4M7AE

Crystal structure of lsm2-8 complex bound to the 3' end sequence of u6 snrna
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
81
structure length
75
Chain Sequence
b'PEILPLEVIDKTINQKVLIVLQSNREFEGTLVGFDDFVNVILEDAVEWLIDNEKVMQHHGRMLLSGNNIAILVPG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords U6 snRNA-associated Sm-like protein LSm8
publication title Crystal structures of the Lsm complex bound to the 3' end sequence of U6 small nuclear RNA.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Rna binding protein
total genus 12
structure length 75
sequence length 81
chains with identical sequence L
ec nomenclature
pdb deposition date 2013-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4m7aE00
2E64A 2EJFA 3JCMV 5GAN3 4JRIA 4C8QC 5GMKl 1B34B 4XTYA 2EWNA 3SWNB 2RA2A 4C92G 5LJ5e 5GAOm 4HT9A 3L1AA 1N9RA 1WPYA 4M78A 1M5Q1 4PJOA 4V2SA 4M75B 4M7DG 2EJ9A 4F7UF 1I81A 1I4K1 3RKXA 4M77D 4PNOA 4M78E 5LJ5f 3QUIA 2VXEA 4M7AA 1JBMA 5GAOl 5GANd 1HK9A 2RB6A 2YLBA 4MMLA 3AHUA 4PJOG 1N9SA 4M75E 5LJ3f 2EJGA 4XU2A 1WQWA 4C92B 3JB9I 4C8QD 5GAOn 2DJZA 4M7AE 3V8LA 3V8KA 2VC8A 4M7DB 4XTUA 5GAMh 5GMKi 5GANh 4M7DC 3JCMh 3FB9A 4XQ3A 5GAOp 2RM4A 3JCMc 2DZCA 4C92C 4C92E 4EMKA 2YHTA 3V8JA 4RCBA 4C8QF 3JCMP 4M78B 4PJOB 2DVEA 1BIAA 3SB2A 3BDUA 5GAMj 5GANj 3JB9G 1KQ2A 4X9DA 3PGGA 3JB9H 3JCMW 2VXFA 1U1SA 3V7RA 4XTZA 5GAMd 3JCMd 2HNIA 3JCMg 5GAMg 2E65A 5LJ3e 3HFOA 5GANg 4M77A 2EAYA 4J6XA 2CGHA 2DTOA 4J5YA 4M7AB 3V7SA 2DEQA 4M7DE 3FIFA 4M78C 3JCMb 3SWNC 4PJOE 3RESA 3VU3C 5GAN8 4M75F 4M75C 4JLIA 1U1TA 5DY9A 3RIRA 5GAN7 4M7AC 4M77G 3HSBA 3M4GA 1HXDA 4XTXA 1M8VA 4A53A 3JCMJ 3JB9F 3V7CA 2E10A 4F7UA 4EMKB 5GAN5 1D3BA 2DXTA 1Y96A 2JN0A 4C8QG 4X9CA 1I8FA 4C92F 3BW1A 4MMKA 4XU0A 4XU1A 2DTHA 4M78D 5GMKh 3RERA 3QSUA 1BIBA 4M7DF 4XTWA 1LJOA 1LNXA 3HFNA 3JCMe 2ZGWA 2FB7A 2Y90A 4M75D 4M77B 4EMKC 1LOJA 4F7UG 4HA8A 5GAN6 5I21A 4N0AA 5GAOq 4J6YA 4A54A 3JB9J 3GIBA 1MGQA 4M7AD 5GMKj 1KQ1A 4M78F 4PJOF 1JRIA 3RUXA 4PJOC 3JB9D 2K57A 5GAMf 1YCYA 5GANf 3JCMf 2YLCA 2DTIA 4M77E 4XU3A 4C8QA 5LJ5h 4C92D 3BFMA 4RCCA 4M7AF 4J6WA 3QO3A 3BY7A 3RKWA 4M7DD 5LJ3h 4F7UB 1D3BB 1Y96B 3QHSA 4EMGA 4C8QE 3JCMX 1WNLA 5LJ5j 3L2ZA 5CAIA 4NL2A 1B34A 2DKGA 3EFSA 3SWNA 5LJ5d 5LJ5g 2DXUA 5LJ3j 3JCMQ 4PJOD 2I2LA 4HT8A 4QVDA 4F7UE 4M75A 5GMKm 5GAN2 5LJ3d 5GAMe 5GANe 5LJ3g 4NOYA 4Y91A 2E41A 1H641 4NL3A 5GAOr 3FJPA 4WF2A 2QTXA 4EMHA 4M78G 4OP0A 5GMKe 4DQ2A 2DZ9A 3INZA 5GAN4 1WQ7A 4C8QB 4M75G 3EFRA 4N0AC 1TH7A 3RKYA 4M77F 4M77C 4C92A 2E1HA 4QVCA 1I5LA 4M7AG 2RD1A 4JRKA 4XTVA 4M7DA 1X01A 4JUVA 2FYKA
chains in the Genus database with same CATH superfamily
5GAN3 4FYVB 2AK5A 4JS4A 1HSQA 1TXQA 3CD6T 5I22A 4M7DG 3RNJA 2D9TA 2QG9B 5EG2A 5KYYB 1G8XA 2OI3A 5AT1B 2FZGB 2JM9A 3EGDB 4XU2A 4BE1A 4J7IA 2E3HA 4ZGJB 4XTUA 5IHNA 2C0TA 4KGZB 1WYXA 1TG0A 3E19A 1G3TA 2K5IA 2L3SA 2AZVA 3JCMP 4PJOB 2EBPA 3JB9H 1PC0A 3FRNA 3L2WA 1NPRA 1K1ZA 2HDAA 3VS0A 2DTOA 4M78C 2D6FA 3RESA 3CCQT 4IKFA 4MZMA 3L2RA 1KC8U 4JRQA 2XK0A 3EHQA 1VQ9T 4FU6A 2K4YA 3MO8A 1BIBA 2LVMA 5KYUA 1G5VA 1UB4A 2J6KA 2O01E 3TREA 2K57A 3EH1A 5J3BA 2QK0A 4JRPA 4AFSC 1M2VB 2EQUA 3C0CA 3CXCP 3CCQQ 3RMSA 4C8QE 2XG8D 4R55A 3CBMA 4NL2A 2BZ8A 2D0NA 5GAOr 1JQQA 1SHFA 1T0HA 5FRMA 1M3AA 4OB3B 2QGFB 3VS1A 5KYYA 2HBWA 2X3XD 4DEYA 3EGDA 4QVCA 2DEUA 3M55A 1RAFB 1X01A 1UE9A 2M1HA 1VQLQ 2LJ1A 1ABOA 4PJOA 1VQ6T 1QVGP 4ORZA 5KCHA 4N4GA 4B9XA 4CI0C 4BE2A 1K9MC 2ABLA 3URGA 1NLPC 2P4RA 4C92B 3JB9I 4M7AE 2VGMA 5KYXB 4HCKA 2B8AA 5FU7B 2O4XB 1UEBA 1JU5C 2A7YA 4HVVA 4HKEA 4X9DA 5FWBA 2KBTA 3CPFA 1M2OA 3E9GA 3JV3A 1BYMA 2F2XA 4CC7A 3CCRT 4KULA 1D1CA 1X6GA 1VQ6Q 2DBKA 1M2VA 4XTXA 4R0KA 5IT9E 1SSHA 5GJVB 2JN0A 1NPPA 3VUZA 5CQYA 1EX4A 1K76A 4QKUA 1W1FA 1EIFA 5CKHA 1ZSZB 2Y90A 5GAN6 3F70A 4J9CA 1NM7A 1YIJA 2LRQA 4M78F 4RTUA 2JT4A 2NWMA 2X51A 1OX8A 1RUWA 2OX7A 3D7SB 1OU8A 3NMZC 1AVZC 4M7DD 1RI9A 3QHSA 2XICA 4PLIA 2ZPFB 1PSFA 5A0DA 4QVDA 1W6XA 2GFUA 3I9QA 4WF2A 3OS5A 2JMAA 3ER0A 1M3BA 4FYXB 1BK2A 1Z9QA 4C92A 1KHIA 2KRMA 3JSCA 3R6OA 2RD1A 3TU4K 5KYXA 2AKLA 1W70A 2ENMA 4C8QC 2O4XA 5A2QE 3QWYA 2MMPA 3WVDB 2EJ9A 4RUGA 4Z89A 4PNOA 2ESWA 4PLLA 2EGCA 2NYSA 3AHUA 1U8RA 4PJOG 2QASA 2RMOA 2OTJT 1GCQA 2J7IA 2HD0A 3CXCA 4DOVA 2VV5A 2QYZA 2LCSA 4BI4A 2Z0WA 3NFCA 2R57A 2EKHA 2YHTA 2YXYA 2LCCA 1IGQA 4DEXA 1TWBA 2VXFA 3PIPA 1K0SA 3KBGA 3OBYA 1S72A 2VASA 1ZSZA 4J5YA 3SWNC 3UATA 1CSKA 5KH6A 4JDSA 1YJ9Q 2FPEA 2BZXA 4M7AC 3M4GA 4OMQA 1M8VA 4KH1B 2H3JA 2OTJQ 5CKBA 4EMKB 4II1A 1VQ8T 1CKBA 2RQUA 4DA4A 2DTHA 1WHKA 4E7ZA 2JTFA 1BBZA 3CCMT 4B9WA 2X4JA 3OYCA 4PJJA 2OAUA 2OTLT 2WACA 1RAAB 4OB2B 1Y71A 1D3BB 4EMGA 2FRWA 1RAEB 2PVDB 2P0KA 2YT6A 3X25B 1VQ8Q 1H641 2GBQA 4ATOA 1QW1A 4XK8E 3E9FA 1IHVA 3QYGB 1RAGB 1D1BA 3CCMQ 4PFPA 1H92A 4N0AC 2HCKA 3KXTA 1G83A 1UG1A 1GCPA 3HKSA 4FYYB 5GMKl 4C0DC 1OZ3A 1QP3A 4IIMA 1K8AU 1YNZA 3A8HB 4KT0E 4C92G 1TS9A 5FU6C 2VVKA 2EQJA 5KE2A 2EYQA 2J6OA 3PVLA 2MWPA 2YLBA 1WHHA 3CCSA 5LJ3f 2H8HA 2OJ2A 3MPUB 2L5QA 1YITT 1W2BP 2GCXA 2KXCA 5GAMh 5GANh 1YHQA 3JCMh 3J7AF 4EMKA 4ZTFA 4C8QF 1T3SA 2K9GA 3TCJA 2XIDA 4M4ZA 4J6XA 2P84A 4BE0A 2DEQA 2LT4A 1MNEA 3EG9B 5CKDA 3G4SQ 2AT1B 2RPNA 1OZ2A 2EGAA 2EPDA 3A1PA 2M9UA 1D3BA 1AD5A 1VQMA 1VQ7T 1LJOA 2O9VA 3VYHB 3JB9J 3CPWS 3OS0A 3META 1MGQA 5GMKj 3WVEB 1J3TA 3H0IA 3LWHA 2JW4A 4Y92A 2LZ6B 3OYKA 4M7AF 2YDLA 4LNPA 2QEXT 1VQKT 2SRCA 3CC4T 5LJ5d 2OAWA 4IUTA 3CC2T 4PJOD 2MYSA 2I2LA 1NLOC 3M53A 5GAN2 2QDLA 4Y91A 1QVFA 4BI8B 1WZOA 4GLMA 1X6BA 4M78G 4LUDA 3CCEQ 3TVTA 1WLPB 4KUDK 4KH0B 3EGXB 2HBPA 2VKNA 2WSFE 1WHGA 4AFQC 5GAOm 2X35A 3VUBA 1VQPQ 3QPHA 1AOJA 3SWNB 2HSPA 4RTZA 3I5SA 1FXXA 2RJFA 3EG1A 5CIUA 4V2SA 1PSEA 2CKKA 2ECZA 3CC4Q 1ABQA 3CC2Q 2BKDN 1YJ9A 3CQTA 2Y4YA 2I0NA 1O75A 2EJGA 3EG9A 2COWA 1SKUB 4JJDA 1OPKA 1IXDA 5GAOp 3C94A 1QWFA 1C6VX 4LD9K 3EG2A 4BB7A 1K9MU 1Q95G 3CMAT 1JXOA 2ZPGB 3V7RA 2CZ7B 2G6FX 2EAYA 2RN8A 1OPLA 3FC3A 4J9EA 3LX7A 1OOTA 3NHNA 1VQ4Q 3A8OB 4M75F 2KXDA 1SF9A 3QDFA 5GAN7 1VQNT 3JB9F 3LH0A 3OYIA 2CSQA 1UHCA 4MMKA 2O2OA 1M1KC 3OYMA 4RG2A 1X2KA 1ZLMA 3CBOA 5I21A 4C0GA 2IIMA 1NYGA 2KYBA 1YJWT 3CMAQ 2ED1A 3I55Q 4PJLA 1D1AA 1YWOA 3PT9A 1RI0A 4PJMA 4C92D 5FU6B 3EGXA 3RKWA 3P8HA 4UC4A 3QKJA 1UGVA 1VQNQ 1NEBA 3EFSA 3SWNA 1QKXA 2LNHB 5LJ3j 3G6EQ 2HQHA 1EFNA 2JVVA 1HYOA 3I5RA 3OBWA 3FLGA 1ZHIA 5HY6A 4DQ2A 3N5BB 1AZGB 1YJNA 3EFRA 3RKYA 3CCUQ 1YJWQ 1VYVA 3WXMB 1V29B 4FT2A 4HVWA 1Q82C 1OULA 2CP7A 5I2SA 2LX9A 3MEUA 2YWWA 3OYJA 1G2BA 2DM1A 2K2MA 1RADB 1K8AC 3GPLA 1PG5B 3RKXA 4IIOA 4QW2A 3G4SA 4KGXB 2VXEA 4ZGEB 2KROA 2DFUA 1RACB 1KIKA 1NZ9A 4XQ3A 2DL8A 3LW5E 2LQWA 3X20B 3G71A 4X34A 5EC7A 1S1NA 2RI5A 5GAOq 5CKEA 3A98A 2CUDA 2CYZB 1Q82R 2QQSA 5L8RE 4F16A 1SSFA 2CZ1B 2LJ0A 4MZPA 1VQOT 3CCVT 2MPXC 3RIRA 3J80E 1AEYA 2EVRA 2IVWA 2LDMA 2BZYA 2AIRB 3MP1A 3ASKA 4AT1B 2DF6A 5C6SA 1K8AR 1YN8A 2ZAEA 4P5NA 4A4GA 4C8QG 3I56A 3EHRA 4M78D 2K2VA 1VQ5Q 4KGVB 3CCEA 1QVFS 1QP2A 3CPWP 4KBMB 3CD6Q 1GFDA 2QQRA 2HKNA 3EG3A 1YCYA 2A37A 3HTRA 4B6MA 2LQNA 2C06A 1VQPA 2CT3A 2ZPHB 2KDSA 1VQOQ 1Q7YC 3CCVQ 2L3QA 1ZUUA 2J6FA 3CCJT 2RJEA 4LDUA 3VS5A 2GTOA 4AFZC 4PFOA 3X28B 2E41A 2XMFA 1I5OB 4F17A 3ME9A 5D7UA 2DZ9A 2QI2A 1WQ7A 4M77F 4M7AG 4LDVA 3A8LB 4EPCA 2R5MA 1NG2A 2RI2A 4L6V5 3MP8A 5KCOA 3M57A 1VQ9Q 1N27A 2K79A 1WHJA 2EFIA 1TU0B 3CMET 1V76A 2RB6A 2FRYA 3SFMA 1LPLA 4LUEA 1SPKA 2ZCFB 3CC7A 2QQAA 2O31A 1E6GA 4RCBA 3OB9A 3MEWA 2NUPB 3JCMW 1IZ6A 5J39A 3GP8A 5GAMg 5GANg 2DX1A 2HNIA 3JCMg 2HAXA 5LJ3e 3I55A 3V7SA 1M4ZA 3VU3C 1YBYA 3CMEQ 4A4FA 2LJ3A 3L2VA 2PVGB 5IXFA 1YI2T 1VIFA 3OSVA 2FL7A 1KG1A 2CH4A 3G6EA 2RK1A 4E2FB 2LQ8A 1YWPA 3VRZA 4NS5A 1R77A 4E7IA 2LTOA 3EFOB 2RNAA 2GGRA 1JXMA 3H0HA 3PTAA 3CCUA 4FW1A 2RHUA 2KSSA 1P92A 3A8MB 3BFMA 1ZUYA 4C0ZA 3GNGA 2RHYA 4J6WA 2O88A 2MI6A 1YI2Q 2DKGA 1K9MR 4BY6C 2KK4A 4HT8A 2VWFA 1M90U 5CKFA 1N8RC 2DE0X 1Q81U 5IH2A 3PE0A 4MDWA 2AHJB 2CZ0B 2K5LA 2NUZA 4IUPA 3CCLA 3OYAA 3CCRQ 2FEIA 4OMOA 4FSXA 1TSFA 2YUNA 3GLXA 1BI3A 3I35A 3OYGA 2NUPA 4JJCA 1AWOA 1OI1A 3ZEHA 3CPWA 3VS2A 2MOXA 2FVUA 2DVJA 1ZQ1A 2BUDA 4M75E 2WSEE 4OMMA 1ZA2B 2M0OA 4C8QD 3V8LA 1PKTA 4E7SA 3OW2S 1N8RR 5AYFA 1UHFA 1VQ5A 2J05A 2P0PA 5IN1A 4M78B 1JO8A 4M7DC 1DJ7B 2RJCA 4JLGA 4K11A 2RK2A 1WHMA 4ELYC 1K0XA 3EFOA 4DBRA 3HRSA 4QVZA 1Y0MA 3JRZA 2V1RA 3MEVA 1BI2A 2IG0A 1V1CA 2DL3A 4IURA 3O8VA 3RR6A 1UGPB 3M0RA 3PIOA 4OMFB 3HL8A 1I8FA 3VYGA 3NTKA 2F5KA 2CP2A 4XU1A 1QQJA 4Z88A 4C5HA 1KJWA 2A0FB 2ZPIB 3JCMe 2FB7A 1LOJA 5KE3A 4M7AD 1QVFP 2HL3A 2PUOB 3REBB 5IHKA 2YSQA 1W4SA 4DOWA 5LJ5h 3CCQA 1M1KU 2A08A 1VQ9A 1AT1B 1E6HA 1JJ2S 5A0GA 5FRNA 4FW2A 4ZGDB 1B07A 2DXCA 2QA4T 3S3MA 4OP0A 1H3ZA 1R0BG 3GBQA 2K7AA 1VQLA 5I2MA 3JCMV 4JS5A 2XDDA 2LC4A 2A28A 4J9BA 3FEOA 4M78A 9ATCB 2DBMA 4F7UF 2KRSA 4HXJA 2G3RA 2PQWA 2KRNA 1Q82U 1TTHB 2R58A 1ARKA 3M9QA 2EYYA 1RABB 3MP6A 4LDYA 4LN2A 2LQKA 1WXBA 2CUBA 1I07A 3FDRA 2MWOA 3NTIA 3THKA 1AWJA 2OTLQ 1VA7A 2JTEA 2RQWA 2HQXA 1PRMC 3TSZA 3OYEA 4D6WA 1K9AA 1IREB 2CGHA 2JNGA 1VQ6A 1QCOA 1JB0E 5A0LA 4M75C 4PFZA 3HRTA 1WI7A 2JS2A 1KSWA 1O9SA 1TUGB 2E70A 3OMGA 4CC3A 4M7DF 2DAQA 2PU9B 3ZL7C 3SEMA 1Q86C 4J6YA 3QBYA 2PUKB 1VUBA 1JRIA 4RTXA 3PMIA 4OGCA 2DD4A 3H9NA 2GFAA 2YRCA 4PJNA 2DTIA 1FMVA 4M77E 2LNVA 4HCCA 2F1LA 2QDYB 4OGEA 2K3BA 1H3HA 3JCMX 1YITQ 1MMNA 1AWXA 1ZBXA 3QJ6A 2ZPEB 2DXUA 2RH2A 2EW3A 5CR2A 2HL5C 5LJ3d 4NOYA 4JZ3A 4A4KA 4IUUA 1M90C 4C8QB 2IPOB 1Q81C 1Q7YU 2L8DA 2FZCB 4RTTA 2DIGA 1RAHB 1FWZA 1AWWA 1YFNA 3QZ9B 2V8JA 4HT9A 3L42A 5M9OA 2KMTA 2JS0A 1I4K1 1BKBA 3QJYA 2AKKA 2R5AA 2EQMA 1GFCA 4D8DA 1VQ7Q 2RHZA 2DJZA 1M1GA 2KY9A 2LT1A 1MNDA 3P8BB 3ZBDA 4N4IA 2V8KA 3V8JA 3DLMA 2EYWA 2HMAA 2CREA 4J9GA 3NTHA 1BIAA 2YRDA 1M90R 2V8IA 3SDZA 3PGGA 3RMQA 4F14A 1Q81R 2MIOA 4XTZA 1M27C 2QEXQ 3PVQA 1VQKQ 3U23A 1RLPC 3HFOA 4M7AB 2H3EB 4JPBW 1YP5A 3M56A 2DLPA 1U1TA 4C5GA 4CRIA 2OTJA 4Z02A 4FT4A 1KK7A 2JXBA 5CK9A 2XD0A 4YTLA 4EIKA 5GAN5 1OEBA 4IUQA 3OS2A 1UJ0A 2A3LA 1AHJB 3QSUA 4XTWA 4QQ6A 8ATCB 4D8KA 1WGSA 1WIEA 3VS7A 5GAMf 5GANf 3MJXA 3JCMf 4C5IA 3Q1JA 2KE9A 4C8QA 4HCZA 2L2PA 3BY7A 1MV3A 2RHIA 3CEYA 1VQ8A 1QVGS 1ACMB 2F2WA 2SEMA 5GMKm 4OB0B 2X3WD 4BI3A 4RTVA 4GY5A 2KNBB 3CCMA 1KQSS 4MDXA 4C0DB 3JAME 4R56A 4M77C 3BDLA 1UUEA 1ZSGA 2FYKA 3M0PA 4BD3A 2E5KA 2DILA 1B34B 4ELZC 1N8RU 1NYFA 1MHNA 2EQIA 3HHTB 3L1AA 5HKCA 5DLOA 2ZPBB 3G7ZA 4M75B 5IHIA 1K73C 2KYMA 5D6XA 1LVKA 4M7AA 1OX9A 1WXTA 2DL5A 4FL6A 1D0ZA 4BDZA 2XDPA 2VC8A 1TUDA 1M1KR 2DYBA 3EH2A 3FB9A 4TVRA 2F2VA 4C92C 2MAMA 3UPUA 4E7LA 4A4HA 5FU7C 1YIJT 4L5GA 3DKMA 2K3YA 2MCNA 2YRVA 4QQDA 2F69A 1VIEA 4E6RA 2QAZA 3H0FA 5DY9A 2ATCB 3TEEA 2DETA 1YITA 2GF7A 1HXDA 3JCMJ 3ZFJA 1GCQC 2ROTA 2EYZA 2MF2A 2ZGWA 3KFVA 3TSWA 4N0AA 2CP6A 2JJ9A 2CDTA 4PJOF 4ZTJA 1B3QA 1PHTA 1YIJQ 4AMCA 1ZSZC 3LYIA 4BDYA 2DNUA 4E7HA 1PNJA 3OW2A 1QKWA 1BU1A 3QYHB 1UDLA 3MKDA 4BACA 1B34A 1H8KA 2KEAA 3PFSA 4J9HA 5LJ5g 3JCMQ 2KT8A 4CC2A 4F7UE 3O5ZA 4M75A 2E12A 1VQ7A 3M58A 5I11A 4J9DA 1WJRA 3LGFA 5GAN4 2L3RA 2DPPB 1MV0B 1XTDA 3QWXX 3UT1A 4AG1C 3LWIA 4XTYA 4DBQA 2QEXA 1VQKA 1UJYA 3G1JA 4J7FA 2CH4W 1M5Q1 4Y28E 2NUTB 1S72T 2JMCA 3CC4A 5HK3A 3P8DA 3CC2A 1KFZA 4LXCA 1SG5A 3A8GB 5DM7R 4E7JA 2CP0A 2KVQG 1HK9A 4J8OA 1WQWA 2QGGA 1PWTA 5GAOn 2X4XA 3UWNA 4N4HA 4JZ4A 5GMKi 4WTOB 4JJBA 1CKAA 2DZCA 3HP9A 5C0MA 1OU9A 5GAMj 5GANj 4M7DE 1JJ2A 3UA6A 4HVUA 3CCJQ 3MEAA 1VQ4A 1NJIU 3JCMb 1S72Q 5GAN8 2QTVA 2RF0A 2KI7A 4E47A 1UFFA 4J83A 4WCIA 1Q7YR 1VQLT 5L23A 2K6DA 2YUPA 1RLQC 2X9HA 1IO6A 4A53A 5FWCA 1XNIA 5D6WA 4C92F 4XU0A 1PCXA 2V26A 1BI1A 4LDXA 3M5AA 5GJWB 5GMKh 1XJWB 3OA6A 2COZA 4M77B 1HD3A 4EMKC 3H8ZA 3TQ7P 3CMAA 4A54A 1MMGA 3VRYA 4PKCC 3BE3A 1R0CB 2M51A 1WJSA 1VQNA 1OYXA 1Y96B 1X69A 4PL6A 5CAIA 1X27A 1Q86U 2FPFA 2W10A 1TUCA 2NUTA 1UGQB 4F04B 1K4US 4NL3A 2B86A 1UGRB 2E6NA 2V1QA 3CCST 4EMHA 3REAB 2FO0A 3PNWC 1KQSP 3OYYA 1W2BS 1MMAA 2DD5A 1YJWA 2LX7A 4M75G 8AT1B 1NE8A 1I5LA 1YHQT 1TOVA 3H6ZA 2KR3A 1B7TA 3EG0A 1T3LA 3JB9G 1M3CA 1BB9A 4JRIA 2BIVA 2EWNA 2RA2A 3X24B 2BE9B 5LJ5e 1WPYA 3GNFB 3HRUA 1WA7A 1KD1C 4ZN1A 7AT1B 1RAIB 1JBMA 1OQKA 1X43A 2EGEA 5IXBA 1N9SA 4J9IA 5CVIA 1F1BB 3CCSQ 2WSCE 2FZKB 2P4TA 1EZZB 3QDRB 2RM4A 1D0XA 1YHQQ 1VQMT 3VV0A 4EDUA 3BDUA 2VGNA 1Y07A 2W0ZA 4M77A 3M54A 1T0JA 4X1VA 3HSBA 5IAYA 3GF5A 2K5FA 1KD1R 1VOMA 1Y96A 2PVOB 4O5VA 3BW1A 2D8JA 1M30A 4FSSA 2FG0A 3RERA 2QQ9A 1M1FA 1ZX6A 2C0IA 4VUBA 1KQ2A 2DERA 1VQMQ 3CD6A 4FIBA 2D0QB 4RTWA 2M02A 1C1AA 3RUXA 2F5TX 1FMWA 2EIFA 1I0CA 1YCSB 1VQOA 3CCVA 1PRLC 5LJ3h 2JM8A 2HZYA 3L2ZA 3S3NA 1FYNA 2E3IA 1JEGA 5GAMe 5GANe 1YJ9T 4RTYA 2DMOA 1M8MA 2PNIA 2XHCA 3VS3A 1U06A 2C0OA 2E4HA 3LGLA 1UECA 2E1HA 1QCFA 2FHDA 2M0YA 4ZN3A 3OYNA 1MMDA 4JUVA 2KQWA 2HSEB 3OS1A 3NGPA 3CCJA 2DRKA 3A5ZB 1OV3A 1KHCA 4PK4A 3H41A 1GBRA 3QUIA 3S6WA 5GAOl 4LE9A 2HQEA 2L89A 4AFUC 2MK5A 1IHWA 2FPDA 4AG2C 3DLLA 3AT1B 3CBPA 1PD1A 3MCAB 3OYLA 1KC8C 3RBBB 2P0QA 3KUFA 1K73U 1WDXA 2A36A 2RQVA 3J81E 4KUIA 2DVEA 2M16A 4LDWA 1QVGA 2RQTA 2CP5A 1Y7XA 4DBHA 1G3SA 2DK3A 3CMEA 4PJOE 1FMKA 1WJQA 1KQSA 3S3OA 1M9SA 4Z8AA 4JJNK 1D09B 4Q5WA 5D6YA 1NJIC 3LH5A 4M77G 2QA4Q 3OYBA 1PD0A 2E5QA 2QQBA 2JTMA 3V7CA 2VUBA 2YUOA 2DXTA 1BI0A 3EGUA 2AZSA 1GXIE 2DJQA 1LNXA 4M75D 4HA8A 3VS4A 2JZ2A 1YJNT 1RL2A 1KC8R 3JB9D 3OYDA 4XU3A 2CZ6B 5DLQE 4BY6B 3QO3A 2EYXA 1YI2A 2BE7D 3M0TA 4F7UB 1U5SA 4BUGA 3C95A 1WX6A 1WFWA 3FJ5A 2CT4A 1A0NB 3G4ST 1NBEB 1NJIR 3FJPA 3OY9A 3OMCA 1XOVA 1QVPA 4ESRA 3CCRA 1TH7A 2DO3A 5ECAA 1YJNQ 3EAEA 2KT1A 3G71T 3R6NA 4OB1B 1N9RA 3LLRA 2E6ZA 1GRIA 1I81A 2QXFA 2COYA 2DIQA 1NEGA 3T9NA 5LJ5f 4A4EA 4MMLA 3QZ5B 2L0AA 3OYHA 2LCLA 4M7DB 2ROLA 1GL5A 5J26A 3I56T 4QT7A 1UGSB 1Y57A 1I1JA 4GBQA 4C92E 1Q86R 2ED0A 3CCET 3G71Q 1X75C 2E65A 1U3OA 1QMCA 1SRMA 1VQPT 2DL7A 4JLIA 1N6AA 3E1SA 5FW9A 3MHXA 4ZNXA 4E7KA 1ZBJA 3HPWA 2DRMA 2E10A 2RI3A 4F7UA 4OMPA 3OW2P 3M4YA 3C4SA 2KAFA 3I56Q 4A63B 2LP5A 3HFNA 4HCBA 2D8HA 3GIBA 1KQ1A 3SHWA 4PJOC 2YLCA 1GBQA 2LMJA 5LL6S 2X4WA 5FROA 1Z9ZA 3CXCS 1G3YA 3UF4A 2CS7A 2KGTA 3UDCA 3GOXA 1WHLA 1WNLA 2RHXA 1MUZA 1X6OA 6AT1B 1ZUKA 1VQ4T 3IQLA 2RJDA 1IGUA 1IRXA 2GQVA 3M59A 1XQHA 3ULRB 4RKUE 4XAXB 4OVAA 4C0FA 1VYUA 1X2QA 2QTXA 1SHGA 4KRTA 5HCKA 3INZA 3SD4A 3CC7T 5FLXE 2VYTA 4FCYA 1VYTA 4JRKA 4M7DA 2E64A 2EJFA 2HEQA 2YUQA 4ME7A 1QCNA 3I55T 3C12A 2VB6A 2ZZDA 4QQGA 4RG8A 2D1XA 5CCAA 1JJ2P 4LD6A 4M77D 4M78E 4C5EA 1IB8A 2PTKA 2HKQB 2DYIA 2X4YA 2CSIA 1SRLA 2QA4A 2Y4XA 5KYWB 2XU8A 4RMOA 3L2QA 4ANJA 3QG1A 3V8KA 3VS6A 2BTTA 3RDVA 2OTLA 3G6ET 2EKOA 1C0MA 3NPFA 3JCMc 3CC7Q 2DA9A 1E7OA 1KD1U 2O9SA 2EQKA 3SB2A 4L59A 5HK0A 1BCMA 2JOYA 1U1SA 5GAMd 1QWEA 5GANd 3JCMd 3DB4A 1R8OB 3CCUT 4MZTA 4IUVA 3QXEB 1SEMA 3FIFA 3M0UA 4FYWB 2RO0A 1AZEA 4CC4B 1W2BA 1G3WA 3M0SA 2RQRA 1UTIA 2CP3A 2GTJA 3L2UA 2PZ1A 1D0YA 1FX7A 3UA7A 1ZA1B 1WXUA 4J9FA 4OMNA 2J06A 4X9CA 4GLKA 2DXBA 1PKSA 3PMTA 2K3XA 2JUFA 3M0QA 4F7UG 3OYFA 3VJPA 4FM4B 1PM3A 3CCLT 1HJDA 3OQ5A 4RCCA 2GQIA 3DB3A 2NLUA 2DL4A 3X26B 1K73R 3E2UA 2XI9A 5LJ5j 4OF1A 2XDBA 5KYNA 5KYUB 1BCOA 5LJ3g 4O6JA 5CQXA 1N5ZA 3OSSC 3QIIA 5GMKe 2L3PA 1QLYA 1LCKA 4DBFA 5KYWA 5CO7A 2GNCA 4OMLA 4XTVA 3VKIA 2XKOC 1VQ5T 3CCLQ
chains in the Genus database with same CATH topology
3JCMV 4JS5A 5GAN3 3QPHA 4JRIA 2BIVA 2EWNA 3SWNB 2RA2A 3X24B 2LC4A 2XDDA 4JS4A 5LJ5e 1FXXA 2RJFA 1WPYA 3FEOA 4M78A 5CIUA 3CD6T 1PSEA 3GNFB 4V2SA 4M7DG 3HRUA 2CKKA 2D9TA 4F7UF 1KD1C 4ZN1A 5EG2A 2G3RA 2BKDN 1JBMA 1YJ9A 2PQWA 2Y4YA 1Q82U 1N9SA 1O75A 2EJGA 5CVIA 4XU2A 1NJIU 2R58A 4BE1A 2WSCE 3M9QA 4J7IA 4ZGJB 4LDYA 3MP6A 4XTUA 2LQKA 2P4TA 3FDRA 3QDRB 5GAOp 2MWOA 2RM4A 3E19A 1G3TA 3NTIA 2K5IA 3C94A 1VQMT 3JCMP 3VV0A 4PJOB 4LD9K 4EDUA 3BDUA 2HQXA 4BB7A 1K9MU 3JB9H 3CMAT 2VGNA 2ZPGB 3V7RA 1Y07A 3FRNA 4D6WA 2CZ7B 1NPRA 3OYEA 3L2WA 3GP8A 1IREB 2EAYA 4M77A 2CGHA 2DTOA 3FC3A 2JNGA 1VQ6A 3LX7A 3M54A 4M78C 2D6FA 3RESA 1JB0E 5A0LA 3A8OB 3CCQT 4IKFA 4MZMA 4M75F 4M75C 3L2RA 1KC8U 4JRQA 2XK0A 3HRTA 5GAN7 1VQ9T 1VQNT 4FU6A 3HSBA 5IAYA 2K4YA 3GF5A 2K5FA 3JB9F 3LH0A 3OYIA 3MO8A 1O9SA 1Y96A 2PVOB 2E70A 4O5VA 3BW1A 4MMKA 3OMGA 1M1KC 3RERA 3OYMA 1BIBA 2QQ9A 1M1FA 2DAQA 4RG2A 2PU9B 4M7DF 2LVMA 4VUBA 1KQ2A 1G5VA 3CBOA 5I21A 1UB4A 1Q86C 3CD6A 4FIBA 4J6YA 4C0GA 2D0QB 3QBYA 1YJWT 2PUKB 1VUBA 2O01E 3RUXA 1JRIA 2F5TX 3TREA 2K57A 3PMIA 4OGCA 2DD4A 2EIFA 5J3BA 2GFAA 2DTIA 4M77E 3PT9A 4JRPA 1RI0A 1VQ4A 2LNVA 4HCCA 4C92D 2QDYB 5FU6B 1VQOA 2EQUA 4OGEA 3CCVA 3RKWA 3P8HA 5LJ3h 3RMSA 4C8QE 3JCMX 2XG8D 4UC4A 4R55A 3QKJA 3CBMA 3L2ZA 4NL2A 3S3NA 1ZBXA 3EFSA 3QJ6A 3SWNA 2ZPEB 2DXUA 5LJ3j 2RH2A 2JVVA 5CR2A 5LJ3d 5GAMe 5GANe 4NOYA 5GAOr 1YJ9T 3OBWA 5FRMA 4A4KA 4OB3B 3FLGA 1ZHIA 4IUUA 5HY6A 1M90C 4DQ2A 2XHCA 3N5BB 4C8QB 1YJNA 1Q81C 3EFRA 1Q7YU 3RKYA 3LGLA 4QVCA 2E1HA 3WXMB 1V29B 2FHDA 2L8DA 3M55A 4FT2A 4ZN3A 3OYNA 1Q82C 5I2SA 1X01A 4JUVA 2DIGA 2KQWA 2LX9A 2M1HA 3MEUA 1FWZA 3OS1A 3OYJA 3QZ9B 2V8JA 4HT9A 3CCJA 3A5ZB 4PJOA 3L42A 5M9OA 1KHCA 2KMTA 1VQ6T 1K8AC 3GPLA 1I4K1 1BKBA 3RKXA 5KCHA 3QJYA 4N4GA 4QW2A 3G4SA 4B9XA 4CI0C 2R5AA 2VXEA 2EQMA 3QUIA 3S6WA 5GAOl 4BE2A 2HQEA 2L89A 3URGA 4ZGEB 2RHZA 1K9MC 4C92B 3JB9I 2DJZA 4M7AE 1M1GA 2KY9A 2LT1A 3DLLA 2VGMA 3CBPA 3MCAB 2B8AA 1NZ9A 3P8BB 4XQ3A 5FU7B 3ZBDA 3OYLA 1KC8C 2O4XB 3LW5E 4N4IA 2P0QA 3KUFA 1UEBA 2V8KA 3V8JA 3X20B 2A7YA 3DLMA 1K73U 3J81E 3NTHA 3G71A 4KUIA 4HKEA 2DVEA 1BIAA 2M16A 4X34A 2V8IA 4LDWA 3PGGA 4X9DA 3RMQA 3SDZA 1QVGA 3CPFA 2RI5A 4XTZA 5GAOq 5CKEA 3E9GA 3HFOA 1Y7XA 1BYMA 4M7AB 1G3SA 2CYZB 2DK3A 2QQSA 5GANg 5L8RE 3CMEA 3CCRT 4PJOE 4KULA 1SSFA 1WJQA 3M56A 2CZ1B 3S3OA 1KQSA 4MZPA 1VQOT 1M9SA 3CCVT 1U1TA 3RIRA 4C5GA 4JJNK 4Q5WA 5D6YA 3J80E 4CRIA 1NJIC 4M77G 2IVWA 2OTJA 4Z02A 2LDMA 3OYBA 4XTXA 2QQBA 2E5QA 3ASKA 3MP1A 4FT4A 5IT9E 2JTMA 5C6SA 5CK9A 2XD0A 3V7CA 4YTLA 2VUBA 5GAN5 4P5NA 2DXTA 2JN0A 4A4GA 4C8QG 1NPPA 4IUQA 1BI0A 3OS2A 3I56A 2A3LA 3VUZA 4M78D 5CQYA 1AHJB 2K2VA 3QSUA 1GXIE 4XTWA 4QQ6A 1EIFA 1LNXA 5CKHA 2Y90A 4M75D 5GAN6 3CCEA 1QVFS 4HA8A 1QP2A 3F70A 1YIJA 2JZ2A 4KBMB 1WGSA 2LRQA 4M78F 2QQRA 1RL2A 1YJNT 3JB9D 5GAMf 1YCYA 5GANf 3JCMf 4C5IA 3Q1JA 3OYDA 4XU3A 2CZ6B 5DLQE 4C8QA 2C06A 4HCZA 1VQPA 4BY6B 2ZPHB 2KDSA 3BY7A 3QO3A 1YI2A 4M7DD 4F7UB 2RHIA 1Q7YC 3CEYA 3QHSA 2XICA 4PLIA 3CCJT 2ZPFB 1PSFA 2RJEA 4BUGA 3C95A 5A0DA 4LDUA 1VQ8A 1QVGS 4QVDA 2GFUA 3G4ST 5GMKm 3X28B 4OB0B 2E41A 4BI3A 3FJPA 4WF2A 3OY9A 3OS5A 4GY5A 3CCMA 3ER0A 1KQSS 4MDXA 4C0DB 3JAME 3OMCA 3ME9A 2DZ9A 2QI2A 1XOVA 2HAXA 1WQ7A 1QVPA 3CCRA 4R56A 1TH7A 4C92A 1KHIA 2DO3A 4M77F 3BDLA 4M77C 4BE0A 3JSCA 3R6OA 4M7AG 2RD1A 3TU4K 3EAEA 3A8LB 4LDVA 4EPCA 2R5MA 2FYKA 2RI2A 4BD3A 3G71T 4L6V5 4C8QC 1B34B 4ELZC 2O4XA 4OB1B 3MP8A 1MHNA 1N8RU 5A2QE 5KCOA 3HHTB 3M57A 3L1AA 1N9RA 5HKCA 2MMPA 3LLRA 5DLOA 1N27A 2ZPBB 3G7ZA 4M75B 3WVDB 2EJ9A 2E6ZA 2EFIA 1I81A 2QXFA 1K73C 2DIQA 3CMET 5D6XA 4PNOA 3T9NA 4PLLA 5LJ5f 4A4EA 4M7AA 3AHUA 4MMLA 2RB6A 4FL6A 1U8RA 4PJOG 3SFMA 2OTJT 4BDZA 3QZ5B 3OYHA 2LCLA 2XDPA 2VC8A 4M7DB 2ZCFB 3CC7A 2HD0A 3CXCA 5J26A 3FB9A 2QQAA 4DOVA 4TVRA 2VV5A 4BI4A 3I56T 3NFCA 4C92C 1UGSB 4C92E 2MAMA 2R57A 2YHTA 4RCBA 3OB9A 3UPUA 2LCCA 4E7LA 3MEWA 4A4HA 3CCET 3JCMW 1IZ6A 2VXFA 5FU7C 5J39A 1X75C 5GAMg 4L5GA 2HNIA 3KBGA 3JCMg 2E65A 3DKMA 2K3YA 3OBYA 5LJ3e 4J5YA 3I55A 1S72A 3V7SA 2YRVA 1M4ZA 4QQDA 3SWNC 2F69A 3VU3C 1YBYA 1VIEA 4A4FA 1VQPT 4JLIA 5KH6A 3L2VA 2PVGB 4JDSA 1N6AA 3E1SA 5DY9A 1YI2T 4M7AC 3TEEA 3MHXA 4E7KA 1VIFA 3M4GA 1YITA 2GF7A 1HXDA 3OSVA 1M8VA 3JCMJ 2FL7A 2H3JA 3HPWA 1KG1A 3ZFJA 2E10A 2RI3A 5CKBA 4EMKB 4F7UA 3G6EA 2RK1A 3M4YA 4II1A 2LQ8A 1VQ8T 3C4SA 2KAFA 4DA4A 2DTHA 4NS5A 4E7IA 2MF2A 2JTFA 3HFNA 2ZGWA 2LTOA 3CCMT 3VUBA 4HCBA 4N0AA 4B9WA 3GIBA 2X4JA 1KQ1A 3OYCA 3PTAA 4PJOF 4ZTJA 3CCUA 4PJOC 2OAUA 2RHUA 2YLCA 2OTLT 2KSSA 1P92A 3LYIA 2WACA 5LL6S 2X4WA 5FROA 4BDYA 3A8MB 3BFMA 4C0ZA 3GNGA 3CXCS 2RHYA 4J6WA 4OB2B 4E7HA 1G3YA 1Y71A 3OW2A 2CS7A 1D3BB 3UDCA 3GOXA 4EMGA 3QYHB 1WNLA 2MI6A 2RHXA 4BACA 1B34A 1X6OA 2DKGA 2PVDB 2P0KA 3PFSA 4BY6C 2KK4A 5LJ5g 3JCMQ 1VQ4T 2RJDA 4HT8A 4F7UE 2GQVA 3M59A 5CKFA 4M75A 1N8RC 1M90U 3X25B 1XQHA 1Q81U 2E12A 1VQ7A 1H641 4ATOA 1QW1A 3M58A 4RKUE 4XAXB 4OVAA 4XK8E 4C0FA 3E9FA 1WJRA 2QTXA 2AHJB 4MDWA 2CZ0B 2K5LA 3QYGB 3INZA 3LGFA 4IUPA 5GAN4 2L3RA 2DPPB 3SD4A 3CC7T 4N0AC 5FLXE 3KXTA 2VYTA 3CCLA 3OYAA 1XTDA 4JRKA 3HKSA 3UT1A 4M7DA 5GMKl 4C0DC 1OZ3A 2E64A 1QP3A 2EJFA 4C92F 1K8AU 3A8HB 4KT0E 4ME7A 4XTYA 3LWIA 4FSXA 4C92G 2QEXA 1VQKA 4J7FA 5FU6C 3GLXA 1BI3A 1M5Q1 4Y28E 1S72T 3I55T 3C12A 2EQJA 3OYGA 2ZZDA 4QQGA 4RG8A 5CCAA 5KE2A 3CC4A 5HK3A 3P8DA 3CC2A 1OI1A 3ZEHA 4LD6A 4M77D 3A8GB 2EYQA 4M78E 4C5EA 5DM7R 3CPWA 4E7JA 2FVUA 2KVQG 1HK9A 2MWPA 2X4YA 1ZQ1A 2BUDA 2YLBA 3CCSA 4M75E 2WSEE 5LJ3f 4J8OA 2QA4A 2M0OA 1WQWA 2Y4XA 4C8QD 2L5QA 5GAOn 1YITT 4RMOA 2XU8A 2X4XA 3UWNA 2GCXA 3QG1A 3V8KA 4N4HA 3V8LA 3L2QA 2OTLA 3G6ET 3OW2S 5GAMh 5GMKi 5GANh 1YHQA 2EKOA 3JCMh 3PIPA 4M7DC 5AYFA 3JCMc 2DZCA 1VQ5A 3HP9A 4EMKA 3J7AF 4ZTFA 1KD1U 4C8QF 2P0PA 5C0MA 5IN1A 4M78B 5GAMj 2EQKA 3SB2A 3TCJA 4L59A 1DJ7B 2RJCA 5HK0A 5GANj 1JJ2A 4M7DE 4JLGA 2JOYA 2RK2A 1U1SA 4ELYC 5GAMd 5GANd 3JCMd 2XIDA 3DB4A 4J6XA 1R8OB 3CCUT 3MEAA 4IUVA 4MZTA 2DEQA 2LT4A 3HRSA 3FIFA 3QXEB 3JRZA 4QVZA 3JCMb 2RO0A 3MEVA 5GAN8 4E47A 4J83A 5CKDA 1W2BA 1VQLT 1BI2A 2IG0A 1G3WA 1OZ2A 3L2UA 4IURA 1YIJT 4A53A 1FX7A 2M9UA 3O8VA 1D3BA 1UGPB 3PIOA 4OMFB 1XNIA 3HL8A 1I8FA 4X9CA 5D6WA 3VYGA 3NTKA 4GLKA 2F5KA 4XU0A 2DXBA 4XU1A 1BI1A 4LDXA 3M5AA 3PMTA 2K3XA 5GMKh 2JUFA 1VQMA 1VQ7T 4C5HA 3OA6A 2ZPIB 1LJOA 3JCMe 4M77B 2FB7A 4EMKC 4F7UG 1LOJA 3VYHB 3H8ZA 5KE3A 3OYFA 3CMAA 3CPWS 3OS0A 3META 4A54A 3JB9J 1MGQA 3VJPA 5GMKj 4M7AD 3WVEB 2PUOB 3LWHA 4FM4B 4PKCC 3CCLT 3OQ5A 1W4SA 4DOWA 5LJ5h 3OYKA 3CCQA 4RCCA 4M7AF 1WJSA 1M1KU 1VQ9A 3DB3A 1VQNA 1OYXA 1Y96B 2NLUA 2QEXT 3X26B 1VQKT 2XI9A 5LJ5j 4PL6A 5CAIA 4OF1A 2XDBA 1Q86U 3CC4T 5LJ5d 4IUTA 5A0GA 1JJ2S 3CC2T 5FRNA 4PJOD 2I2LA 3M53A 5GAN2 1UGQB 5LJ3g 4O6JA 4Y91A 5CQXA 4BI8B 1UGRB 4ZGDB 4NL3A 1QVFA 3OSSC 2E6NA 3CCST 2DXCA 2QA4T 4EMHA 3S3MA 4M78G 4OP0A 3QIIA 3PNWC 5GMKe 3OYYA 1W2BS 2DD5A 1YJWA 1H3ZA 4M75G 1NE8A 4KUDK 1I5LA 1YHQT 2HBPA 2WSFE 3H6ZA 5CO7A 1VQLA 4XTVA 3VKIA 2XKOC 1VQ5T 5GAOm 5I2MA 3JB9G 2X35A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E64 A;  2EJF A;  3JCM V;  5GAN 3;  4JRI A;  4C8Q C;  5GMK l;  1B34 B;  4XTY A;  2EWN A;  3SWN B;  2RA2 A;  4C92 G;  5LJ5 e;  5GAO m;  4HT9 A;  3L1A A;  1N9R A;  1WPY A;  4M78 A;  1M5Q 1;  4PJO A;  4V2S A;  4M75 B;  4M7D G;  2EJ9 A;  4F7U F;  1I81 A;  1I4K 1;  3RKX A;  4M77 D;  4PNO A;  4M78 E;  5LJ5 f;  3QUI A;  2VXE A;  4M7A A;  1JBM A;  5GAO l;  5GAN d;  1HK9 A;  2RB6 A;  2YLB A;  4MML A;  3AHU A;  4PJO G;  1N9S A;  4M75 E;  5LJ3 f;  2EJG A;  4XU2 A;  1WQW A;  4C92 B;  3JB9 I;  4C8Q D;  5GAO n;  2DJZ A;  4M7A E;  3V8L A;  3V8K A;  2VC8 A;  4M7D B;  4XTU A;  5GAM h;  5GMK i;  5GAN h;  4M7D C;  3JCM h;  3FB9 A;  4XQ3 A;  5GAO p;  2RM4 A;  3JCM c;  2DZC A;  4C92 C;  4C92 E;  4EMK A;  2YHT A;  3V8J A;  4RCB A;  4C8Q F;  3JCM P;  4M78 B;  4PJO B;  2DVE A;  1BIA A;  3SB2 A;  3BDU A;  5GAM j;  5GAN j;  3JB9 G;  1KQ2 A;  4X9D A;  3PGG A;  3JB9 H;  3JCM W;  2VXF A;  1U1S A;  3V7R A;  4XTZ A;  5GAM d;  3JCM d;  2HNI A;  3JCM g;  5GAM g;  2E65 A;  5LJ3 e;  3HFO A;  5GAN g;  4M77 A;  2EAY A;  4J6X A;  2CGH A;  2DTO A;  4J5Y A;  4M7A B;  3V7S A;  2DEQ A;  4M7D E;  3FIF A;  4M78 C;  3JCM b;  3SWN C;  4PJO E;  3RES A;  3VU3 C;  5GAN 8;  4M75 F;  4M75 C;  4JLI A;  1U1T A;  5DY9 A;  3RIR A;  5GAN 7;  4M7A C;  4M77 G;  3HSB A;  3M4G A;  1HXD A;  4XTX A;  1M8V A;  4A53 A;  3JCM J;  3JB9 F;  3V7C A;  2E10 A;  4F7U A;  4EMK B;  5GAN 5;  1D3B A;  2DXT A;  1Y96 A;  2JN0 A;  4C8Q G;  4X9C A;  1I8F A;  4C92 F;  3BW1 A;  4MMK A;  4XU0 A;  4XU1 A;  2DTH A;  4M78 D;  5GMK h;  3RER A;  3QSU A;  1BIB A;  4M7D F;  4XTW A;  1LJO A;  1LNX A;  3HFN A;  3JCM e;  2ZGW A;  2FB7 A;  2Y90 A;  4M75 D;  4M77 B;  4EMK C;  1LOJ A;  4F7U G;  4HA8 A;  5GAN 6;  5I21 A;  4N0A A;  5GAO q;  4J6Y A;  4A54 A;  3JB9 J;  3GIB A;  1MGQ A;  4M7A D;  5GMK j;  1KQ1 A;  4M78 F;  4PJO F;  1JRI A;  3RUX A;  4PJO C;  3JB9 D;  2K57 A;  5GAM f;  1YCY A;  5GAN f;  3JCM f;  2YLC A;  2DTI A;  4M77 E;  4XU3 A;  4C8Q A;  5LJ5 h;  4C92 D;  3BFM A;  4RCC A;  4M7A F;  4J6W A;  3QO3 A;  3BY7 A;  3RKW A;  4M7D D;  5LJ3 h;  4F7U B;  1D3B B;  1Y96 B;  3QHS A;  4EMG A;  4C8Q E;  3JCM X;  1WNL A;  5LJ5 j;  3L2Z A;  5CAI A;  4NL2 A;  1B34 A;  2DKG A;  3EFS A;  3SWN A;  5LJ5 d;  5LJ5 g;  2DXU A;  5LJ3 j;  3JCM Q;  4PJO D;  2I2L A;  4HT8 A;  4QVD A;  4F7U E;  4M75 A;  5GMK m;  5GAN 2;  5LJ3 d;  5GAM e;  5GAN e;  5LJ3 g;  4NOY A;  4Y91 A;  2E41 A;  1H64 1;  4NL3 A;  5GAO r;  3FJP A;  4WF2 A;  2QTX A;  4EMH A;  4M78 G;  4OP0 A;  5GMK e;  4DQ2 A;  2DZ9 A;  3INZ A;  5GAN 4;  1WQ7 A;  4C8Q B;  4M75 G;  3EFR A;  4N0A C;  1TH7 A;  3RKY A;  4M77 F;  4M77 C;  4C92 A;  2E1H A;  4QVC A;  1I5L A;  4M7A G;  2RD1 A;  4JRK A;  4XTV A;  4M7D A;  1X01 A;  4JUV A;  2FYK A; 
#chains in the Genus database with same CATH topology
 5GAN 3;  4FYV B;  2AK5 A;  4JS4 A;  1HSQ A;  1TXQ A;  3CD6 T;  5I22 A;  4M7D G;  3RNJ A;  2D9T A;  2QG9 B;  5EG2 A;  5KYY B;  1G8X A;  2OI3 A;  5AT1 B;  2FZG B;  2JM9 A;  3EGD B;  4XU2 A;  4BE1 A;  4J7I A;  2E3H A;  4ZGJ B;  4XTU A;  5IHN A;  2C0T A;  4KGZ B;  1WYX A;  1TG0 A;  3E19 A;  1G3T A;  2K5I A;  2L3S A;  2AZV A;  3JCM P;  4PJO B;  2EBP A;  3JB9 H;  1PC0 A;  3FRN A;  3L2W A;  1NPR A;  1K1Z A;  2HDA A;  3VS0 A;  2DTO A;  4M78 C;  2D6F A;  3RES A;  3CCQ T;  4IKF A;  4MZM A;  3L2R A;  1KC8 U;  4JRQ A;  2XK0 A;  3EHQ A;  1VQ9 T;  4FU6 A;  2K4Y A;  3MO8 A;  1BIB A;  2LVM A;  5KYU A;  1G5V A;  1UB4 A;  2J6K A;  2O01 E;  3TRE A;  2K57 A;  3EH1 A;  5J3B A;  2QK0 A;  4JRP A;  4AFS C;  1M2V B;  2EQU A;  3C0C A;  3CXC P;  3CCQ Q;  3RMS A;  4C8Q E;  2XG8 D;  4R55 A;  3CBM A;  4NL2 A;  2BZ8 A;  2D0N A;  5GAO r;  1JQQ A;  1SHF A;  1T0H A;  5FRM A;  1M3A A;  4OB3 B;  2QGF B;  3VS1 A;  5KYY A;  2HBW A;  2X3X D;  4DEY A;  3EGD A;  4QVC A;  2DEU A;  3M55 A;  1RAF B;  1X01 A;  1UE9 A;  2M1H A;  1VQL Q;  2LJ1 A;  1ABO A;  4PJO A;  1VQ6 T;  1QVG P;  4ORZ A;  5KCH A;  4N4G A;  4B9X A;  4CI0 C;  4BE2 A;  1K9M C;  2ABL A;  3URG A;  1NLP C;  2P4R A;  4C92 B;  3JB9 I;  4M7A E;  2VGM A;  5KYX B;  4HCK A;  2B8A A;  5FU7 B;  2O4X B;  1UEB A;  1JU5 C;  2A7Y A;  4HVV A;  4HKE A;  4X9D A;  5FWB A;  2KBT A;  3CPF A;  1M2O A;  3E9G A;  3JV3 A;  1BYM A;  2F2X A;  4CC7 A;  3CCR T;  4KUL A;  1D1C A;  1X6G A;  1VQ6 Q;  2DBK A;  1M2V A;  4XTX A;  4R0K A;  5IT9 E;  1SSH A;  5GJV B;  2JN0 A;  1NPP A;  3VUZ A;  5CQY A;  1EX4 A;  1K76 A;  4QKU A;  1W1F A;  1EIF A;  5CKH A;  1ZSZ B;  2Y90 A;  5GAN 6;  3F70 A;  4J9C A;  1NM7 A;  1YIJ A;  2LRQ A;  4M78 F;  4RTU A;  2JT4 A;  2NWM A;  2X51 A;  1OX8 A;  1RUW A;  2OX7 A;  3D7S B;  1OU8 A;  3NMZ C;  1AVZ C;  4M7D D;  1RI9 A;  3QHS A;  2XIC A;  4PLI A;  2ZPF B;  1PSF A;  5A0D A;  4QVD A;  1W6X A;  2GFU A;  3I9Q A;  4WF2 A;  3OS5 A;  2JMA A;  3ER0 A;  1M3B A;  4FYX B;  1BK2 A;  1Z9Q A;  4C92 A;  1KHI A;  2KRM A;  3JSC A;  3R6O A;  2RD1 A;  3TU4 K;  5KYX A;  2AKL A;  1W70 A;  2ENM A;  4C8Q C;  2O4X A;  5A2Q E;  3QWY A;  2MMP A;  3WVD B;  2EJ9 A;  4RUG A;  4Z89 A;  4PNO A;  2ESW A;  4PLL A;  2EGC A;  2NYS A;  3AHU A;  1U8R A;  4PJO G;  2QAS A;  2RMO A;  2OTJ T;  1GCQ A;  2J7I A;  2HD0 A;  3CXC A;  4DOV A;  2VV5 A;  2QYZ A;  2LCS A;  4BI4 A;  2Z0W A;  3NFC A;  2R57 A;  2EKH A;  2YHT A;  2YXY A;  2LCC A;  1IGQ A;  4DEX A;  1TWB A;  2VXF A;  3PIP A;  1K0S A;  3KBG A;  3OBY A;  1S72 A;  2VAS A;  1ZSZ A;  4J5Y A;  3SWN C;  3UAT A;  1CSK A;  5KH6 A;  4JDS A;  1YJ9 Q;  2FPE A;  2BZX A;  4M7A C;  3M4G A;  4OMQ A;  1M8V A;  4KH1 B;  2H3J A;  2OTJ Q;  5CKB A;  4EMK B;  4II1 A;  1VQ8 T;  1CKB A;  2RQU A;  4DA4 A;  2DTH A;  1WHK A;  4E7Z A;  2JTF A;  1BBZ A;  3CCM T;  4B9W A;  2X4J A;  3OYC A;  4PJJ A;  2OAU A;  2OTL T;  2WAC A;  1RAA B;  4OB2 B;  1Y71 A;  1D3B B;  4EMG A;  2FRW A;  1RAE B;  2PVD B;  2P0K A;  2YT6 A;  3X25 B;  1VQ8 Q;  1H64 1;  2GBQ A;  4ATO A;  1QW1 A;  4XK8 E;  3E9F A;  1IHV A;  3QYG B;  1RAG B;  1D1B A;  3CCM Q;  4PFP A;  1H92 A;  4N0A C;  2HCK A;  3KXT A;  1G83 A;  1UG1 A;  1GCP A;  3HKS A;  4FYY B;  5GMK l;  4C0D C;  1OZ3 A;  1QP3 A;  4IIM A;  1K8A U;  1YNZ A;  3A8H B;  4KT0 E;  4C92 G;  1TS9 A;  5FU6 C;  2VVK A;  2EQJ A;  5KE2 A;  2EYQ A;  2J6O A;  3PVL A;  2MWP A;  2YLB A;  1WHH A;  3CCS A;  5LJ3 f;  2H8H A;  2OJ2 A;  3MPU B;  2L5Q A;  1YIT T;  1W2B P;  2GCX A;  2KXC A;  5GAM h;  5GAN h;  1YHQ A;  3JCM h;  3J7A F;  4EMK A;  4ZTF A;  4C8Q F;  1T3S A;  2K9G A;  3TCJ A;  2XID A;  4M4Z A;  4J6X A;  2P84 A;  4BE0 A;  2DEQ A;  2LT4 A;  1MNE A;  3EG9 B;  5CKD A;  3G4S Q;  2AT1 B;  2RPN A;  1OZ2 A;  2EGA A;  2EPD A;  3A1P A;  2M9U A;  1D3B A;  1AD5 A;  1VQM A;  1VQ7 T;  1LJO A;  2O9V A;  3VYH B;  3JB9 J;  3CPW S;  3OS0 A;  3MET A;  1MGQ A;  5GMK j;  3WVE B;  1J3T A;  3H0I A;  3LWH A;  2JW4 A;  4Y92 A;  2LZ6 B;  3OYK A;  4M7A F;  2YDL A;  4LNP A;  2QEX T;  1VQK T;  2SRC A;  3CC4 T;  5LJ5 d;  2OAW A;  4IUT A;  3CC2 T;  4PJO D;  2MYS A;  2I2L A;  1NLO C;  3M53 A;  5GAN 2;  2QDL A;  4Y91 A;  1QVF A;  4BI8 B;  1WZO A;  4GLM A;  1X6B A;  4M78 G;  4LUD A;  3CCE Q;  3TVT A;  1WLP B;  4KUD K;  4KH0 B;  3EGX B;  2HBP A;  2VKN A;  2WSF E;  1WHG A;  4AFQ C;  5GAO m;  2X35 A;  3VUB A;  1VQP Q;  3QPH A;  1AOJ A;  3SWN B;  2HSP A;  4RTZ A;  3I5S A;  1FXX A;  2RJF A;  3EG1 A;  5CIU A;  4V2S A;  1PSE A;  2CKK A;  2ECZ A;  3CC4 Q;  1ABQ A;  3CC2 Q;  2BKD N;  1YJ9 A;  3CQT A;  2Y4Y A;  2I0N A;  1O75 A;  2EJG A;  3EG9 A;  2COW A;  1SKU B;  4JJD A;  1OPK A;  1IXD A;  5GAO p;  3C94 A;  1QWF A;  1C6V X;  4LD9 K;  3EG2 A;  4BB7 A;  1K9M U;  1Q95 G;  3CMA T;  1JXO A;  2ZPG B;  3V7R A;  2CZ7 B;  2G6F X;  2EAY A;  2RN8 A;  1OPL A;  3FC3 A;  4J9E A;  3LX7 A;  1OOT A;  3NHN A;  1VQ4 Q;  3A8O B;  4M75 F;  2KXD A;  1SF9 A;  3QDF A;  5GAN 7;  1VQN T;  3JB9 F;  3LH0 A;  3OYI A;  2CSQ A;  1UHC A;  4MMK A;  2O2O A;  1M1K C;  3OYM A;  4RG2 A;  1X2K A;  1ZLM A;  3CBO A;  5I21 A;  4C0G A;  2IIM A;  1NYG A;  2KYB A;  1YJW T;  3CMA Q;  2ED1 A;  3I55 Q;  4PJL A;  1D1A A;  1YWO A;  3PT9 A;  1RI0 A;  4PJM A;  4C92 D;  5FU6 B;  3EGX A;  3RKW A;  3P8H A;  4UC4 A;  3QKJ A;  1UGV A;  1VQN Q;  1NEB A;  3EFS A;  3SWN A;  1QKX A;  2LNH B;  5LJ3 j;  3G6E Q;  2HQH A;  1EFN A;  2JVV A;  1HYO A;  3I5R A;  3OBW A;  3FLG A;  1ZHI A;  5HY6 A;  4DQ2 A;  3N5B B;  1AZG B;  1YJN A;  3EFR A;  3RKY A;  3CCU Q;  1YJW Q;  1VYV A;  3WXM B;  1V29 B;  4FT2 A;  4HVW A;  1Q82 C;  1OUL A;  2CP7 A;  5I2S A;  2LX9 A;  3MEU A;  2YWW A;  3OYJ A;  1G2B A;  2DM1 A;  2K2M A;  1RAD B;  1K8A C;  3GPL A;  1PG5 B;  3RKX A;  4IIO A;  4QW2 A;  3G4S A;  4KGX B;  2VXE A;  4ZGE B;  2KRO A;  2DFU A;  1RAC B;  1KIK A;  1NZ9 A;  4XQ3 A;  2DL8 A;  3LW5 E;  2LQW A;  3X20 B;  3G71 A;  4X34 A;  5EC7 A;  1S1N A;  2RI5 A;  5GAO q;  5CKE A;  3A98 A;  2CUD A;  2CYZ B;  1Q82 R;  2QQS A;  5L8R E;  4F16 A;  1SSF A;  2CZ1 B;  2LJ0 A;  4MZP A;  1VQO T;  3CCV T;  2MPX C;  3RIR A;  3J80 E;  1AEY A;  2EVR A;  2IVW A;  2LDM A;  2BZY A;  2AIR B;  3MP1 A;  3ASK A;  4AT1 B;  2DF6 A;  5C6S A;  1K8A R;  1YN8 A;  2ZAE A;  4P5N A;  4A4G A;  4C8Q G;  3I56 A;  3EHR A;  4M78 D;  2K2V A;  1VQ5 Q;  4KGV B;  3CCE A;  1QVF S;  1QP2 A;  3CPW P;  4KBM B;  3CD6 Q;  1GFD A;  2QQR A;  2HKN A;  3EG3 A;  1YCY A;  2A37 A;  3HTR A;  4B6M A;  2LQN A;  2C06 A;  1VQP A;  2CT3 A;  2ZPH B;  2KDS A;  1VQO Q;  1Q7Y C;  3CCV Q;  2L3Q A;  1ZUU A;  2J6F A;  3CCJ T;  2RJE A;  4LDU A;  3VS5 A;  2GTO A;  4AFZ C;  4PFO A;  3X28 B;  2E41 A;  2XMF A;  1I5O B;  4F17 A;  3ME9 A;  5D7U A;  2DZ9 A;  2QI2 A;  1WQ7 A;  4M77 F;  4M7A G;  4LDV A;  3A8L B;  4EPC A;  2R5M A;  1NG2 A;  2RI2 A;  4L6V 5;  3MP8 A;  5KCO A;  3M57 A;  1VQ9 Q;  1N27 A;  2K79 A;  1WHJ A;  2EFI A;  1TU0 B;  3CME T;  1V76 A;  2RB6 A;  2FRY A;  3SFM A;  1LPL A;  4LUE A;  1SPK A;  2ZCF B;  3CC7 A;  2QQA A;  2O31 A;  1E6G A;  4RCB A;  3OB9 A;  3MEW A;  2NUP B;  3JCM W;  1IZ6 A;  5J39 A;  3GP8 A;  5GAM g;  5GAN g;  2DX1 A;  2HNI A;  3JCM g;  2HAX A;  5LJ3 e;  3I55 A;  3V7S A;  1M4Z A;  3VU3 C;  1YBY A;  3CME Q;  4A4F A;  2LJ3 A;  3L2V A;  2PVG B;  5IXF A;  1YI2 T;  1VIF A;  3OSV A;  2FL7 A;  1KG1 A;  2CH4 A;  3G6E A;  2RK1 A;  4E2F B;  2LQ8 A;  1YWP A;  3VRZ A;  4NS5 A;  1R77 A;  4E7I A;  2LTO A;  3EFO B;  2RNA A;  2GGR A;  1JXM A;  3H0H A;  3PTA A;  3CCU A;  4FW1 A;  2RHU A;  2KSS A;  1P92 A;  3A8M B;  3BFM A;  1ZUY A;  4C0Z A;  3GNG A;  2RHY A;  4J6W A;  2O88 A;  2MI6 A;  1YI2 Q;  2DKG A;  1K9M R;  4BY6 C;  2KK4 A;  4HT8 A;  2VWF A;  1M90 U;  5CKF A;  1N8R C;  2DE0 X;  1Q81 U;  5IH2 A;  3PE0 A;  4MDW A;  2AHJ B;  2CZ0 B;  2K5L A;  2NUZ A;  4IUP A;  3CCL A;  3OYA A;  3CCR Q;  2FEI A;  4OMO A;  4FSX A;  1TSF A;  2YUN A;  3GLX A;  1BI3 A;  3I35 A;  3OYG A;  2NUP A;  4JJC A;  1AWO A;  1OI1 A;  3ZEH A;  3CPW A;  3VS2 A;  2MOX A;  2FVU A;  2DVJ A;  1ZQ1 A;  2BUD A;  4M75 E;  2WSE E;  4OMM A;  1ZA2 B;  2M0O A;  4C8Q D;  3V8L A;  1PKT A;  4E7S A;  3OW2 S;  1N8R R;  5AYF A;  1UHF A;  1VQ5 A;  2J05 A;  2P0P A;  5IN1 A;  4M78 B;  1JO8 A;  4M7D C;  1DJ7 B;  2RJC A;  4JLG A;  4K11 A;  2RK2 A;  1WHM A;  4ELY C;  1K0X A;  3EFO A;  4DBR A;  3HRS A;  4QVZ A;  1Y0M A;  3JRZ A;  2V1R A;  3MEV A;  1BI2 A;  2IG0 A;  1V1C A;  2DL3 A;  4IUR A;  3O8V A;  3RR6 A;  1UGP B;  3M0R A;  3PIO A;  4OMF B;  3HL8 A;  1I8F A;  3VYG A;  3NTK A;  2F5K A;  2CP2 A;  4XU1 A;  1QQJ A;  4Z88 A;  4C5H A;  1KJW A;  2A0F B;  2ZPI B;  3JCM e;  2FB7 A;  1LOJ A;  5KE3 A;  4M7A D;  1QVF P;  2HL3 A;  2PUO B;  3REB B;  5IHK A;  2YSQ A;  1W4S A;  4DOW A;  5LJ5 h;  3CCQ A;  1M1K U;  2A08 A;  1VQ9 A;  1AT1 B;  1E6H A;  1JJ2 S;  5A0G A;  5FRN A;  4FW2 A;  4ZGD B;  1B07 A;  2DXC A;  2QA4 T;  3S3M A;  4OP0 A;  1H3Z A;  1R0B G;  3GBQ A;  2K7A A;  1VQL A;  5I2M A;  3JCM V;  4JS5 A;  2XDD A;  2LC4 A;  2A28 A;  4J9B A;  3FEO A;  4M78 A;  9ATC B;  2DBM A;  4F7U F;  2KRS A;  4HXJ A;  2G3R A;  2PQW A;  2KRN A;  1Q82 U;  1TTH B;  2R58 A;  1ARK A;  3M9Q A;  2EYY A;  1RAB B;  3MP6 A;  4LDY A;  4LN2 A;  2LQK A;  1WXB A;  2CUB A;  1I07 A;  3FDR A;  2MWO A;  3NTI A;  3THK A;  1AWJ A;  2OTL Q;  1VA7 A;  2JTE A;  2RQW A;  2HQX A;  1PRM C;  3TSZ A;  3OYE A;  4D6W A;  1K9A A;  1IRE B;  2CGH A;  2JNG A;  1VQ6 A;  1QCO A;  1JB0 E;  5A0L A;  4M75 C;  4PFZ A;  3HRT A;  1WI7 A;  2JS2 A;  1KSW A;  1O9S A;  1TUG B;  2E70 A;  3OMG A;  4CC3 A;  4M7D F;  2DAQ A;  2PU9 B;  3ZL7 C;  3SEM A;  1Q86 C;  4J6Y A;  3QBY A;  2PUK B;  1VUB A;  1JRI A;  4RTX A;  3PMI A;  4OGC A;  2DD4 A;  3H9N A;  2GFA A;  2YRC A;  4PJN A;  2DTI A;  1FMV A;  4M77 E;  2LNV A;  4HCC A;  2F1L A;  2QDY B;  4OGE A;  2K3B A;  1H3H A;  3JCM X;  1YIT Q;  1MMN A;  1AWX A;  1ZBX A;  3QJ6 A;  2ZPE B;  2DXU A;  2RH2 A;  2EW3 A;  5CR2 A;  2HL5 C;  5LJ3 d;  4NOY A;  4JZ3 A;  4A4K A;  4IUU A;  1M90 C;  4C8Q B;  2IPO B;  1Q81 C;  1Q7Y U;  2L8D A;  2FZC B;  4RTT A;  2DIG A;  1RAH B;  1FWZ A;  1AWW A;  1YFN A;  3QZ9 B;  2V8J A;  4HT9 A;  3L42 A;  5M9O A;  2KMT A;  2JS0 A;  1I4K 1;  1BKB A;  3QJY A;  2AKK A;  2R5A A;  2EQM A;  1GFC A;  4D8D A;  1VQ7 Q;  2RHZ A;  2DJZ A;  1M1G A;  2KY9 A;  2LT1 A;  1MND A;  3P8B B;  3ZBD A;  4N4I A;  2V8K A;  3V8J A;  3DLM A;  2EYW A;  2HMA A;  2CRE A;  4J9G A;  3NTH A;  1BIA A;  2YRD A;  1M90 R;  2V8I A;  3SDZ A;  3PGG A;  3RMQ A;  4F14 A;  1Q81 R;  2MIO A;  4XTZ A;  1M27 C;  2QEX Q;  3PVQ A;  1VQK Q;  3U23 A;  1RLP C;  3HFO A;  4M7A B;  2H3E B;  4JPB W;  1YP5 A;  3M56 A;  2DLP A;  1U1T A;  4C5G A;  4CRI A;  2OTJ A;  4Z02 A;  4FT4 A;  1KK7 A;  2JXB A;  5CK9 A;  2XD0 A;  4YTL A;  4EIK A;  5GAN 5;  1OEB A;  4IUQ A;  3OS2 A;  1UJ0 A;  2A3L A;  1AHJ B;  3QSU A;  4XTW A;  4QQ6 A;  8ATC B;  4D8K A;  1WGS A;  1WIE A;  3VS7 A;  5GAM f;  5GAN f;  3MJX A;  3JCM f;  4C5I A;  3Q1J A;  2KE9 A;  4C8Q A;  4HCZ A;  2L2P A;  3BY7 A;  1MV3 A;  2RHI A;  3CEY A;  1VQ8 A;  1QVG S;  1ACM B;  2F2W A;  2SEM A;  5GMK m;  4OB0 B;  2X3W D;  4BI3 A;  4RTV A;  4GY5 A;  2KNB B;  3CCM A;  1KQS S;  4MDX A;  4C0D B;  3JAM E;  4R56 A;  4M77 C;  3BDL A;  1UUE A;  1ZSG A;  2FYK A;  3M0P A;  4BD3 A;  2E5K A;  2DIL A;  1B34 B;  4ELZ C;  1N8R U;  1NYF A;  1MHN A;  2EQI A;  3HHT B;  3L1A A;  5HKC A;  5DLO A;  2ZPB B;  3G7Z A;  4M75 B;  5IHI A;  1K73 C;  2KYM A;  5D6X A;  1LVK A;  4M7A A;  1OX9 A;  1WXT A;  2DL5 A;  4FL6 A;  1D0Z A;  4BDZ A;  2XDP A;  2VC8 A;  1TUD A;  1M1K R;  2DYB A;  3EH2 A;  3FB9 A;  4TVR A;  2F2V A;  4C92 C;  2MAM A;  3UPU A;  4E7L A;  4A4H A;  5FU7 C;  1YIJ T;  4L5G A;  3DKM A;  2K3Y A;  2MCN A;  2YRV A;  4QQD A;  2F69 A;  1VIE A;  4E6R A;  2QAZ A;  3H0F A;  5DY9 A;  2ATC B;  3TEE A;  2DET A;  1YIT A;  2GF7 A;  1HXD A;  3JCM J;  3ZFJ A;  1GCQ C;  2ROT A;  2EYZ A;  2MF2 A;  2ZGW A;  3KFV A;  3TSW A;  4N0A A;  2CP6 A;  2JJ9 A;  2CDT A;  4PJO F;  4ZTJ A;  1B3Q A;  1PHT A;  1YIJ Q;  4AMC A;  1ZSZ C;  3LYI A;  4BDY A;  2DNU A;  4E7H A;  1PNJ A;  3OW2 A;  1QKW A;  1BU1 A;  3QYH B;  1UDL A;  3MKD A;  4BAC A;  1B34 A;  1H8K A;  2KEA A;  3PFS A;  4J9H A;  5LJ5 g;  3JCM Q;  2KT8 A;  4CC2 A;  4F7U E;  3O5Z A;  4M75 A;  2E12 A;  1VQ7 A;  3M58 A;  5I11 A;  4J9D A;  1WJR A;  3LGF A;  5GAN 4;  2L3R A;  2DPP B;  1MV0 B;  1XTD A;  3QWX X;  3UT1 A;  4AG1 C;  3LWI A;  4XTY A;  4DBQ A;  2QEX A;  1VQK A;  1UJY A;  3G1J A;  4J7F A;  2CH4 W;  1M5Q 1;  4Y28 E;  2NUT B;  1S72 T;  2JMC A;  3CC4 A;  5HK3 A;  3P8D A;  3CC2 A;  1KFZ A;  4LXC A;  1SG5 A;  3A8G B;  5DM7 R;  4E7J A;  2CP0 A;  2KVQ G;  1HK9 A;  4J8O A;  1WQW A;  2QGG A;  1PWT A;  5GAO n;  2X4X A;  3UWN A;  4N4H A;  4JZ4 A;  5GMK i;  4WTO B;  4JJB A;  1CKA A;  2DZC A;  3HP9 A;  5C0M A;  1OU9 A;  5GAM j;  5GAN j;  4M7D E;  1JJ2 A;  3UA6 A;  4HVU A;  3CCJ Q;  3MEA A;  1VQ4 A;  1NJI U;  3JCM b;  1S72 Q;  5GAN 8;  2QTV A;  2RF0 A;  2KI7 A;  4E47 A;  1UFF A;  4J83 A;  4WCI A;  1Q7Y R;  1VQL T;  5L23 A;  2K6D A;  2YUP A;  1RLQ C;  2X9H A;  1IO6 A;  4A53 A;  5FWC A;  1XNI A;  5D6W A;  4C92 F;  4XU0 A;  1PCX A;  2V26 A;  1BI1 A;  4LDX A;  3M5A A;  5GJW B;  5GMK h;  1XJW B;  3OA6 A;  2COZ A;  4M77 B;  1HD3 A;  4EMK C;  3H8Z A;  3TQ7 P;  3CMA A;  4A54 A;  1MMG A;  3VRY A;  4PKC C;  3BE3 A;  1R0C B;  2M51 A;  1WJS A;  1VQN A;  1OYX A;  1Y96 B;  1X69 A;  4PL6 A;  5CAI A;  1X27 A;  1Q86 U;  2FPF A;  2W10 A;  1TUC A;  2NUT A;  1UGQ B;  4F04 B;  1K4U S;  4NL3 A;  2B86 A;  1UGR B;  2E6N A;  2V1Q A;  3CCS T;  4EMH A;  3REA B;  2FO0 A;  3PNW C;  1KQS P;  3OYY A;  1W2B S;  1MMA A;  2DD5 A;  1YJW A;  2LX7 A;  4M75 G;  8AT1 B;  1NE8 A;  1I5L A;  1YHQ T;  1TOV A;  3H6Z A;  2KR3 A;  1B7T A;  3EG0 A;  1T3L A;  3JB9 G;  1M3C A;  1BB9 A;  4JRI A;  2BIV A;  2EWN A;  2RA2 A;  3X24 B;  2BE9 B;  5LJ5 e;  1WPY A;  3GNF B;  3HRU A;  1WA7 A;  1KD1 C;  4ZN1 A;  7AT1 B;  1RAI B;  1JBM A;  1OQK A;  1X43 A;  2EGE A;  5IXB A;  1N9S A;  4J9I A;  5CVI A;  1F1B B;  3CCS Q;  2WSC E;  2FZK B;  2P4T A;  1EZZ B;  3QDR B;  2RM4 A;  1D0X A;  1YHQ Q;  1VQM T;  3VV0 A;  4EDU A;  3BDU A;  2VGN A;  1Y07 A;  2W0Z A;  4M77 A;  3M54 A;  1T0J A;  4X1V A;  3HSB A;  5IAY A;  3GF5 A;  2K5F A;  1KD1 R;  1VOM A;  1Y96 A;  2PVO B;  4O5V A;  3BW1 A;  2D8J A;  1M30 A;  4FSS A;  2FG0 A;  3RER A;  2QQ9 A;  1M1F A;  1ZX6 A;  2C0I A;  4VUB A;  1KQ2 A;  2DER A;  1VQM Q;  3CD6 A;  4FIB A;  2D0Q B;  4RTW A;  2M02 A;  1C1A A;  3RUX A;  2F5T X;  1FMW A;  2EIF A;  1I0C A;  1YCS B;  1VQO A;  3CCV A;  1PRL C;  5LJ3 h;  2JM8 A;  2HZY A;  3L2Z A;  3S3N A;  1FYN A;  2E3I A;  1JEG A;  5GAM e;  5GAN e;  1YJ9 T;  4RTY A;  2DMO A;  1M8M A;  2PNI A;  2XHC A;  3VS3 A;  1U06 A;  2C0O A;  2E4H A;  3LGL A;  1UEC A;  2E1H A;  1QCF A;  2FHD A;  2M0Y A;  4ZN3 A;  3OYN A;  1MMD A;  4JUV A;  2KQW A;  2HSE B;  3OS1 A;  3NGP A;  3CCJ A;  2DRK A;  3A5Z B;  1OV3 A;  1KHC A;  4PK4 A;  3H41 A;  1GBR A;  3QUI A;  3S6W A;  5GAO l;  4LE9 A;  2HQE A;  2L89 A;  4AFU C;  2MK5 A;  1IHW A;  2FPD A;  4AG2 C;  3DLL A;  3AT1 B;  3CBP A;  1PD1 A;  3MCA B;  3OYL A;  1KC8 C;  3RBB B;  2P0Q A;  3KUF A;  1K73 U;  1WDX A;  2A36 A;  2RQV A;  3J81 E;  4KUI A;  2DVE A;  2M16 A;  4LDW A;  1QVG A;  2RQT A;  2CP5 A;  1Y7X A;  4DBH A;  1G3S A;  2DK3 A;  3CME A;  4PJO E;  1FMK A;  1WJQ A;  1KQS A;  3S3O A;  1M9S A;  4Z8A A;  4JJN K;  1D09 B;  4Q5W A;  5D6Y A;  1NJI C;  3LH5 A;  4M77 G;  2QA4 Q;  3OYB A;  1PD0 A;  2E5Q A;  2QQB A;  2JTM A;  3V7C A;  2VUB A;  2YUO A;  2DXT A;  1BI0 A;  3EGU A;  2AZS A;  1GXI E;  2DJQ A;  1LNX A;  4M75 D;  4HA8 A;  3VS4 A;  2JZ2 A;  1YJN T;  1RL2 A;  1KC8 R;  3JB9 D;  3OYD A;  4XU3 A;  2CZ6 B;  5DLQ E;  4BY6 B;  3QO3 A;  2EYX A;  1YI2 A;  2BE7 D;  3M0T A;  4F7U B;  1U5S A;  4BUG A;  3C95 A;  1WX6 A;  1WFW A;  3FJ5 A;  2CT4 A;  1A0N B;  3G4S T;  1NBE B;  1NJI R;  3FJP A;  3OY9 A;  3OMC A;  1XOV A;  1QVP A;  4ESR A;  3CCR A;  1TH7 A;  2DO3 A;  5ECA A;  1YJN Q;  3EAE A;  2KT1 A;  3G71 T;  3R6N A;  4OB1 B;  1N9R A;  3LLR A;  2E6Z A;  1GRI A;  1I81 A;  2QXF A;  2COY A;  2DIQ A;  1NEG A;  3T9N A;  5LJ5 f;  4A4E A;  4MML A;  3QZ5 B;  2L0A A;  3OYH A;  2LCL A;  4M7D B;  2ROL A;  1GL5 A;  5J26 A;  3I56 T;  4QT7 A;  1UGS B;  1Y57 A;  1I1J A;  4GBQ A;  4C92 E;  1Q86 R;  2ED0 A;  3CCE T;  3G71 Q;  1X75 C;  2E65 A;  1U3O A;  1QMC A;  1SRM A;  1VQP T;  2DL7 A;  4JLI A;  1N6A A;  3E1S A;  5FW9 A;  3MHX A;  4ZNX A;  4E7K A;  1ZBJ A;  3HPW A;  2DRM A;  2E10 A;  2RI3 A;  4F7U A;  4OMP A;  3OW2 P;  3M4Y A;  3C4S A;  2KAF A;  3I56 Q;  4A63 B;  2LP5 A;  3HFN A;  4HCB A;  2D8H A;  3GIB A;  1KQ1 A;  3SHW A;  4PJO C;  2YLC A;  1GBQ A;  2LMJ A;  5LL6 S;  2X4W A;  5FRO A;  1Z9Z A;  3CXC S;  1G3Y A;  3UF4 A;  2CS7 A;  2KGT A;  3UDC A;  3GOX A;  1WHL A;  1WNL A;  2RHX A;  1MUZ A;  1X6O A;  6AT1 B;  1ZUK A;  1VQ4 T;  3IQL A;  2RJD A;  1IGU A;  1IRX A;  2GQV A;  3M59 A;  1XQH A;  3ULR B;  4RKU E;  4XAX B;  4OVA A;  4C0F A;  1VYU A;  1X2Q A;  2QTX A;  1SHG A;  4KRT A;  5HCK A;  3INZ A;  3SD4 A;  3CC7 T;  5FLX E;  2VYT A;  4FCY A;  1VYT A;  4JRK A;  4M7D A;  2E64 A;  2EJF A;  2HEQ A;  2YUQ A;  4ME7 A;  1QCN A;  3I55 T;  3C12 A;  2VB6 A;  2ZZD A;  4QQG A;  4RG8 A;  2D1X A;  5CCA A;  1JJ2 P;  4LD6 A;  4M77 D;  4M78 E;  4C5E A;  1IB8 A;  2PTK A;  2HKQ B;  2DYI A;  2X4Y A;  2CSI A;  1SRL A;  2QA4 A;  2Y4X A;  5KYW B;  2XU8 A;  4RMO A;  3L2Q A;  4ANJ A;  3QG1 A;  3V8K A;  3VS6 A;  2BTT A;  3RDV A;  2OTL A;  3G6E T;  2EKO A;  1C0M A;  3NPF A;  3JCM c;  3CC7 Q;  2DA9 A;  1E7O A;  1KD1 U;  2O9S A;  2EQK A;  3SB2 A;  4L59 A;  5HK0 A;  1BCM A;  2JOY A;  1U1S A;  5GAM d;  1QWE A;  5GAN d;  3JCM d;  3DB4 A;  1R8O B;  3CCU T;  4MZT A;  4IUV A;  3QXE B;  1SEM A;  3FIF A;  3M0U A;  4FYW B;  2RO0 A;  1AZE A;  4CC4 B;  1W2B A;  1G3W A;  3M0S A;  2RQR A;  1UTI A;  2CP3 A;  2GTJ A;  3L2U A;  2PZ1 A;  1D0Y A;  1FX7 A;  3UA7 A;  1ZA1 B;  1WXU A;  4J9F A;  4OMN A;  2J06 A;  4X9C A;  4GLK A;  2DXB A;  1PKS A;  3PMT A;  2K3X A;  2JUF A;  3M0Q A;  4F7U G;  3OYF A;  3VJP A;  4FM4 B;  1PM3 A;  3CCL T;  1HJD A;  3OQ5 A;  4RCC A;  2GQI A;  3DB3 A;  2NLU A;  2DL4 A;  3X26 B;  1K73 R;  3E2U A;  2XI9 A;  5LJ5 j;  4OF1 A;  2XDB A;  5KYN A;  5KYU B;  1BCO A;  5LJ3 g;  4O6J A;  5CQX A;  1N5Z A;  3OSS C;  3QII A;  5GMK e;  2L3P A;  1QLY A;  1LCK A;  4DBF A;  5KYW A;  5CO7 A;  2GNC A;  4OML A;  4XTV A;  3VKI A;  2XKO C;  1VQ5 T;  3CCL Q; 
#chains in the Genus database with same CATH homology
 3JCM V;  4JS5 A;  5GAN 3;  3QPH A;  4JRI A;  2BIV A;  2EWN A;  3SWN B;  2RA2 A;  3X24 B;  2LC4 A;  2XDD A;  4JS4 A;  5LJ5 e;  1FXX A;  2RJF A;  1WPY A;  3FEO A;  4M78 A;  5CIU A;  3CD6 T;  1PSE A;  3GNF B;  4V2S A;  4M7D G;  3HRU A;  2CKK A;  2D9T A;  4F7U F;  1KD1 C;  4ZN1 A;  5EG2 A;  2G3R A;  2BKD N;  1JBM A;  1YJ9 A;  2PQW A;  2Y4Y A;  1Q82 U;  1N9S A;  1O75 A;  2EJG A;  5CVI A;  4XU2 A;  1NJI U;  2R58 A;  4BE1 A;  2WSC E;  3M9Q A;  4J7I A;  4ZGJ B;  4LDY A;  3MP6 A;  4XTU A;  2LQK A;  2P4T A;  3FDR A;  3QDR B;  5GAO p;  2MWO A;  2RM4 A;  3E19 A;  1G3T A;  3NTI A;  2K5I A;  3C94 A;  1VQM T;  3JCM P;  3VV0 A;  4PJO B;  4LD9 K;  4EDU A;  3BDU A;  2HQX A;  4BB7 A;  1K9M U;  3JB9 H;  3CMA T;  2VGN A;  2ZPG B;  3V7R A;  1Y07 A;  3FRN A;  4D6W A;  2CZ7 B;  1NPR A;  3OYE A;  3L2W A;  3GP8 A;  1IRE B;  2EAY A;  4M77 A;  2CGH A;  2DTO A;  3FC3 A;  2JNG A;  1VQ6 A;  3LX7 A;  3M54 A;  4M78 C;  2D6F A;  3RES A;  1JB0 E;  5A0L A;  3A8O B;  3CCQ T;  4IKF A;  4MZM A;  4M75 F;  4M75 C;  3L2R A;  1KC8 U;  4JRQ A;  2XK0 A;  3HRT A;  5GAN 7;  1VQ9 T;  1VQN T;  4FU6 A;  3HSB A;  5IAY A;  2K4Y A;  3GF5 A;  2K5F A;  3JB9 F;  3LH0 A;  3OYI A;  3MO8 A;  1O9S A;  1Y96 A;  2PVO B;  2E70 A;  4O5V A;  3BW1 A;  4MMK A;  3OMG A;  1M1K C;  3RER A;  3OYM A;  1BIB A;  2QQ9 A;  1M1F A;  2DAQ A;  4RG2 A;  2PU9 B;  4M7D F;  2LVM A;  4VUB A;  1KQ2 A;  1G5V A;  3CBO A;  5I21 A;  1UB4 A;  1Q86 C;  3CD6 A;  4FIB A;  4J6Y A;  4C0G A;  2D0Q B;  3QBY A;  1YJW T;  2PUK B;  1VUB A;  2O01 E;  3RUX A;  1JRI A;  2F5T X;  3TRE A;  2K57 A;  3PMI A;  4OGC A;  2DD4 A;  2EIF A;  5J3B A;  2GFA A;  2DTI A;  4M77 E;  3PT9 A;  4JRP A;  1RI0 A;  1VQ4 A;  2LNV A;  4HCC A;  4C92 D;  2QDY B;  5FU6 B;  1VQO A;  2EQU A;  4OGE A;  3CCV A;  3RKW A;  3P8H A;  5LJ3 h;  3RMS A;  4C8Q E;  3JCM X;  2XG8 D;  4UC4 A;  4R55 A;  3QKJ A;  3CBM A;  3L2Z A;  4NL2 A;  3S3N A;  1ZBX A;  3EFS A;  3QJ6 A;  3SWN A;  2ZPE B;  2DXU A;  5LJ3 j;  2RH2 A;  2JVV A;  5CR2 A;  5LJ3 d;  5GAM e;  5GAN e;  4NOY A;  5GAO r;  1YJ9 T;  3OBW A;  5FRM A;  4A4K A;  4OB3 B;  3FLG A;  1ZHI A;  4IUU A;  5HY6 A;  1M90 C;  4DQ2 A;  2XHC A;  3N5B B;  4C8Q B;  1YJN A;  1Q81 C;  3EFR A;  1Q7Y U;  3RKY A;  3LGL A;  4QVC A;  2E1H A;  3WXM B;  1V29 B;  2FHD A;  2L8D A;  3M55 A;  4FT2 A;  4ZN3 A;  3OYN A;  1Q82 C;  5I2S A;  1X01 A;  4JUV A;  2DIG A;  2KQW A;  2LX9 A;  2M1H A;  3MEU A;  1FWZ A;  3OS1 A;  3OYJ A;  3QZ9 B;  2V8J A;  4HT9 A;  3CCJ A;  3A5Z B;  4PJO A;  3L42 A;  5M9O A;  1KHC A;  2KMT A;  1VQ6 T;  1K8A C;  3GPL A;  1I4K 1;  1BKB A;  3RKX A;  5KCH A;  3QJY A;  4N4G A;  4QW2 A;  3G4S A;  4B9X A;  4CI0 C;  2R5A A;  2VXE A;  2EQM A;  3QUI A;  3S6W A;  5GAO l;  4BE2 A;  2HQE A;  2L89 A;  3URG A;  4ZGE B;  2RHZ A;  1K9M C;  4C92 B;  3JB9 I;  2DJZ A;  4M7A E;  1M1G A;  2KY9 A;  2LT1 A;  3DLL A;  2VGM A;  3CBP A;  3MCA B;  2B8A A;  1NZ9 A;  3P8B B;  4XQ3 A;  5FU7 B;  3ZBD A;  3OYL A;  1KC8 C;  2O4X B;  3LW5 E;  4N4I A;  2P0Q A;  3KUF A;  1UEB A;  2V8K A;  3V8J A;  3X20 B;  2A7Y A;  3DLM A;  1K73 U;  3J81 E;  3NTH A;  3G71 A;  4KUI A;  4HKE A;  2DVE A;  1BIA A;  2M16 A;  4X34 A;  2V8I A;  4LDW A;  3PGG A;  4X9D A;  3RMQ A;  3SDZ A;  1QVG A;  3CPF A;  2RI5 A;  4XTZ A;  5GAO q;  5CKE A;  3E9G A;  3HFO A;  1Y7X A;  1BYM A;  4M7A B;  1G3S A;  2CYZ B;  2DK3 A;  2QQS A;  5GAN g;  5L8R E;  3CME A;  3CCR T;  4PJO E;  4KUL A;  1SSF A;  1WJQ A;  3M56 A;  2CZ1 B;  3S3O A;  1KQS A;  4MZP A;  1VQO T;  1M9S A;  3CCV T;  1U1T A;  3RIR A;  4C5G A;  4JJN K;  4Q5W A;  5D6Y A;  3J80 E;  4CRI A;  1NJI C;  4M77 G;  2IVW A;  2OTJ A;  4Z02 A;  2LDM A;  3OYB A;  4XTX A;  2QQB A;  2E5Q A;  3ASK A;  3MP1 A;  4FT4 A;  5IT9 E;  2JTM A;  5C6S A;  5CK9 A;  2XD0 A;  3V7C A;  4YTL A;  2VUB A;  5GAN 5;  4P5N A;  2DXT A;  2JN0 A;  4A4G A;  4C8Q G;  1NPP A;  4IUQ A;  1BI0 A;  3OS2 A;  3I56 A;  2A3L A;  3VUZ A;  4M78 D;  5CQY A;  1AHJ B;  2K2V A;  3QSU A;  1GXI E;  4XTW A;  4QQ6 A;  1EIF A;  1LNX A;  5CKH A;  2Y90 A;  4M75 D;  5GAN 6;  3CCE A;  1QVF S;  4HA8 A;  1QP2 A;  3F70 A;  1YIJ A;  2JZ2 A;  4KBM B;  1WGS A;  2LRQ A;  4M78 F;  2QQR A;  1RL2 A;  1YJN T;  3JB9 D;  5GAM f;  1YCY A;  5GAN f;  3JCM f;  4C5I A;  3Q1J A;  3OYD A;  4XU3 A;  2CZ6 B;  5DLQ E;  4C8Q A;  2C06 A;  4HCZ A;  1VQP A;  4BY6 B;  2ZPH B;  2KDS A;  3BY7 A;  3QO3 A;  1YI2 A;  4M7D D;  4F7U B;  2RHI A;  1Q7Y C;  3CEY A;  3QHS A;  2XIC A;  4PLI A;  3CCJ T;  2ZPF B;  1PSF A;  2RJE A;  4BUG A;  3C95 A;  5A0D A;  4LDU A;  1VQ8 A;  1QVG S;  4QVD A;  2GFU A;  3G4S T;  5GMK m;  3X28 B;  4OB0 B;  2E41 A;  4BI3 A;  3FJP A;  4WF2 A;  3OY9 A;  3OS5 A;  4GY5 A;  3CCM A;  3ER0 A;  1KQS S;  4MDX A;  4C0D B;  3JAM E;  3OMC A;  3ME9 A;  2DZ9 A;  2QI2 A;  1XOV A;  2HAX A;  1WQ7 A;  1QVP A;  3CCR A;  4R56 A;  1TH7 A;  4C92 A;  1KHI A;  2DO3 A;  4M77 F;  3BDL A;  4M77 C;  4BE0 A;  3JSC A;  3R6O A;  4M7A G;  2RD1 A;  3TU4 K;  3EAE A;  3A8L B;  4LDV A;  4EPC A;  2R5M A;  2FYK A;  2RI2 A;  4BD3 A;  3G71 T;  4L6V 5;  4C8Q C;  1B34 B;  4ELZ C;  2O4X A;  4OB1 B;  3MP8 A;  1MHN A;  1N8R U;  5A2Q E;  5KCO A;  3HHT B;  3M57 A;  3L1A A;  1N9R A;  5HKC A;  2MMP A;  3LLR A;  5DLO A;  1N27 A;  2ZPB B;  3G7Z A;  4M75 B;  3WVD B;  2EJ9 A;  2E6Z A;  2EFI A;  1I81 A;  2QXF A;  1K73 C;  2DIQ A;  3CME T;  5D6X A;  4PNO A;  3T9N A;  4PLL A;  5LJ5 f;  4A4E A;  4M7A A;  3AHU A;  4MML A;  2RB6 A;  4FL6 A;  1U8R A;  4PJO G;  3SFM A;  2OTJ T;  4BDZ A;  3QZ5 B;  3OYH A;  2LCL A;  2XDP A;  2VC8 A;  4M7D B;  2ZCF B;  3CC7 A;  2HD0 A;  3CXC A;  5J26 A;  3FB9 A;  2QQA A;  4DOV A;  4TVR A;  2VV5 A;  4BI4 A;  3I56 T;  3NFC A;  4C92 C;  1UGS B;  4C92 E;  2MAM A;  2R57 A;  2YHT A;  4RCB A;  3OB9 A;  3UPU A;  2LCC A;  4E7L A;  3MEW A;  4A4H A;  3CCE T;  3JCM W;  1IZ6 A;  2VXF A;  5FU7 C;  5J39 A;  1X75 C;  5GAM g;  4L5G A;  2HNI A;  3KBG A;  3JCM g;  2E65 A;  3DKM A;  2K3Y A;  3OBY A;  5LJ3 e;  4J5Y A;  3I55 A;  1S72 A;  3V7S A;  2YRV A;  1M4Z A;  4QQD A;  3SWN C;  2F69 A;  3VU3 C;  1YBY A;  1VIE A;  4A4F A;  1VQP T;  4JLI A;  5KH6 A;  3L2V A;  2PVG B;  4JDS A;  1N6A A;  3E1S A;  5DY9 A;  1YI2 T;  4M7A C;  3TEE A;  3MHX A;  4E7K A;  1VIF A;  3M4G A;  1YIT A;  2GF7 A;  1HXD A;  3OSV A;  1M8V A;  3JCM J;  2FL7 A;  2H3J A;  3HPW A;  1KG1 A;  3ZFJ A;  2E10 A;  2RI3 A;  5CKB A;  4EMK B;  4F7U A;  3G6E A;  2RK1 A;  3M4Y A;  4II1 A;  2LQ8 A;  1VQ8 T;  3C4S A;  2KAF A;  4DA4 A;  2DTH A;  4NS5 A;  4E7I A;  2MF2 A;  2JTF A;  3HFN A;  2ZGW A;  2LTO A;  3CCM T;  3VUB A;  4HCB A;  4N0A A;  4B9W A;  3GIB A;  2X4J A;  1KQ1 A;  3OYC A;  3PTA A;  4PJO F;  4ZTJ A;  3CCU A;  4PJO C;  2OAU A;  2RHU A;  2YLC A;  2OTL T;  2KSS A;  1P92 A;  3LYI A;  2WAC A;  5LL6 S;  2X4W A;  5FRO A;  4BDY A;  3A8M B;  3BFM A;  4C0Z A;  3GNG A;  3CXC S;  2RHY A;  4J6W A;  4OB2 B;  4E7H A;  1G3Y A;  1Y71 A;  3OW2 A;  2CS7 A;  1D3B B;  3UDC A;  3GOX A;  4EMG A;  3QYH B;  1WNL A;  2MI6 A;  2RHX A;  4BAC A;  1B34 A;  1X6O A;  2DKG A;  2PVD B;  2P0K A;  3PFS A;  4BY6 C;  2KK4 A;  5LJ5 g;  3JCM Q;  1VQ4 T;  2RJD A;  4HT8 A;  4F7U E;  2GQV A;  3M59 A;  5CKF A;  4M75 A;  1N8R C;  1M90 U;  3X25 B;  1XQH A;  1Q81 U;  2E12 A;  1VQ7 A;  1H64 1;  4ATO A;  1QW1 A;  3M58 A;  4RKU E;  4XAX B;  4OVA A;  4XK8 E;  4C0F A;  3E9F A;  1WJR A;  2QTX A;  2AHJ B;  4MDW A;  2CZ0 B;  2K5L A;  3QYG B;  3INZ A;  3LGF A;  4IUP A;  5GAN 4;  2L3R A;  2DPP B;  3SD4 A;  3CC7 T;  4N0A C;  5FLX E;  3KXT A;  2VYT A;  3CCL A;  3OYA A;  1XTD A;  4JRK A;  3HKS A;  3UT1 A;  4M7D A;  5GMK l;  4C0D C;  1OZ3 A;  2E64 A;  1QP3 A;  2EJF A;  4C92 F;  1K8A U;  3A8H B;  4KT0 E;  4ME7 A;  4XTY A;  3LWI A;  4FSX A;  4C92 G;  2QEX A;  1VQK A;  4J7F A;  5FU6 C;  3GLX A;  1BI3 A;  1M5Q 1;  4Y28 E;  1S72 T;  3I55 T;  3C12 A;  2EQJ A;  3OYG A;  2ZZD A;  4QQG A;  4RG8 A;  5CCA A;  5KE2 A;  3CC4 A;  5HK3 A;  3P8D A;  3CC2 A;  1OI1 A;  3ZEH A;  4LD6 A;  4M77 D;  3A8G B;  2EYQ A;  4M78 E;  4C5E A;  5DM7 R;  3CPW A;  4E7J A;  2FVU A;  2KVQ G;  1HK9 A;  2MWP A;  2X4Y A;  1ZQ1 A;  2BUD A;  2YLB A;  3CCS A;  4M75 E;  2WSE E;  5LJ3 f;  4J8O A;  2QA4 A;  2M0O A;  1WQW A;  2Y4X A;  4C8Q D;  2L5Q A;  5GAO n;  1YIT T;  4RMO A;  2XU8 A;  2X4X A;  3UWN A;  2GCX A;  3QG1 A;  3V8K A;  4N4H A;  3V8L A;  3L2Q A;  2OTL A;  3G6E T;  3OW2 S;  5GAM h;  5GMK i;  5GAN h;  1YHQ A;  2EKO A;  3JCM h;  3PIP A;  4M7D C;  5AYF A;  3JCM c;  2DZC A;  1VQ5 A;  3HP9 A;  4EMK A;  3J7A F;  4ZTF A;  1KD1 U;  4C8Q F;  2P0P A;  5C0M A;  5IN1 A;  4M78 B;  5GAM j;  2EQK A;  3SB2 A;  3TCJ A;  4L59 A;  1DJ7 B;  2RJC A;  5HK0 A;  5GAN j;  1JJ2 A;  4M7D E;  4JLG A;  2JOY A;  2RK2 A;  1U1S A;  4ELY C;  5GAM d;  5GAN d;  3JCM d;  2XID A;  3DB4 A;  4J6X A;  1R8O B;  3CCU T;  3MEA A;  4IUV A;  4MZT A;  2DEQ A;  2LT4 A;  3HRS A;  3FIF A;  3QXE B;  3JRZ A;  4QVZ A;  3JCM b;  2RO0 A;  3MEV A;  5GAN 8;  4E47 A;  4J83 A;  5CKD A;  1W2B A;  1VQL T;  1BI2 A;  2IG0 A;  1G3W A;  1OZ2 A;  3L2U A;  4IUR A;  1YIJ T;  4A53 A;  1FX7 A;  2M9U A;  3O8V A;  1D3B A;  1UGP B;  3PIO A;  4OMF B;  1XNI A;  3HL8 A;  1I8F A;  4X9C A;  5D6W A;  3VYG A;  3NTK A;  4GLK A;  2F5K A;  4XU0 A;  2DXB A;  4XU1 A;  1BI1 A;  4LDX A;  3M5A A;  3PMT A;  2K3X A;  5GMK h;  2JUF A;  1VQM A;  1VQ7 T;  4C5H A;  3OA6 A;  2ZPI B;  1LJO A;  3JCM e;  4M77 B;  2FB7 A;  4EMK C;  4F7U G;  1LOJ A;  3VYH B;  3H8Z A;  5KE3 A;  3OYF A;  3CMA A;  3CPW S;  3OS0 A;  3MET A;  4A54 A;  3JB9 J;  1MGQ A;  3VJP A;  5GMK j;  4M7A D;  3WVE B;  2PUO B;  3LWH A;  4FM4 B;  4PKC C;  3CCL T;  3OQ5 A;  1W4S A;  4DOW A;  5LJ5 h;  3OYK A;  3CCQ A;  4RCC A;  4M7A F;  1WJS A;  1M1K U;  1VQ9 A;  3DB3 A;  1VQN A;  1OYX A;  1Y96 B;  2NLU A;  2QEX T;  3X26 B;  1VQK T;  2XI9 A;  5LJ5 j;  4PL6 A;  5CAI A;  4OF1 A;  2XDB A;  1Q86 U;  3CC4 T;  5LJ5 d;  4IUT A;  5A0G A;  1JJ2 S;  3CC2 T;  5FRN A;  4PJO D;  2I2L A;  3M53 A;  5GAN 2;  1UGQ B;  5LJ3 g;  4O6J A;  4Y91 A;  5CQX A;  4BI8 B;  1UGR B;  4ZGD B;  4NL3 A;  1QVF A;  3OSS C;  2E6N A;  3CCS T;  2DXC A;  2QA4 T;  4EMH A;  3S3M A;  4M78 G;  4OP0 A;  3QII A;  3PNW C;  5GMK e;  3OYY A;  1W2B S;  2DD5 A;  1YJW A;  1H3Z A;  4M75 G;  1NE8 A;  4KUD K;  1I5L A;  1YHQ T;  2HBP A;  2WSF E;  3H6Z A;  5CO7 A;  1VQL A;  4XTV A;  3VKI A;  2XKO C;  1VQ5 T;  5GAO m;  5I2M A;  3JB9 G;  2X35 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...