;  3V7S A;  4J6Y A;  1Q95 G;  1H8K A;  4J6X A;  1RAI B;  5LJ5 h;  3VV0 A;  4AMC A;  1Q86 U;  2GTO A;  5CQX A;  4M78 A;  1NPR A;  4F17 A;  2E70 A;  3CD6 T;  1BCM A;  3MPU B;  4HVW A;  1M1K R;  2YUN A;  2QEX T;  2MI6 A;  4HT8 A;  2DVJ A;  1Y96 A;  4OGC A;  3QJ6 A;  1Q7Y C;  2RHX A;  1BCO A;  2EYZ A;  1D1C A;  4E6R A;  1LCK A;  2KT1 A;  3RR6 A;  1OPL A;  3MET A;  2KE9 A;  1ZSZ C;  1ZUK A;  1UG1 A;  3AT1 B;  4F16 A;  3OYN A;  4E2F B;  4JJD A;  3Q1J A;  2OAW A;  3TSW A;  2DO3 A;  1C6V X;  4LD6 A;  1HXD A;  4OB3 B;  4PJO E;  2EFI A;  2DKG A;  1AWO A;  4OVA A; 
#chains in the Genus database with same CATH homology
 4E7I A;  3H6Z A;  1M1G A;  4XTY A;  3LX7 A;  2KMT A;  4IUU A;  4C92 D;  2DXB A;  5GAO p;  2M9U A;  5CCA A;  1K9M C;  3H8Z A;  2CZ6 B;  3CBP A;  3WVD B;  1N8R C;  3LH0 A;  5GAN g;  3CC2 A;  3MEW A;  3UT1 A;  3CPW A;  1YIT A;  2AHJ B;  3LLR A;  4JS4 A;  4KUD K;  4M78 G;  5IAY A;  3FJP A;  1QP2 A;  1RL2 A;  3MEA A;  5J39 A;  1YHQ A;  3QXE B;  3WVE B;  5FU7 B;  4BE2 A;  1YJ9 A;  3G4S A;  2DZ9 A;  3X28 B;  3PT9 A;  4C8Q A;  2PVO B;  4MMK A;  2LQ8 A;  3S3N A;  4M77 A;  4LDW A;  2LX9 A;  3G7Z A;  3OBW A;  3LW5 E;  4M75 G;  5GMK i;  4C0Z A;  4M7D E;  1VQK T;  1YI2 A;  3FEO A;  1VQL T;  1VQ4 A;  3INZ A;  2D6F A;  1P92 A;  2V8K A;  1BIA A;  1TH7 A;  4ELZ C;  1WPY A;  3QJY A;  3L1A A;  3M54 A;  5C6S A;  5LJ3 g;  2E65 A;  5GMK j;  2BIV A;  1NJI U;  2FYK A;  4FL6 A;  3QZ5 B;  2E6N A;  3OBY A;  3RUX A;  4BE0 A;  5DY9 A;  3CCJ A;  1K73 C;  2O4X A;  3BW1 A;  2EQJ A;  3RKY A;  5LJ5 j;  4XU2 A;  5CKH A;  2FHD A;  2VXF A;  5J3B A;  3X24 B;  4BE1 A;  4IUR A;  4EMH A;  2P0P A;  4E7L A;  1GXI E;  4HA8 A;  3CCM T;  2PUK B;  3GP8 A;  1Y96 B;  2GFU A;  4C5G A;  3M53 A;  3G71 A;  2Y90 A;  3OS2 A;  2OTJ T;  3M59 A;  3JB9 I;  2E1H A;  2X4J A;  2V8I A;  2XG8 D;  3V7R A;  3CCV T;  3CCQ T;  1YBY A;  4XAX B;  3RMQ A;  3CXC S;  4VUB A;  1S72 T;  5GAO q;  2QTX A;  4LDY A;  3CEY A;  4M78 D;  2EKO A;  3OSV A;  4XTV A;  2ZPB B;  1JB0 E;  3CMA A;  2DIQ A;  4J6W A;  2E5Q A;  4E47 A;  4PJO C;  2RHU A;  2XK0 A;  1Q81 C;  2CKK A;  3RER A;  2DJZ A;  4F7U G;  4M7A F;  2PVG B;  4NS5 A;  3HKS A;  3HHT B;  4C92 E;  5D6W A;  1WQ7 A;  4ATO A;  4GLK A;  2KQW A;  2ZPE B;  2VXE A;  2D9T A;  2CS7 A;  2YLC A;  2ZPG B;  4M75 D;  1O75 A;  4QW2 A;  3E9G A;  4FU6 A;  4ZN3 A;  1B34 B;  4R55 A;  4HKE A;  4X9D A;  3FRN A;  3MP8 A;  1VQM A;  1M90 U;  2XIC A;  3MCA B;  5GMK m;  3CC7 T;  3JCM d;  3VYG A;  1ZHI A;  2Y4X A;  4XQ3 A;  3CCL T;  3JCM W;  3S6W A;  3CCU A;  1XQH A;  2X4W A;  3AHU A;  2XHC A;  5FU6 B;  3L2W A;  4MDX A;  5GAN f;  3V7C A;  2RI2 A;  4ZGJ B;  3CXC A;  2HQX A;  4EPC A;  4OF1 A;  2P0K A;  2CZ0 B;  5I2S A;  2F69 A;  3CD6 A;  1WJR A;  4C8Q G;  2MMP A;  2CYZ B;  3OYH A;  1M1K C;  3SWN C;  3BDL A;  3SDZ A;  1VUB A;  5HKC A;  2QDY B;  4OB0 B;  3OYA A;  2DXU A;  4R56 A;  3C12 A;  3VUZ A;  2QEX A;  4M7D C;  5GMK l;  1I5L A;  1Q86 C;  5GAN d;  2QI2 A;  3L2V A;  4A4H A;  4J7I A;  5GAN 5;  3OYG A;  4NL2 A;  5I21 A;  2VYT A;  3UDC A;  5KCO A;  4L5G A;  1Q82 C;  3QG1 A;  5GAM h;  3J81 E;  2WSC E;  5LJ3 f;  3T9N A;  3I56 A;  4M77 B;  1Q7Y U;  5GAN 3;  3RIR A;  1VQ6 T;  1WGS A;  1VQN A;  1PSF A;  4XTX A;  4C92 B;  2DTH A;  3JB9 G;  2ZPH B;  5GAO n;  3QSU A;  2DAQ A;  3KXT A;  1FX7 A;  2RA2 A;  5DM7 R;  3L42 A;  4M7A A;  1JBM A;  1VQ8 T;  1WJS A;  4XU0 A;  4JUV A;  3CCS A;  2DXC A;  2V8J A;  4X9C A;  5LJ3 d;  2GF7 A;  2O4X B;  2R5A A;  4M78 E;  3FLG A;  2QA4 A;  3HRT A;  3OYC A;  1VQO T;  1VQ7 A;  2OTL T;  3MEV A;  3OMG A;  5GMK e;  3NFC A;  1IZ6 A;  1XOV A;  2E6Z A;  3OYD A;  4M77 C;  4WF2 A;  2RH2 A;  2E12 A;  2DVE A;  5CR2 A;  2H3J A;  2PUO B;  1G3Y A;  4C5E A;  4C8Q D;  4HT9 A;  1VQ9 T;  4M75 E;  2JUF A;  4C92 C;  4JJN K;  3X20 B;  4LDV A;  3A8H B;  4Z02 A;  4FSX A;  4L59 A;  3OA6 A;  4KUL A;  2X35 A;  3ER0 A;  3HPW A;  3M58 A;  3A8G B;  1JRI A;  4FM4 B;  4RCC A;  1D3B A;  2LTO A;  2JVV A;  5HY6 A;  3ZBD A;  3FDR A;  3LYI A;  3EAE A;  4EDU A;  5CAI A;  1I8F A;  3KUF A;  3QII A;  4HCC A;  1QVG S;  4RCB A;  2K5L A;  3QHS A;  4A4E A;  4EMG A;  2WSE E;  4ZN1 A;  3DLM A;  4II1 A;  2LNV A;  4C0F A;  2DTO A;  3V8L A;  5KCH A;  5GAO m;  2RJF A;  4ZTJ A;  2MF2 A;  3CME A;  4C0D B;  5CK9 A;  4Y28 E;  2B8A A;  3HRS A;  4OMF B;  4A4K A;  2EJF A;  3JRZ A;  4PNO A;  4Y91 A;  3HRU A;  2RHY A;  3QDR B;  3JB9 D;  4EMK A;  5J26 A;  3OYJ A;  1YJN A;  3BFM A;  2KAF A;  4RG8 A;  3ME9 A;  4YTL A;  1WQW A;  1PSE A;  2E64 A;  1VQK A;  3CCE T;  1BYM A;  1UGR B;  5GAN 8;  1VQL A;  5A2Q E;  4N4H A;  5CKB A;  4HCB A;  5DLO A;  1I4K 1;  4M78 B;  4P5N A;  4ZGD B;  3TCJ A;  5LJ5 g;  2EWN A;  4J8O A;  5GAO l;  2DZC A;  1XTD A;  2E41 A;  3L2R A;  2DTI A;  3E19 A;  4F7U E;  3HFO A;  3JAM E;  1QVG A;  3JSC A;  5FU7 C;  1G3W A;  4QVD A;  3GNG A;  3VUB A;  5I2M A;  4D6W A;  4M75 B;  4E7H A;  3CCM A;  1K73 U;  1QVF S;  3G4S T;  1XNI A;  4PJO G;  1NPP A;  1WJQ A;  2K3X A;  2MWP A;  4PL6 A;  5HK3 A;  4M7A G;  4BDY A;  1U1T A;  3JCM b;  1KQ2 A;  2OTJ A;  2K2V A;  3CCV A;  3FC3 A;  1QVP A;  2ZZD A;  3I55 T;  3JB9 H;  1M9S A;  4M78 C;  4A54 A;  5GAO r;  2QQR A;  4KUI A;  3M57 A;  3X25 B;  3JCM h;  3NTH A;  2M1H A;  3A5Z B;  4UC4 A;  3OS1 A;  1G5V A;  3KBG A;  2JN0 A;  4RKU E;  4C8Q E;  2PQW A;  3GOX A;  2XDB A;  3P8D A;  1KC8 U;  4M77 E;  5CKF A;  3JCM f;  4XU1 A;  1KG1 A;  3J80 E;  4PJO F;  2XID A;  1I81 A;  4IUQ A;  4M75 C;  2RI5 A;  4ZTF A;  5GAM j;  4JRQ A;  1YIJ T;  2RJD A;  1R8O B;  2FB7 A;  1W4S A;  2EYQ A;  2FL7 A;  3DB3 A;  4JRP A;  2XKO C;  1QVF A;  2GQV A;  3GLX A;  4IUP A;  3OMC A;  3CCR T;  1VQP A;  1QP3 A;  3CC7 A;  5FLX E;  5GAN h;  5GAN 2;  1BI1 A;  4M7D G;  3CCL A;  1Y7X A;  1KD1 U;  1VQ5 A;  4F7U B;  3QPH A;  2M0O A;  3SD4 A;  1D3B B;  2DPP B;  3OS5 A;  2RD1 A;  3R6O A;  3VKI A;  3JCM X;  1OZ2 A;  5LL6 S;  2JOY A;  1VIF A;  4M7A D;  5CVI A;  2VGN A;  5CQY A;  4N0A C;  2P0Q A;  4MZT A;  3V8J A;  3TRE A;  2Y4Y A;  2R5M A;  5L8R E;  1M90 C;  2A3L A;  3CC4 T;  2YRV A;  2BUD A;  2K57 A;  2RM4 A;  3ZEH A;  3G6E T;  2YLB A;  2D0Q B;  4ZGE B;  4M7D F;  2RI3 A;  3PMI A;  2EJ9 A;  3OYL A;  4HCZ A;  5LJ3 h;  4ELY C;  4N4G A;  3OYB A;  3OW2 S;  2KDS A;  3LWH A;  2DD4 A;  2ZPF B;  3MEU A;  5FU6 C;  4C5H A;  4B9X A;  4XTU A;  4C8Q B;  2RHI A;  2EJG A;  1VQ6 A;  1BI3 A;  3UPU A;  1Q82 U;  1HK9 A;  4BI4 A;  5IN1 A;  4J5Y A;  2BKD N;  1BI0 A;  2DD5 A;  4BD3 A;  3JCM Q;  1N27 A;  4QQD A;  3QUI A;  4BUG A;  2KK4 A;  1VQ8 A;  4PJO A;  3M4Y A;  3OY9 A;  1K8A U;  2O01 E;  2KVQ G;  2PVD B;  5CIU A;  3LGL A;  1UB4 A;  3PTA A;  3SB2 A;  5LJ5 d;  3BY7 A;  2RJE A;  2X4Y A;  3EFR A;  4CRI A;  1KHI A;  3QYG B;  4O5V A;  1H64 1;  1VQO A;  1MHN A;  5CKD A;  3A8O B;  3C94 A;  2OTL A;  3P8H A;  4X34 A;  4BDZ A;  4DA4 A;  4C8Q C;  2RO0 A;  3OYF A;  2L89 A;  3OW2 A;  3C4S A;  1VIE A;  2E10 A;  2LCC A;  4A4F A;  1KQS S;  4BY6 B;  2DEQ A;  4M77 F;  4BI3 A;  4J7F A;  4BI8 B;  1VQ9 A;  2LRQ A;  5DLQ E;  3URG A;  4MML A;  5LJ5 e;  4BAC A;  4C92 F;  4C0G A;  2RK2 A;  4KT0 E;  3JCM J;  5GAN 6;  3PIP A;  2ZGW A;  1BI2 A;  4MZM A;  2HAX A;  3SWN A;  3M56 A;  4QQG A;  1K9M U;  1JJ2 S;  4JRK A;  4JRI A;  1UGQ B;  1N9S A;  5CO7 A;  1B34 A;  4QVC A;  3DKM A;  4M7D A;  1N8R U;  2HQE A;  2XDD A;  1U8R A;  2GCX A;  2WSF E;  1YJW T;  5D6X A;  4XK8 E;  4BY6 C;  4M7A E;  1OYX A;  4IUV A;  1K8A C;  2IG0 A;  1UEB A;  1SSF A;  5LJ3 e;  3M4G A;  5KE3 A;  3M9Q A;  5AYF A;  2EAY A;  3HL8 A;  4MDW A;  2QQA A;  2R58 A;  5A0D A;  1KQS A;  1O9S A;  2WAC A;  3VYH B;  1OZ3 A;  3CCE A;  5GAM e;  5FRM A;  2K5I A;  4XU3 A;  4J83 A;  1G3S A;  3M55 A;  4ME7 A;  2LDM A;  1U1S A;  4JLG A;  2ZPI B;  3X26 B;  3SFM A;  3E9F A;  3PFS A;  5GAN 4;  3CC2 T;  4JDS A;  4QVZ A;  2YHT A;  1YIT T;  1MGQ A;  3QO3 A;  1X01 A;  4C0D C;  3GPL A;  3ZFJ A;  4RMO A;  1JJ2 A;  3CME T;  4XTZ A;  5GAN j;  1YHQ T;  2DK3 A;  1M4Z A;  1YJ9 T;  3HFN A;  2ZCF B;  2VGM A;  3PNW C;  1N6A A;  2MWO A;  4BB7 A;  3LWI A;  3OYE A;  3S3M A;  1YJN T;  4FT2 A;  5FRN A;  2LT4 A;  4OGE A;  2RK1 A;  2LT1 A;  4MZP A;  4A53 A;  1QW1 A;  2RHZ A;  2MAM A;  3I55 A;  2JTM A;  2LQK A;  1AHJ B;  3NTI A;  4C92 A;  3O8V A;  3CCQ A;  2GFA A;  1YI2 T;  1NJI C;  1VQ4 T;  1V29 B;  3QYH B;  4QQ6 A;  1W2B S;  1S72 A;  4M78 F;  3VJP A;  2C06 A;  2VUB A;  3GNF B;  2K5F A;  2M16 A;  1M8V A;  3DLL A;  2HNI A;  5GAM g;  1M1F A;  4Q5W A;  5KE2 A;  4LDU A;  3CCJ T;  4PJO B;  4M7A B;  5CKE A;  5LJ3 j;  3A8L B;  1OI1 A;  4C5I A;  3M5A A;  2KY9 A;  2L8D A;  2XI9 A;  1LOJ A;  1YIJ A;  1Q81 U;  4M75 F;  1RI0 A;  2CZ1 B;  2HBP A;  1KHC A;  3OYY A;  3PIO A;  3JB9 J;  4E7K A;  3MP1 A;  2DXT A;  1YCY A;  2K3Y A;  2XU8 A;  3OYI A;  3CCR A;  2L5Q A;  3G71 T;  2EIF A;  4DOW A;  2RB6 A;  1BKB A;  5GAN 7;  2EQK A;  4N4I A;  4OP0 A;  3F70 A;  1FWZ A;  4NOY A;  3TEE A;  1ZBX A;  1KC8 C;  3MO8 A;  2QQS A;  2G3R A;  2KSS A;  3OYK A;  4PKC C;  2JTF A;  2XDP A;  1W2B A;  2XD0 A;  2L3R A;  3CMA T;  2F5T X;  2NLU A;  4M7A C;  3FB9 A;  1N9R A;  5A0G A;  3QKJ A;  2VC8 A;  5C0M A;  3JCM V;  4L6V 5;  2P4T A;  3CPF A;  3RES A;  4PJO D;  2K4Y A;  3MP6 A;  3SWN B;  1EIF A;  2QQ9 A;  4O6J A;  4IKF A;  3CC4 A;  1M1K U;  5GMK h;  1G3T A;  5A0L A;  3PMT A;  3QBY A;  3G6E A;  3V7S A;  3WXM B;  3L2Q A;  4E7J A;  3J7A F;  4J6Y A;  4M7D B;  4TVR A;  2JZ2 A;  2JNG A;  5HK0 A;  4NL3 A;  4J6X A;  4FT4 A;  1VQM T;  1KD1 C;  1VQP T;  3L2Z A;  5KH6 A;  3CBO A;  5LJ5 h;  3VV0 A;  1LJO A;  4DOV A;  2DIG A;  3LGF A;  1Q86 U;  1Y07 A;  3TU4 K;  4EMK B;  3CCU T;  1VQ5 T;  5CQX A;  2IVW A;  3OB9 A;  3L2U A;  5D6Y A;  4F7U F;  5LJ5 f;  1UGS B;  1LNX A;  4M78 A;  4OB2 B;  4XTW A;  3PGG A;  1NPR A;  2CZ7 B;  2FVU A;  2E70 A;  3CD6 T;  1DJ7 B;  2LCL A;  3BDU A;  3V8K A;  1UGP B;  2X4X A;  4M77 G;  2LC4 A;  1NE8 A;  4PLL A;  3QZ9 B;  3JCM e;  2CGH A;  5FRO A;  3OS0 A;  3HP9 A;  3OQ5 A;  2QQB A;  4C92 G;  4LD9 K;  3MHX A;  2F5K A;  2QEX T;  2MI6 A;  3N5B B;  4M75 A;  4LDX A;  4FIB A;  4B9W A;  3JCM P;  2HD0 A;  4HT8 A;  2EQU A;  1Y96 A;  4OGC A;  1FXX A;  4RG2 A;  3QJ6 A;  4M7D D;  3EFS A;  1H3Z A;  3OYM A;  3NTK A;  3UWN A;  4EMK C;  2RHX A;  1Q7Y C;  2OAU A;  4V2S A;  4OB1 B;  3A8M B;  4C8Q F;  4KBM B;  4A4G A;  3I56 T;  2PU9 B;  3E1S A;  4CI0 C;  3GIB A;  3JCM c;  5GAM f;  1ZQ1 A;  1VQN T;  3ASK A;  5EG2 A;  5GAN e;  3VU3 C;  2I2L A;  3RMS A;  3MET A;  4GY5 A;  4PLI A;  2QXF A;  3RKX A;  2VV5 A;  1KQ1 A;  1X75 C;  3CPW S;  3OYN A;  5M9O A;  2EQM A;  4JLI A;  1BIB A;  3CBM A;  1WNL A;  3CCS T;  3S3O A;  2RJC A;  3Q1J A;  4N0A A;  3C95 A;  2QA4 T;  1X6O A;  5IT9 E;  1Y71 A;  3JCM g;  5GAM d;  1VQ7 T;  3HSB A;  2DO3 A;  3FIF A;  3RKW A;  1YJW A;  4IUT A;  2A7Y A;  2LVM A;  1HXD A;  1M5Q 1;  4LD6 A;  4OB3 B;  4PJO E;  2EFI A;  2DKG A;  4DQ2 A;  3JB9 F;  4JS5 A;  1IRE B;  3P8B B;  3OSS C;  4OVA A;  2R57 A;  3GF5 A;  3DB4 A;  4M77 D;  1NZ9 A;  4F7U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...