4M7DC

Crystal structure of lsm2-8 complex bound to the rna fragment cguuu
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
77
structure length
77
Chain Sequence
b'TPLDLLKLNLDERVYIKLRGARTLVGTLQAFDSHSNIVLSDAVETIYQLNNEELSESERRSEMVFIRGDTVTLISTP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords U6 snRNA-associated Sm-like protein LSm8
publication title Crystal structures of the Lsm complex bound to the 3' end sequence of U6 small nuclear RNA.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Rna binding protein
total genus 11
structure length 77
sequence length 77
chains with identical sequence J
ec nomenclature
pdb deposition date 2013-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4m7dC00
4M77G 1WQ7A 2YLCA 4M75E 4C92D 4EMKA 3RKWA 3SWNB 2EJGA 4M7AF 4NL3A 4C8QB 3EFSA 4JRIA 1WNLA 2DVEA 2E41A 4M75G 5GAN8 1YCYA 5GAMe 4XTYA 5GAOn 3V7CA 1M8VA 4MMKA 2QTXA 4C8QE 4PJOG 4DQ2A 4MMLA 4NL2A 2E10A 5GAN2 4M78B 5DY9A 3RKYA 1Y96A 4C8QG 4HT8A 3INZA 3JCMJ 3QHSA 3RKXA 4PJOC 4JLIA 5GANf 3RERA 4M78E 4M7AB 5LJ5g 3QUIA 3GIBA 2DXTA 3FIFA 2DTHA 5GANg 4M78G 1MGQA 4M7DG 4M7AE 1M5Q1 3JB9H 2CGHA 4RCBA 5GAOp 2EJ9A 3FJPA 4M77A 3JB9D 3VU3C 4X9DA 2EAYA 3RUXA 2YHTA 4EMHA 4M7AG 4M7DC 3L2ZA 3JB9F 2DJZA 4M77C 4C92F 1JBMA 1N9RA 4F7UA 2FYKA 4X9CA 1H641 2RB6A 4A53A 5LJ5h 2DEQA 3JCMf 5LJ3f 4PJOA 4M75C 2I2LA 4XU0A 2VXEA 5I21A 2RM4A 5GAN6 5GMKm 5LJ5f 5GANh 4EMKB 3HFNA 1U1SA 3JCMg 5LJ3g 3HFOA 5GAN7 1N9SA 4HA8A 5GMKh 2DXUA 3EFRA 3SWNC 4PNOA 3JB9J 1B34A 1I5LA 4C92B 4C8QC 4M77D 4XU3A 1D3BA 3JCMQ 3JCMd 4M78A 4M77F 3V7SA 4M7DA 5GAN4 2JN0A 3QO3A 4C92E 1JRIA 2DZCA 1LJOA 1Y96B 5GANe 5LJ5d 5GAMg 5GAOm 4V2SA 2E65A 2EWNA 4M78C 4M7AA 3JB9I 2RD1A 4C92G 5GANd 1X01A 2K57A 4F7UF 2FB7A 4J6XA 1LNXA 4PJOD 4JUVA 4M75A 5LJ3h 3JCMh 1KQ2A 4JRKA 4M7AC 3PGGA 4PJOF 4HT9A 2VC8A 5GAN5 4XTXA 3RESA 4M77B 4XTZA 4A54A 4J5YA 4QVDA 5GAOq 5LJ5j 3SWNA 4N0AA 3JCMb 3V8LA 1HXDA 1WPYA 1I8FA 4C8QA 3V7RA 4M77E 5CAIA 2EJFA 5GANj 5GAMh 4M78D 4M7DD 1I4K1 2VXFA 3JCMe 4N0AC 4F7UB 4J6WA 5GMKi 5GMKj 3JCMX 4M7DF 3BFMA 1TH7A 4XTUA 1BIBA 4RCCA 5GAMf 5LJ5e 5GAN3 4WF2A 3JCMW 3HSBA 3QSUA 5LJ3d 4M7AD 4PJOB 4F7UE 4XQ3A 3JB9G 4M75D 4PJOE 2DTIA 3BW1A 2E64A 4EMKC 4F7UG 2DTOA 1HK9A 3FB9A 4M75F 1WQWA 3V8JA 1B34B 4C92A 1U1TA 2RA2A 1KQ1A 3SB2A 4EMGA 3AHUA 4XU1A 1D3BB 3L1AA 3JCMP 5GAMd 5GMKl 4C92C 4QVCA 4M7DB 4OP0A 3JCMc 5GAOl 4C8QD 5LJ3j 2Y90A 4XU2A 4C8QF 3BDUA 1LOJA 2YLBA 3M4GA 2DZ9A 4XTWA 4XTVA 4M7DE 2E1HA 5GMKe 3BY7A 2DKGA 5GAOr 2ZGWA 1BIAA 4Y91A 4M75B 3RIRA 3JCMV 1I81A 2HNIA 4J6YA 4NOYA 3V8KA 5LJ3e 4M78F 5GAMj
chains in the Genus database with same CATH superfamily
1WQ7A 2YXYA 4MDWA 3OYYA 4RTWA 1VIFA 2JTMA 2DVEA 2O2OA 3CC4T 2ESWA 3V7CA 1EZZB 4MMKA 3TQ7P 2KXDA 4LNPA 1TUCA 1PKTA 4GBQA 5GJWB 1VQPT 3NPFA 3RKXA 4E7SA 4PJOC 1M30A 2RJDA 1H8KA 1YWOA 2XIDA 2AIRB 3VKIA 4BACA 5CQXA 1QP2A 3OA6A 1VQPQ 3CCST 2XKOC 1U5SA 4PLLA 1ZQ1A 4BE1A 1YITA 2QGFB 1VYUA 4ZTJA 2QYZA 1AWJA 4LXCA 3CCSQ 1G3SA 5LJ5f 2L3QA 3HKSA 3C0CA 2ZPGB 1WHGA 3JCMQ 1QVPA 3RMQA 2RHUA 1VQ4A 2DIQA 1ZUUA 3VYGA 3QDFA 3RNJA 3L2WA 2A0FB 3FJ5A 4QVZA 2QA4Q 4J5YA 4MZPA 1RABB 2EQKA 4OB1B 1M8MA 2KYMA 3M54A 3WXMB 3BE3A 3VRYA 4XTUA 3VS5A 3OYJA 1PHTA 2L89A 1QVFS 3X25B 1VIEA 3OYGA 5HK3A 1UUEA 5A0GA 1PSEA 2RQUA 3HRUA 1VQNA 2KQWA 1QVFA 3CBPA 3CCUA 2JOYA 4M7DE 1O9SA 4J9BA 2EPDA 3BY7A 1NLOC 1BIAA 1M3BA 1UGQB 1RACB 4L5GA 3OYIA 2NUTB 2HSEB 1GCPA 3LWIA 5CIUA 4JRIA 4FM4B 3GP8A 4HVVA 4OMFB 3ME9A 3MP8A 5J3BA 3VS7A 3ASKA 4Z02A 2KXCA 4C8QG 2CYZB 5GANf 2P0KA 3CCVA 5D6WA 5FROA 2DTHA 2HL5C 2CGHA 3VV0A 2EJ9A 3FJPA 3DB3A 4RTUA 1O75A 3L2UA 3ER0A 4HCZA 1TSFA 3M0QA 1YIJT 1WXTA 4JPBW 4X9CA 2MWOA 3JCMf 2KAFA 3P8HA 4XU0A 3RMSA 1NYFA 4LDWA 1PCXA 2DILA 3CEYA 1YIJQ 2KDSA 1GCQA 3EH1A 4M7DA 2DD4A 2DBKA 1K1ZA 1Q86C 2M02A 1BK2A 1VQPA 5GANd 1IXDA 1NLPC 1RAIB 4OB2B 4XTXA 2CUBA 3CXCP 2OAUA 3CCSA 4PJNA 2AT1B 2KRMA 2E3IA 3PFSA 4NS5A 2KEAA 5GMKj 2AKKA 3J7AF 1SRLA 1LCKA 4PJOB 4KRTA 3IQLA 4LDUA 2DTOA 1BU1A 3V8JA 2JMAA 2KY9A 2OTLT 3VUZA 3ZEHA 5GMKl 1OZ3A 1EFNA 3CCQT 2Y90A 2DL4A 3OS1A 2EQMA 2A7YA 2QA4A 1X6BA 2KE9A 4LE9A 2OTLQ 2F5KA 4J6YA 3CCQQ 1F1BB 1MMNA 2CP6A 6AT1B 2V1RA 1BYMA 2YLCA 2KR3A 4NL3A 2RPNA 2QGGA 1W2BP 2QTXA 3QXEB 4PJOG 2YRVA 2MPXC 3J80E 3TSZA 2CSQA 4OMOA 2O4XA 3FEOA 2RI3A 2LJ1A 3CCET 1G5VA 3JCMJ 3OYHA 1NM7A 3QDRB 2EQIA 3O8VA 3DB4A 3E9GA 2LQNA 1PSFA 1TOVA 1I1JA 3CCEQ 4A4GA 2VGNA 2IVWA 4IUQA 2XI9A 4FSXA 1Q81C 4BI3A 2X4JA 4DBHA 4UC4A 2P0PA 5L8RE 2I2LA 5FLXE 2J6FA 3MPUB 2I0NA 2EKHA 1GRIA 1B34A 4L6V5 4J9DA 3V7SA 2RHZA 1KK7A 4E2FB 4V2SA 1QCNA 2L5QA 1X01A 1SSHA 1M90C 2ED1A 4JRKA 2M0YA 1T3LA 2X4YA 1OQKA 4CC4B 2QXFA 1K8AU 1HXDA 4PJMA 1I4K1 5M9OA 4F7UB 1YIJA 4DOWA 2QDYB 4OGEA 1M2VB 1FXXA 5J39A 3JSCA 4XQ3A 4E7HA 4M75D 3BW1A 2WSEE 5KCHA 1HK9A 1NE8A 2RA2A 4E7IA 1RI0A 1X2QA 5GAMd 2C0TA 1E6HA 4BDYA 2YT6A 5LJ3j 1YN8A 4C8QF 5KYXB 1ZSGA 3Q1JA 2FRWA 2E12A 1BBZA 1IZ6A 4O5VA 5IHIA 2NUPA 2COYA 2LJ0A 2MWPA 2A08A 2K3BA 1I07A 2QG9B 4XTYA 1QVGP 1AVZC 3NFCA 3PMTA 5IXFA 4ATOA 1Z9QA 2X3WD 2C0IA 1Y96A 2D0NA 2K5FA 1K73R 4JLIA 4E7ZA 2ZAEA 3HRSA 3PIPA 3QZ5B 1R0BG 2MIOA 5CKHA 1HD3A 1AWOA 2CH4W 1K9MU 2OTLA 1SF9A 3VU3C 3CCQA 4M7AG 2VV5A 4FT4A 2MI6A 3L2VA 1D1CA 1KC8R 1BI1A 3FDRA 4WTOB 2HMAA 3OSVA 4ME7A 2JW4A 2ZPBB 2FZGB 3EFRA 1YJ9T 3JB9J 4N4GA 1NEBA 4FU6A 3CD6T 4IURA 5GAN4 2LX7A 1OZ2A 2HBWA 3CCEA 1OV3A 2IG0A 4BDZA 1YJ9Q 2DL7A 5FRMA 1W2BS 3CD6Q 3CBOA 2JNGA 3PGGA 3EG2A 4E7LA 2JM9A 5GAOq 5LJ5j 4EIKA 3C4SA 4M4ZA 1QCOA 1SSFA 2EJFA 2L0AA 2DPPB 1VQKT 3GF5A 1X27A 2QI2A 2V26A 2O4XB 3R6OA 3LX7A 1HJDA 1MMDA 2E6ZA 2CZ1B 4C5IA 3OYEA 2LNHB 1JXMA 1RAHB 4QVCA 4OP0A 1GXIE 4FIBA 2F5TX 4VUBA 4XTWA 2DKGA 2JS2A 4FW2A 2BZ8A 2DXCA 3TU4K 3VUBA 3UDCA 4HKEA 1BCMA 1QKWA 2LNVA 1RL2A 1EX4A 4Q5WA 2EBPA 1AEYA 1KC8C 4B9XA 4J9IA 1X2KA 2F2VA 4KBMB 4ELZC 3GIBA 3EG9B 2GNCA 1VQ6Q 2K2MA 3PVQA 1KHIA 5GAOp 1FMWA 1NG2A 4E7JA 1UEBA 2YHTA 4EMHA 2D8HA 2FZCB 2GTOA 2WSFE 2QEXT 4A53A 3CQTA 5CKBA 5I21A 4QQ6A 1VQ5T 3HFNA 1OU8A 4LUDA 3S3OA 1GBQA 2K4YA 2PNIA 1UB4A 3HTRA 2QEXQ 4C8QC 3LYIA 4M77D 4ZGJB 4QQGA 1UJYA 4OF1A 3VS3A 1VQ5Q 5FWBA 4AG2C 4LDXA 1YNZA 4BB7A 4RKUE 1QKXA 1K73U 4HXJA 1YJWT 1KQSS 1KSWA 2E5QA 2DX1A 2VC8A 1QVGS 3RESA 1HYOA 1SHGA 3OQ5A 2IIMA 3PIOA 3VYHB 1JO8A 3META 3MEWA 4JJCA 1YJWQ 5GMKi 5J26A 1KQSA 3J81E 1JU5C 4RTTA 3QPHA 2A37A 4PJOE 4ANJA 4K11A 1YJ9A 4LD9K 3M5AA 3CD6A 1LOJA 2YLBA 4D6WA 1OYXA 1DJ7B 2YUPA 2O9VA 2QQAA 3UT1A 2K5IA 2EGCA 3LW5E 4DBFA 4M7AF 2RJEA 4BY6C 2X4XA 1VYTA 4M75G 5GAMe 1R0CB 2DLPA 3VS0A 2EYQA 4C5GA 3OYCA 4BE0A 3VS4A 4HT8A 3QHSA 2KROA 2JMCA 4M78G 2RI5A 1AOJA 2D0QB 3M59A 4LN2A 3CC7T 2D9TA 1TWBA 2XMFA 2F2WA 1H3ZA 4PJOA 3MEUA 2VXEA 3I35A 1K76A 3QJYA 5GANh 4ZGDB 3CC7Q 1V29B 2FO0A 1M3CA 3CC4Q 5IH2A 2FEIA 3PT9A 2X3XD 1VQ6A 2MCNA 3U23A 2PQWA 4C92G 3FC3A 4RTZA 1ARKA 1I5OB 2FB7A 1KIKA 1Y07A 3EHRA 3JCMh 3MEVA 2KK4A 4J7FA 1N8RR 5FRNA 2PVOB 2DERA 1T0HA 4XTZA 2QK0A 5KYYA 3HP9A 2J6KA 1AD5A 3CC2T 2PU9B 3BFMA 4RTVA 3QSUA 3LWHA 1WHKA 2QEXA 3JCMW 3HSBA 1GL5A 4F7UE 3NGPA 3L2RA 1QLYA 2LT1A 1VQ5A 2DTIA 2ZZDA 1WQWA 3CC2Q 2DE0X 1Y57A 1NJIU 4XU2A 2KRSA 2V8JA 2JTEA 2O88A 3FRNA 1T0JA 2KT8A 2B8AA 1YJWA 2EYXA 5HK0A 1Q86R 4Y28E 1C6VX 1S1NA 1SRMA 3EGDA 3MJXA 4C8QB 3A8MB 4F14A 2RI2A 3RR6A 1YJNT 3EG1A 3JAME 1RLPC 2RNAA 3INZA 4PK4A 3JRZA 3R6NA 2FG0A 3QUIA 5IXBA 3FIFA 1YJNQ 1E6GA 3MP1A 2CDTA 2KRNA 3REAB 1JJ2P 4PFZA 2DJZA 1JBMA 1KG1A 4F7UA 1OU9A 1VQLT 1JEGA 3SDZA 2DD5A 3OYDA 1M2VA 1VQ7T 3QYHB 2P0QA 2BUDA 5A2QE 1N8RC 1Q82C 2MAMA 2VKNA 3EAEA 1VQLQ 2VGMA 3OYBA 3REBB 1VQ7Q 4RMOA 5GAOm 1WHJA 2GTJA 5KYXA 4M7AA 3JB9I 3SD4A 1OX8A 3WVEB 2KVQG 4J6XA 3OYNA 4M7AC 1PD0A 3H0HA 1M4ZA 3HPWA 4BY6B 4KULA 3V8LA 2DYIA 1I8FA 2M9UA 1X43A 5GAMh 1X69A 5EG2A 4M7DD 4A4EA 3G71T 3CC7A 1TH7A 5GAN3 1BIBA 2EQUA 3CC4A 1IRXA 3L42A 5FW9A 1UGVA 1Q81R 4EMKC 3GLXA 4M75F 3G71Q 3M0UA 2A28A 2YUQA 1RAFB 1M3AA 1G8XA 1WHMA 2DETA 2AHJB 4FYVB 1JQQA 4RTYA 4C0ZA 3BDUA 3RDVA 1XNIA 3CCRT 2ROLA 1W4SA 3JCMV 4OMMA 4M78F 3EGUA 5IAYA 5KE2A 9ATCB 2YUOA 2EJGA 1MNEA 1M90R 4FL6A 3CCRQ 1TXQA 5FU6C 2RH2A 2MOXA 2LTOA 1M8VA 1YP5A 1EIFA 1Y71A 2RF0A 4NL2A 2J06A 4XAXB 3QBYA 3CC2A 3E19A 1G3TA 1MHNA 2V8IA 2EYYA 1QP3A 1VOMA 2BIVA 4F04B 1AHJB 1UHFA 3L2ZA 1C1AA 1RAAB 4MDXA 1K4US 3URGA 4C92F 1V1CA 3E2UA 5KYYB 1PRMC 2V8KA 5KE3A 1FMVA 1YI2T 2PVGB 2RB6A 2DL8A 2LZ6B 2RQWA 2QQRA 4EDUA 1M1FA 1WA7A 2JZ2A 2AKLA 2QQ9A 3CCLT 1FWZA 2FVUA 2EW3A 4JRPA 5LJ3g 4JRQA 1Q86U 3TSWA 3I9QA 1K8AC 3OY9A 4AFQC 3CCLQ 5C6SA 3NTIA 1YJNA 1JRIA 2DZCA 1LJOA 2E65A 3F70A 1CKBA 1WJRA 3TVTA 1UE9A 1KD1R 2X35A 1HSQA 2HKNA 3EGDB 3JCMb 3P8BB 3OW2P 1IO6A 2DVJA 3V7RA 2VXFA 4J6WA 3A8OB 5GAMf 1YBYA 1VQLA 2J7IA 1VQ7A 5I22A 1JJ2S 4EMGA 2H8HA 3EG9A 2COZA 3KUFA 3GBQA 1TTHB 2D8JA 1BB9A 2HZYA 3I56T 2OAWA 4J9CA 5GAOr 3OB9A 2G6FX 4N4IA 4ESRA 5IHKA 3OYAA 5LL6S 3UF4A 3I56Q 2W0ZA 1K9AA 2HKQB 1WNLA 2MYSA 3EHQA 2HQXA 5GAOn 2CP2A 1XQHA 3G71A 4AMCA 4A4FA 5AYFA 2DAQA 2EGEA 3EH2A 3VJPA 2ZCFB 5LJ5g 2CT4A 2RK1A 4M7AB 2M16A 2PVDB 1JXOA 1G3WA 2ZPHB 1Q81U 4KGZB 3JB9D 2F69A 3A8HB 3EG0A 3ZBDA 4YTLA 2KYBA 2GFAA 3CCRA 2A36A 2M0OA 4HCKA 3GPLA 4M75C 3G6ET 3OS5A 3S3MA 1LPLA 5GAN6 3C12A 4EMKB 2DEUA 4L59A 4OVAA 3CXCS 1KD1C 1VUBA 2L8DA 4R56A 4XU3A 1SHFA 4IUPA 3WVDB 3G6EQ 4M78A 4M77F 1M90U 1OPKA 2LMJA 4HCBA 4M78C 1TG0A 3CXCA 1WHHA 2GF7A 4KH0B 3TEEA 2JJ9A 2CP7A 2CP0A 1D1AA 5FU6B 1WPYA 1ZX6A 4HVWA 4E47A 4Z89A 1QQJA 2JTFA 4J9FA 2NUZA 4AFZC 4J83A 4LD6A 4CC7A 2OTJT 2E6NA 2AK5A 2DRKA 2CP5A 1YFNA 2ROTA 3CCLA 5L23A 5IT9E 5CVIA 4C92A 5CO7A 4OMPA 1NYGA 2KSSA 2OTJQ 1T3SA 2HQEA 3SHWA 4C92C 2SRCA 5D6YA 2PUKB 1E7OA 4XTVA 2E1HA 3H41A 4QT7A 3EGXB 2XDDA 3A98A 3V8KA 1W2BA 1VQOT 1IHVA 2CUDA 5A0DA 3H0IA 3M53A 3M0PA 3PVLA 1VQKQ 4DEXA 2XICA 4C8QE 1VQOQ 2DO3A 1R77A 2C0OA 2RMOA 4KUIA 3OMGA 2LP5A 3KFVA 1VQMT 4X9DA 4PLIA 2KMTA 1NZ9A 3I56A 3LH0A 3MCAB 2XD0A 2FYKA 1S72T 1VQMQ 2FHDA 4J8OA 1U1SA 5GAN7 2H3EB 3CPWP 1AWXA 4J7IA 1S72Q 2L2PA 4LUEA 4CC3A 3VS6A 2VASA 3AT1B 1MMAA 3OBWA 2K57A 5CKFA 1WDXA 5FWCA 4HT9A 2W10A 1V76A 3MO8A 4OMNA 5D6XA 1Q7YC 1BI2A 3H6ZA 1WHLA 5CQYA 1PC0A 3DKMA 4C8QA 3QJ6A 4C5HA 5GANj 2XK0A 4WF2A 1PKSA 1W6XA 3PMIA 5I2MA 4MZTA 3G6EA 4IIMA 4BD3A 1D3BB 2X51A 2CZ0B 1RADB 3LGFA 3OYKA 1M1KC 2FPEA 2LQ8A 4JZ3A 3M4GA 1LVKA 2GCXA 1ZBXA 4BE2A 4M75B 4NOYA 1QVGA 4J9HA 4B9WA 2GBQA 1X6GA 1KC8U 2K9GA 5GAN8 2E41A 3A8LB 2GQIA 2X9HA 1M9SA 1ZSZA 2DBMA 2E10A 4M78B 4QW2A 2HAXA 2LCSA 1FYNA 4R55A 2OTJA 2K7AA 2MK5A 3PE0A 1ZSZC 2SEMA 1VQNT 5CCAA 1IHWA 3CPFA 4RCBA 2CREA 3SFMA 4RG2A 5KH6A 4AFSC 2EVRA 2JS0A 1VQKA 5LJ3f 2M1HA 4FSSA 2ZPEB 4Z8AA 5GMKm 1WZOA 1VQOA 2RHYA 1UFFA 3C94A 3SWNC 2R5AA 4C92B 3A8GB 2LJ3A 3GOXA 3QO3A 1VA7A 3H0FA 3MHXA 1ZA2B 4JJNK 1M1GA 1GFDA 4PJOD 3SEMA 2D6FA 3OYFA 5GAN5 3D7SB 2K3YA 1NEGA 2YDLA 3E9FA 1VQMA 3QIIA 1UGPB 4FT2A 2NWMA 1NJIC 4QQDA 3MP6A 2RQTA 3OYMA 1WI7A 2JVVA 5GJVB 5KYUA 1QWEA 4M7DF 1RUWA 4DA4A 1S72A 1QCFA 2F1LA 5LJ3d 4F17A 1VQ9T 2MF2A 2HQHA 1UDLA 2E70A 3DLMA 4ORZA 2DJQA 2LX9A 3FB9A 1U1TA 4EPCA 2K6DA 4WCIA 2LDMA 3JCMP 4AFUC 1VQ9Q 3GNGA 3JCMc 2K79A 1G3YA 1GBRA 1Q82R 4AT1B 2CSIA 2RHIA 4ZN3A 3QG1A 4AG1C 3CPWS 4IUVA 3RIRA 4B6MA 5GAMj 2GGRA 2K3XA 1AZEA 4Y92A 3JV3A 2EYWA 1RI9A 2COWA 2ZPIB 4FYYB 3CPWA 4DBRA 2DYBA 2B86A 5FU7C 7AT1B 3ULRB 2ABLA 1OEBA 1RAGB 3VS1A 2DXTA 3C95A 4C0DC 4M7AE 1M5Q1 1M2OA 3NTKA 2EAYA 2QA4T 3CMAT 5CKEA 1D1BA 4KGXB 3M0RA 2RO0A 1GFCA 3CMAQ 4C0FA 1N9SA 2DXUA 4MZMA 1Z9ZA 4E6RA 3HHTB 2QTVA 5CK9A 2LQWA 1H92A 2JN0A 1KHCA 1UJ0A 2M51A 5LJ5d 2RD1A 4OB3B 1LNXA 2Y4XA 4JUVA 4KH1B 4X1VA 1KQ2A 5KYWB 1R8OB 2VB6A 1G2BA 4M77B 4QVDA 2JUFA 2FRYA 2LC4A 1BI0A 1ZLMA 2WACA 2C06A 3H9NA 5A0LA 2P84A 3P8DA 2GFUA 1OULA 4M7AD 1D0YA 1ZSZB 2LCCA 1UECA 2RJCA 1SKUB 4R0KA 3BDLA 5GMKe 2DL3A 4KGVB 3G4ST 4IUTA 2DF6A 4XU1A 2QAZA 4C0GA 1OX9A 1RAEB 3A1PA 3G4SQ 1C0MA 1KFZA 3RBBB 1K8AR 2KGTA 4CRIA 1XTDA 4OGCA 4M77G 2DFUA 1TU0B 2CZ6B 1U8RA 4EMKA 4JZ4A 3SWNB 1M27C 2DXBA 1YCYA 3CMET 3S3NA 2DMOA 4MMLA 1YWPA 2A3LA 2CZ7B 1FX7A 4BI4A 4Z88A 2OJ2A 1VQ9A 3CMEQ 4BI8B 1ABOA 4JDSA 3M9QA 1GCQC 1ABQA 2XDBA 3JB9H 2ZPFB 2E3HA 1RLQC 2HDAA 4M7DC 3JB9F 3L2QA 1WJQA 1N8RU 3M56A 3NTHA 1Q82U 3T9NA 1H641 2CP3A 1BKBA 5KYUB 2DK3A 3UPUA 4X34A 4HA8A 2FPFA 2P4TA 4PFPA 3JCMd 4PL6A 1NBEB 4F16A 1K9MR 4PJJA 5IHNA 2ED0A 3EGXA 2KNBB 1Y0MA 3FLGA 2BE9B 1TUDA 3X20B 4J9EA 2HCKA 5I11A 3CMAA 1WXUA 3N5BB 3OSSC 3M4YA 2HD0A 2BE7D 5FU7B 1YI2Q 2R57A 2O31A 1KJWA 3M0TA 3X26B 1NPRA 4ELYC 2O9SA 2NYSA 2BZXA 3EG3A 2LRQA 1MMGA 4HVUA 4C0DB 4GLKA 2YUNA 1WIEA 3L1AA 4RTXA 3OBYA 2CS7A 3TREA 2ECZA 3M55A 4FYXB 2QDLA 2R5MA 3EFOA 1P92A 4Y91A 2XHCA 4JJBA 3OMCA 5LJ3e 2HNIA 2K2VA 5HCKA 4M75E 2F2XA 2KT1A 2KI7A 2LT4A 3CBMA 3RKWA 1PM3A 3EFSA 2AZSA 4LDYA 4A4KA 4FW1A 2LQKA 4DQ2A 2VVKA 5GAN2 1X6OA 1Q95G 2LVMA 2VYTA 3M58A 2XU8A 1QW1A 2E4HA 4M78E 3I5RA 2H3JA 1JJ2A 1K0SA 2EKOA 3G4SA 2VUBA 2L3RA 1G83A 2K5LA 3LGLA 1YHQT 2BKDN 4DBQA 3NHNA 4ZGEB 2P4RA 5KYNA 1K9MC 1ACMB 4PKCC 2DEQA 1K0XA 3HL8A 1YHQQ 1B07A 1MNDA 3CCJT 2RK2A 4JLGA 3HFOA 1IREB 2EFIA 2R58A 5GMKh 5ECAA 3I55T 3QZ9B 4JJDA 3CMEA 2EYZA 1D3BA 2RQVA 1WXBA 1I0CA 4A4HA 3CCJQ 4C92E 2WSCE 3ZL7C 3I55Q 2EWNA 1W1FA 3E1SA 4M75A 4O6JA 3QWYA 3KXTA 3PTAA 4II1A 5CKDA 1MUZA 1SPKA 1IGUA 4M78D 1J3TA 5DLOA 4RG8A 1N27A 2DM1A 4RCCA 5LJ5e 2DA9A 1U06A 1QMCA 4LDVA 2PZ1A 2AZVA 3LH5A 4F7UG 4HCCA 1KQSP 4PJLA 1KQ1A 3SB2A 3AHUA 3G1JA 2MMPA 2YWWA 4M7DB 5DLQE 3VRZA 2JT4A 2D1XA 2J05A 2O01E 2KBTA 2ZGWA 1WYXA 4OB0B 3O5ZA 5GAOl 1VQ8T 1YI2A 3X28B 4C92D 4FCYA 3GNFB 1X75C 1A0NB 4CC2A 1UTIA 1ZHIA 3OS0A 1VQ8Q 1Q7YR 2QASA 3MEAA 1N6AA 5DY9A 3RKYA 1H3HA 4PFOA 2CKKA 2LCLA 4IIOA 1UGSB 2HSPA 3ZFJA 3PNWC 2JXBA 1NPPA 4ZN1A 2Y4YA 5GANg 1MGQA 3X24B 4M7DG 1D0ZA 2BZYA 2J6OA 2PUOB 2RJFA 3S6WA 3UWNA 3DLLA 4IKFA 1BCOA 4P5NA 1KD1U 1N9RA 4QKUA 1WX6A 3UA6A 1M1KR 3HRTA 2EQJA 3A5ZB 4DEYA 2HEQA 4DOVA 1B7TA 3JCMg 4D8KA 3G7ZA 4PNOA 3OW2S 1I5LA 2DRMA 2YRCA 2X4WA 1SEMA 3NMZC 5GANe 5KCOA 3KBGA 1WGSA 4IUUA 2RN8A 3OW2A 2G3RA 3EFOB 5LJ3h 3CCMT 4PJOF 4JS4A 2FZKB 1ZUKA 1D09B 1U3OA 4N0AA 1YHQA 1BI3A 1UHCA 4M77E 1K73C 4OMQA 3CCMQ 2YSQA 2DNUA 3JCMe 4N0AC 3UATA 2FPDA 2QQBA 2E5KA 1MV3A 3OS2A 3CCJA 3H8ZA 1AZGB 2E64A 3I55A 1B34B 2VWFA 1VQ6T 1SG5A 1OI1A 3I5SA 1D0XA 4C8QD 2IPOB 5EC7A 2PTKA 1YITT 2DIGA 2DZ9A 3QKJA 3M57A 5DM7R 1UG1A 2HBPA 8ATCB 1VYVA 3TCJA 1WFWA 1Y7XA 5IN1A 5HKCA 1YITQ 2FL7A 2NLUA 1AWWA 3QWXX 1MV0B 1CKAA 4C5EA 4FYWB 1VQ4T 5CR2A 1NJIR 1ZUYA 2ENMA 3RERA 1XOVA 4E7KA 5I2SA 5KYWA 3QYGB 2DL5A 1QWFA 1QVFP 1VQ4Q 2CH4A 4M77A 4GLMA 3RUXA 3UA7A 4M77C 1IB8A 2OI3A 1WJSA 2NUTA 3VS2A 5LJ5h 4CI0C 4GY5A 1VQ8A 2QQSA 2RM4A 1AT1B 2NUPB 2RHXA 3MKDA 4D8DA 1PRLC 3THKA 1FMKA 1ZA1B 1UGRB 2L3SA 4N4HA 1PD1A 4J9GA 5D7UA 1JB0E 3CCUT 1IGQA 4TVRA 1B3QA 1Y96B 5GAMg 1YCSB 2JM8A 1W70A 1Q7YU 3OYLA 1VQNQ 4F7UF 2BTTA 2HL3A 3M0SA 3CCUQ 4ZTFA 2ATCB 1WLPB 4A54A 3SWNA 1PWTA 2YRDA 1PG5B 4OMLA 5CAIA 5C0MA 3JCMX 1CSKA 4A63B 4ZNXA 2Z0WA 4XK8E 3JB9G 1M1KU 1TS9A 2CT3A 2OX7A 5HY6A 3CCVT 1N5ZA 4RUGA 1ZBJA 2RQRA 2V1QA 4KT0E 2GQVA 3LLRA 2L3PA 4BUGA 1PNJA 1OOTA 2EGAA 3CCVQ 4JS5A 2EIFA 2XG8D 5AT1B 1OPLA 1TUGB 1XJWB 1I81A 4KUDK 2XDPA 8AT1B 3CCMA
chains in the Genus database with same CATH topology
4M77G 1WQ7A 3TU4K 3OYAA 2CZ6B 4MDWA 5LL6S 3UDCA 3VUBA 4EMKA 1U8RA 3SWNB 3OYYA 4HKEA 1VIFA 2JTMA 2DXBA 1WNLA 2DVEA 2LNVA 1YCYA 2HQXA 3CMET 3CC4T 3S3NA 5GAOn 3V7CA 1XQHA 1RL2A 4MMKA 4MMLA 3G71A 2A3LA 4Q5WA 2CZ7B 4A4FA 1KC8C 1FX7A 5AYFA 4B9XA 4BI4A 1VQPT 2DAQA 3RKXA 3VJPA 1VQ9A 4PJOC 2ZCFB 4BI8B 5LJ5g 4M7AB 2RK1A 4JDSA 2M16A 2PVDB 2RJDA 4KBMB 4ELZC 3GIBA 2XIDA 3M9QA 1G3WA 2ZPHB 2XDBA 3JB9H 1KHIA 5GAOp 2ZPFB 3VKIA 4BACA 1Q81U 5CQXA 1QP2A 3OA6A 3JB9D 3CCST 4E7JA 1UEBA 2F69A 2XKOC 2YHTA 4EMHA 4M7DC 3JB9F 4PLLA 1ZQ1A 3A8HB 4BE1A 1YITA 3L2QA 1WJQA 3ZBDA 4ZTJA 4YTLA 1N8RU 3M56A 3NTHA 1Q82U 2GFAA 3T9NA 3CCRA 1H641 2WSFE 2QEXT 4A53A 1BKBA 2DK3A 2M0OA 5CKBA 3GPLA 4M75C 3G6ET 3OS5A 3UPUA 1G3SA 5I21A 3S3MA 5GAN6 4QQ6A 3C12A 4EMKB 5LJ5f 3HFNA 1VQ5T 3HKSA 4L59A 3S3OA 4OVAA 4X34A 3CXCS 1KD1C 4HA8A 2K4YA 1VUBA 2L8DA 1UB4A 2ZPGB 4R56A 4C8QC 3LYIA 4M77D 2P4TA 4XU3A 3JCMQ 4IUPA 4ZGJB 4QQGA 3WVDB 4M78A 4M77F 3JCMd 1M90U 4PL6A 4OF1A 1QVPA 3RMQA 4LDXA 4HCBA 4BB7A 2RHUA 1VQ4A 4M78C 2DIQA 4RKUE 3CXCA 3VYGA 2GF7A 3TEEA 3FLGA 1K73U 1YJWT 1KQSS 2E5QA 1QVGS 2VC8A 3L2WA 3X20B 4QVZA 3RESA 4J5YA 3OQ5A 4MZPA 5FU6B 2EQKA 3PIOA 1WPYA 4OB1B 3M54A 3VYHB 3CMAA 3N5BB 3OSSC 3WXMB 3M4YA 4E47A 2HD0A 3META 3MEWA 5FU7B 2JTFA 5GMKi 2R57A 4XTUA 5J26A 1KQSA 3OYJA 4J83A 4LD6A 3J81E 2L89A 1QVFS 2E6NA 3X25B 1NPRA 3X26B 4ELYC 2OTJT 1VIEA 3QPHA 3CCLA 3OYGA 2LRQA 4PJOE 5IT9E 5HK3A 5CVIA 4C0DB 4C92A 5A0GA 1PSEA 4GLKA 5CO7A 3HRUA 1YJ9A 2KSSA 3L1AA 4LD9K 2KQWA 1VQNA 2HQEA 3OBYA 3M5AA 4C92C 3CD6A 5D6YA 1QVFA 2CS7A 2PUKB 3CBPA 3CCUA 3TREA 1LOJA 2JOYA 2YLBA 4XTVA 4M7DE 1O9SA 4D6WA 3M55A 1OYXA 2E1HA 3BY7A 2R5MA 1P92A 1BIAA 4Y91A 1DJ7B 1UGQB 2XHCA 2XDDA 3OMCA 3V8KA 5LJ3e 2HNIA 2QQAA 4L5GA 3UT1A 3OYIA 1W2BA 2K5IA 2K2VA 1VQOT 3LWIA 4M75E 3CBMA 3LW5E 2LT4A 3RKWA 4M7AF 2RJEA 5A0DA 3M53A 5CIUA 3EFSA 4JRIA 4BY6C 2X4XA 4M75G 4FM4B 5GAMe 3GP8A 2XICA 4LDYA 4OMFB 2EYQA 3ME9A 4C8QE 3MP8A 4A4KA 2LQKA 4C5GA 5J3BA 4DQ2A 3OYCA 4BE0A 2DO3A 5GAN2 3ASKA 4Z02A 1X6OA 4C8QG 2LVMA 2CYZB 2VYTA 2XU8A 3M58A 3QHSA 4HT8A 1QW1A 5GANf 4M78E 2H3JA 2P0KA 3CCVA 1JJ2A 4KUIA 5D6WA 2EKOA 3G4SA 3OMGA 5FROA 2DTHA 4M78G 2RI5A 2CGHA 2VUBA 2L3RA 3VV0A 2D0QB 2EJ9A 3FJPA 1VQMT 3DB3A 3M59A 4X9DA 1O75A 2K5LA 3LGLA 2KMTA 4PLIA 1YHQT 1YJNA 2BKDN 3L2UA 1NZ9A 3ER0A 4HCZA 3I56A 3LH0A 4ZGEB 3CC7T 1YIJT 3MCAB 2XD0A 2FYKA 4X9CA 2MWOA 1S72T 1K9MC 2D9TA 4PKCC 2DEQA 3HL8A 1H3ZA 2FHDA 3JCMf 2KAFA 3MEUA 4PJOA 3P8HA 4XU0A 2VXEA 3RMSA 3CCJT 4J8OA 3QJYA 5GANh 2RK2A 1U1SA 4JLGA 4LDWA 3HFOA 4ZGDB 5GAN7 1IREB 2EFIA 1V29B 2R58A 3CEYA 5GMKh 2KDSA 4J7IA 3I55T 3QZ9B 3CMEA 1D3BA 3PT9A 4M7DA 4A4HA 2DD4A 4C92E 1VQ6A 2WSCE 1Q86C 2EWNA 2PQWA 4C92G 3FC3A 1VQPA 3OBWA 5GANd 2K57A 3E1SA 2FB7A 1Y07A 5CKFA 4M75A 3JCMh 3MEVA 4O6JA 2KK4A 4OB2B 3KXTA 4HT9A 4J7FA 3PTAA 4XTXA 5FRNA 2PVOB 3MO8A 4II1A 4XTZA 5D6XA 1Q7YC 1BI2A 2OAUA 3H6ZA 5CQYA 5CKDA 3CCSA 3DKMA 3HP9A 4C8QA 3QJ6A 3PFSA 4NS5A 4C5HA 5GANj 4M78D 5DLOA 5GMKj 4RG8A 3CC2T 2PU9B 1N27A 3BFMA 3QSUA 4RCCA 3LWHA 5LJ5e 3J7AF 2XK0A 4WF2A 2QEXA 3JCMW 3HSBA 4PJOB 3PMIA 4F7UE 5I2MA 3L2RA 4MZTA 3G6EA 4LDUA 2LT1A 4LDVA 1VQ5A 2DTIA 4F7UG 4HCCA 2ZZDA 2DTOA 1WQWA 3V8JA 3AHUA 1KQ1A 3SB2A 1NJIC 4BD3A 1D3BB 2KY9A 2OTLT 3VUZA 2MMPA 3ZEHA 5GMKl 1NJIU 2CZ0B 4M7DB 1OZ3A 5DLQE 3CCQT 3LGFA 2Y90A 3OYKA 1M1KC 2LQ8A 2EQMA 4XU2A 2A7YA 2O01E 3OS1A 3M4GA 2QA4A 2V8JA 2GCXA 1ZBXA 2ZGWA 4OB0B 3FRNA 4BE2A 2F5KA 4M75B 4J6YA 4NOYA 5GAOl 2B8AA 1VQ8T 1YJWA 5HK0A 4Y28E 1YI2A 4B9WA 1QVGA 2YLCA 3X28B 1BYMA 4C92D 3GNFB 1X75C 4NL3A 1KC8U 4C8QB 5GAN8 2E41A 3A8MB 3A8LB 1ZHIA 3OS0A 2QTXA 2RI2A 3QXEB 4PJOG 1M9SA 1YJNT 2YRVA 3MEAA 3J80E 2E10A 1N6AA 2O4XA 4M78B 4QW2A 3FEOA 5DY9A 2RI3A 3RKYA 3JAME 4R55A 2HAXA 3CCET 3INZA 3JCMJ 2CKKA 2OTJA 1G5VA 3JRZA 2LCLA 1UGSB 3ZFJA 3OYHA 3QDRB 1VQNT 3QUIA 3PNWC 3O8VA 3DB4A 1NPPA 3E9GA 3FIFA 4ZN1A 1PSFA 5CCAA 2Y4YA 3CPFA 5GANg 1MGQA 3MP1A 3X24B 4M7DG 4M7DD 4RCBA 2PUOB 4A4GA 2RJFA 3S6WA 3UWNA 3SFMA 2VGNA 3DLLA 4IKFA 2IVWA 4IUQA 2XI9A 2DJZA 4FSXA 4RG2A 5KH6A 1JBMA 4P5NA 1KG1A 1KD1U 1N9RA 4F7UA 1Q81C 4BI3A 2X4JA 3HRTA 2EQJA 1VQLT 3SDZA 4UC4A 1VQKA 2DD5A 2P0PA 3A5ZB 5LJ3f 3OYDA 2M1HA 2I2LA 3QYHB 5L8RE 2ZPEB 4DOVA 1VQ7T 5FLXE 2P0QA 5GMKm 2BUDA 1VQOA 3JCMg 2RHYA 5A2QE 1N8RC 1Q82C 3G7ZA 3SWNC 2MAMA 3C94A 4PNOA 1B34A 3OW2S 1I5LA 2R5AA 3EAEA 4C92B 2VGMA 3OYBA 3A8GB 4L6V5 2X4WA 3V7SA 3GOXA 3QO3A 2RHZA 4RMOA 5GANe 5GAOm 4V2SA 5KCOA 3KBGA 3MHXA 2L5QA 1WGSA 4M7AA 3JB9I 3SD4A 4IUUA 4JJNK 1M1GA 1X01A 3WVEB 2KVQG 4J6XA 3OW2A 2G3RA 1M90C 3OYNA 2D6FA 4PJOD 5LJ3h 4M7AC 4JRKA 3CCMT 4PJOF 3OYFA 2X4YA 4JS4A 5GAN5 2QXFA 2K3YA 1M4ZA 3E9FA 3HPWA 1K8AU 4BY6B 1VQMA 4KULA 3QIIA 1UGPB 4FT2A 4N0AA 3V8LA 1HXDA 1I8FA 2M9UA 1BI3A 1YHQA 4M77E 1K73C 5GAMh 5EG2A 4QQDA 3MP6A 1I4K1 3JCMe 4A4EA 4N0AC 5M9OA 2JVVA 4F7UB 3OYMA 3G71T 3CC7A 4M7DF 1YIJA 1TH7A 4DOWA 1BIBA 2QDYB 2EQUA 2QQBA 5GAN3 4DA4A 1S72A 3CC4A 4OGEA 5LJ3d 1FXXA 5J39A 1VQ9T 2MF2A 3JSCA 3OS2A 4XQ3A 2E70A 3DLMA 3L42A 3CCJA 4E7HA 4M75D 3H8ZA 3BW1A 2WSEE 2E64A 2LX9A 4EMKC 1HK9A 1NE8A 3FB9A 3GLXA 4M75F 1B34B 5KCHA 1U1TA 2RA2A 4EPCA 3I55A 4E7IA 2LDMA 1RI0A 1VQ6T 3JCMP 5GAMd 1OI1A 2AHJB 3GNGA 3JCMc 4BDYA 4C8QD 1G3YA 5LJ3j 2RHIA 4C0ZA 4C8QF 4ZN3A 3BDUA 1YITT 2DIGA 2DZ9A 1XNIA 3QG1A 3CPWS 4IUVA 3QKJA 3Q1JA 3CCRT 1W4SA 3M57A 5DM7R 3RIRA 3JCMV 2HBPA 2E12A 4M78F 5GAMj 3TCJA 2K3XA 1Y7XA 1IZ6A 4O5VA 5IN1A 5HKCA 5IAYA 5KE2A 2MWPA 2FL7A 2EJGA 2NLUA 4FL6A 2ZPIB 5FU6C 3CPWA 2RH2A 4XTYA 2LTOA 1M8VA 1EIFA 1Y71A 5FU7C 3NFCA 3PMTA 4NL2A 4XAXB 4C5EA 3QBYA 3CC2A 4ATOA 3E19A 1Y96A 1VQ4T 2K5FA 5CR2A 1G3TA 1MHNA 2V8IA 4JLIA 3RERA 1XOVA 3HRSA 3PIPA 4E7KA 2DXTA 3QZ5B 1QP3A 5I2SA 2BIVA 3C95A 5CKHA 4C0DC 3QYGB 4M7AE 1M5Q1 1K9MU 2OTLA 3NTKA 4M77A 3VU3C 1AHJB 2EAYA 3RUXA 2QA4T 3CMAT 3CCQA 4M7AG 2VV5A 3L2ZA 4FT4A 4MDXA 5CKEA 2MI6A 3URGA 4M77C 4C92F 3L2VA 2V8KA 1WJSA 5KE3A 2RO0A 1BI1A 3FDRA 2PVGB 2RB6A 1YI2T 5LJ5h 3OSVA 4ME7A 2QQRA 4EDUA 4GY5A 1M1FA 4CI0C 2JZ2A 1VQ8A 2QQ9A 2QQSA 1FWZA 2RM4A 2FVUA 2RHXA 2ZPBB 3CCLT 4JRPA 4C0FA 5LJ3g 4JRQA 1N9SA 1Q86U 2DXUA 3EFRA 4MZMA 1YJ9T 3JB9J 4N4GA 1UGRB 3HHTB 5CK9A 4FU6A 1K8AC 3OY9A 3CD6T 5C6SA 4IURA 2JN0A 3NTIA 4N4HA 5GAN4 1JB0E 1JRIA 3CCUT 1KHCA 2DZCA 1LJOA 1Y96B 4TVRA 5LJ5d 5GAMg 1OZ2A 2E65A 3CCEA 2IG0A 3F70A 4BDZA 1Q7YU 2RD1A 5FRMA 3OYLA 4OB3B 4F7UF 1LNXA 2Y4XA 1W2BS 4JUVA 3CBOA 2JNGA 1KQ2A 1WJRA 3PGGA 1R8OB 4ZTFA 4E7LA 4A54A 4M77B 4QVDA 5GAOq 2X35A 5LJ5j 3SWNA 2JUFA 3JCMb 3C4SA 3P8BB 3V7RA 1SSFA 2LC4A 1BI0A 2EJFA 2WACA 5CAIA 2C06A 2VXFA 2DPPB 1VQKT 3GF5A 5C0MA 4J6WA 5A0LA 3JCMX 2QI2A 3A8OB 3P8DA 2GFUA 5GAMf 1YBYA 1VQLA 4M7AD 4XK8E 2LCCA 1VQ7A 2O4XB 3R6OA 3LX7A 2RJCA 3JB9G 1M1KU 5HY6A 3CCVT 1JJ2S 3BDLA 2E6ZA 5GMKe 3G4ST 4EMGA 2CZ1B 4IUTA 4XU1A 3KUFA 4C5IA 3OYEA 4KT0E 2GQVA 4QVCA 1GXIE 3LLRA 4OP0A 4C0GA 4BUGA 4FIBA 2F5TX 4VUBA 2EIFA 4XTWA 3I56T 2XG8D 4JS5A 2DKGA 5GAOr 3OB9A 2DXCA 1I81A 4KUDK 4CRIA 1XTDA 4N4IA 2XDPA 4OGCA 3CCMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M77 G;  1WQ7 A;  2YLC A;  4M75 E;  4C92 D;  4EMK A;  3RKW A;  3SWN B;  2EJG A;  4M7A F;  4NL3 A;  4C8Q B;  3EFS A;  4JRI A;  1WNL A;  2DVE A;  2E41 A;  4M75 G;  5GAN 8;  1YCY A;  5GAM e;  4XTY A;  5GAO n;  3V7C A;  1M8V A;  4MMK A;  2QTX A;  4C8Q E;  4PJO G;  4DQ2 A;  4MML A;  4NL2 A;  2E10 A;  5GAN 2;  4M78 B;  5DY9 A;  3RKY A;  1Y96 A;  4C8Q G;  4HT8 A;  3INZ A;  3JCM J;  3QHS A;  3RKX A;  4PJO C;  4JLI A;  5GAN f;  3RER A;  4M78 E;  4M7A B;  5LJ5 g;  3QUI A;  3GIB A;  2DXT A;  3FIF A;  2DTH A;  5GAN g;  4M78 G;  1MGQ A;  4M7D G;  4M7A E;  1M5Q 1;  3JB9 H;  2CGH A;  4RCB A;  5GAO p;  2EJ9 A;  3FJP A;  4M77 A;  3JB9 D;  3VU3 C;  4X9D A;  2EAY A;  3RUX A;  2YHT A;  4EMH A;  4M7A G;  4M7D C;  3L2Z A;  3JB9 F;  2DJZ A;  4M77 C;  4C92 F;  1JBM A;  1N9R A;  4F7U A;  2FYK A;  4X9C A;  1H64 1;  2RB6 A;  4A53 A;  5LJ5 h;  2DEQ A;  3JCM f;  5LJ3 f;  4PJO A;  4M75 C;  2I2L A;  4XU0 A;  2VXE A;  5I21 A;  2RM4 A;  5GAN 6;  5GMK m;  5LJ5 f;  5GAN h;  4EMK B;  3HFN A;  1U1S A;  3JCM g;  5LJ3 g;  3HFO A;  5GAN 7;  1N9S A;  4HA8 A;  5GMK h;  2DXU A;  3EFR A;  3SWN C;  4PNO A;  3JB9 J;  1B34 A;  1I5L A;  4C92 B;  4C8Q C;  4M77 D;  4XU3 A;  1D3B A;  3JCM Q;  3JCM d;  4M78 A;  4M77 F;  3V7S A;  4M7D A;  5GAN 4;  2JN0 A;  3QO3 A;  4C92 E;  1JRI A;  2DZC A;  1LJO A;  1Y96 B;  5GAN e;  5LJ5 d;  5GAM g;  5GAO m;  4V2S A;  2E65 A;  2EWN A;  4M78 C;  4M7A A;  3JB9 I;  2RD1 A;  4C92 G;  5GAN d;  1X01 A;  2K57 A;  4F7U F;  2FB7 A;  4J6X A;  1LNX A;  4PJO D;  4JUV A;  4M75 A;  5LJ3 h;  3JCM h;  1KQ2 A;  4JRK A;  4M7A C;  3PGG A;  4PJO F;  4HT9 A;  2VC8 A;  5GAN 5;  4XTX A;  3RES A;  4M77 B;  4XTZ A;  4A54 A;  4J5Y A;  4QVD A;  5GAO q;  5LJ5 j;  3SWN A;  4N0A A;  3JCM b;  3V8L A;  1HXD A;  1WPY A;  1I8F A;  4C8Q A;  3V7R A;  4M77 E;  5CAI A;  2EJF A;  5GAN j;  5GAM h;  4M78 D;  4M7D D;  1I4K 1;  2VXF A;  3JCM e;  4N0A C;  4F7U B;  4J6W A;  5GMK i;  5GMK j;  3JCM X;  4M7D F;  3BFM A;  1TH7 A;  4XTU A;  1BIB A;  4RCC A;  5GAM f;  5LJ5 e;  5GAN 3;  4WF2 A;  3JCM W;  3HSB A;  3QSU A;  5LJ3 d;  4M7A D;  4PJO B;  4F7U E;  4XQ3 A;  3JB9 G;  4M75 D;  4PJO E;  2DTI A;  3BW1 A;  2E64 A;  4EMK C;  4F7U G;  2DTO A;  1HK9 A;  3FB9 A;  4M75 F;  1WQW A;  3V8J A;  1B34 B;  4C92 A;  1U1T A;  2RA2 A;  1KQ1 A;  3SB2 A;  4EMG A;  3AHU A;  4XU1 A;  1D3B B;  3L1A A;  3JCM P;  5GAM d;  5GMK l;  4C92 C;  4QVC A;  4M7D B;  4OP0 A;  3JCM c;  5GAO l;  4C8Q D;  5LJ3 j;  2Y90 A;  4XU2 A;  4C8Q F;  3BDU A;  1LOJ A;  2YLB A;  3M4G A;  2DZ9 A;  4XTW A;  4XTV A;  4M7D E;  2E1H A;  5GMK e;  3BY7 A;  2DKG A;  5GAO r;  2ZGW A;  1BIA A;  4Y91 A;  4M75 B;  3RIR A;  3JCM V;  1I81 A;  2HNI A;  4J6Y A;  4NOY A;  3V8K A;  5LJ3 e;  4M78 F;  5GAM j; 
#chains in the Genus database with same CATH topology
 1WQ7 A;  2YXY A;  4MDW A;  3OYY A;  4RTW A;  1VIF A;  2JTM A;  2DVE A;  2O2O A;  3CC4 T;  2ESW A;  3V7C A;  1EZZ B;  4MMK A;  3TQ7 P;  2KXD A;  4LNP A;  1TUC A;  1PKT A;  4GBQ A;  5GJW B;  1VQP T;  3NPF A;  3RKX A;  4E7S A;  4PJO C;  1M30 A;  2RJD A;  1H8K A;  1YWO A;  2XID A;  2AIR B;  3VKI A;  4BAC A;  5CQX A;  1QP2 A;  3OA6 A;  1VQP Q;  3CCS T;  2XKO C;  1U5S A;  4PLL A;  1ZQ1 A;  4BE1 A;  1YIT A;  2QGF B;  1VYU A;  4ZTJ A;  2QYZ A;  1AWJ A;  4LXC A;  3CCS Q;  1G3S A;  5LJ5 f;  2L3Q A;  3HKS A;  3C0C A;  2ZPG B;  1WHG A;  3JCM Q;  1QVP A;  3RMQ A;  2RHU A;  1VQ4 A;  2DIQ A;  1ZUU A;  3VYG A;  3QDF A;  3RNJ A;  3L2W A;  2A0F B;  3FJ5 A;  4QVZ A;  2QA4 Q;  4J5Y A;  4MZP A;  1RAB B;  2EQK A;  4OB1 B;  1M8M A;  2KYM A;  3M54 A;  3WXM B;  3BE3 A;  3VRY A;  4XTU A;  3VS5 A;  3OYJ A;  1PHT A;  2L89 A;  1QVF S;  3X25 B;  1VIE A;  3OYG A;  5HK3 A;  1UUE A;  5A0G A;  1PSE A;  2RQU A;  3HRU A;  1VQN A;  2KQW A;  1QVF A;  3CBP A;  3CCU A;  2JOY A;  4M7D E;  1O9S A;  4J9B A;  2EPD A;  3BY7 A;  1NLO C;  1BIA A;  1M3B A;  1UGQ B;  1RAC B;  4L5G A;  3OYI A;  2NUT B;  2HSE B;  1GCP A;  3LWI A;  5CIU A;  4JRI A;  4FM4 B;  3GP8 A;  4HVV A;  4OMF B;  3ME9 A;  3MP8 A;  5J3B A;  3VS7 A;  3ASK A;  4Z02 A;  2KXC A;  4C8Q G;  2CYZ B;  5GAN f;  2P0K A;  3CCV A;  5D6W A;  5FRO A;  2DTH A;  2HL5 C;  2CGH A;  3VV0 A;  2EJ9 A;  3FJP A;  3DB3 A;  4RTU A;  1O75 A;  3L2U A;  3ER0 A;  4HCZ A;  1TSF A;  3M0Q A;  1YIJ T;  1WXT A;  4JPB W;  4X9C A;  2MWO A;  3JCM f;  2KAF A;  3P8H A;  4XU0 A;  3RMS A;  1NYF A;  4LDW A;  1PCX A;  2DIL A;  3CEY A;  1YIJ Q;  2KDS A;  1GCQ A;  3EH1 A;  4M7D A;  2DD4 A;  2DBK A;  1K1Z A;  1Q86 C;  2M02 A;  1BK2 A;  1VQP A;  5GAN d;  1IXD A;  1NLP C;  1RAI B;  4OB2 B;  4XTX A;  2CUB A;  3CXC P;  2OAU A;  3CCS A;  4PJN A;  2AT1 B;  2KRM A;  2E3I A;  3PFS A;  4NS5 A;  2KEA A;  5GMK j;  2AKK A;  3J7A F;  1SRL A;  1LCK A;  4PJO B;  4KRT A;  3IQL A;  4LDU A;  2DTO A;  1BU1 A;  3V8J A;  2JMA A;  2KY9 A;  2OTL T;  3VUZ A;  3ZEH A;  5GMK l;  1OZ3 A;  1EFN A;  3CCQ T;  2Y90 A;  2DL4 A;  3OS1 A;  2EQM A;  2A7Y A;  2QA4 A;  1X6B A;  2KE9 A;  4LE9 A;  2OTL Q;  2F5K A;  4J6Y A;  3CCQ Q;  1F1B B;  1MMN A;  2CP6 A;  6AT1 B;  2V1R A;  1BYM A;  2YLC A;  2KR3 A;  4NL3 A;  2RPN A;  2QGG A;  1W2B P;  2QTX A;  3QXE B;  4PJO G;  2YRV A;  2MPX C;  3J80 E;  3TSZ A;  2CSQ A;  4OMO A;  2O4X A;  3FEO A;  2RI3 A;  2LJ1 A;  3CCE T;  1G5V A;  3JCM J;  3OYH A;  1NM7 A;  3QDR B;  2EQI A;  3O8V A;  3DB4 A;  3E9G A;  2LQN A;  1PSF A;  1TOV A;  1I1J A;  3CCE Q;  4A4G A;  2VGN A;  2IVW A;  4IUQ A;  2XI9 A;  4FSX A;  1Q81 C;  4BI3 A;  2X4J A;  4DBH A;  4UC4 A;  2P0P A;  5L8R E;  2I2L A;  5FLX E;  2J6F A;  3MPU B;  2I0N A;  2EKH A;  1GRI A;  1B34 A;  4L6V 5;  4J9D A;  3V7S A;  2RHZ A;  1KK7 A;  4E2F B;  4V2S A;  1QCN A;  2L5Q A;  1X01 A;  1SSH A;  1M90 C;  2ED1 A;  4JRK A;  2M0Y A;  1T3L A;  2X4Y A;  1OQK A;  4CC4 B;  2QXF A;  1K8A U;  1HXD A;  4PJM A;  1I4K 1;  5M9O A;  4F7U B;  1YIJ A;  4DOW A;  2QDY B;  4OGE A;  1M2V B;  1FXX A;  5J39 A;  3JSC A;  4XQ3 A;  4E7H A;  4M75 D;  3BW1 A;  2WSE E;  5KCH A;  1HK9 A;  1NE8 A;  2RA2 A;  4E7I A;  1RI0 A;  1X2Q A;  5GAM d;  2C0T A;  1E6H A;  4BDY A;  2YT6 A;  5LJ3 j;  1YN8 A;  4C8Q F;  5KYX B;  1ZSG A;  3Q1J A;  2FRW A;  2E12 A;  1BBZ A;  1IZ6 A;  4O5V A;  5IHI A;  2NUP A;  2COY A;  2LJ0 A;  2MWP A;  2A08 A;  2K3B A;  1I07 A;  2QG9 B;  4XTY A;  1QVG P;  1AVZ C;  3NFC A;  3PMT A;  5IXF A;  4ATO A;  1Z9Q A;  2X3W D;  2C0I A;  1Y96 A;  2D0N A;  2K5F A;  1K73 R;  4JLI A;  4E7Z A;  2ZAE A;  3HRS A;  3PIP A;  3QZ5 B;  1R0B G;  2MIO A;  5CKH A;  1HD3 A;  1AWO A;  2CH4 W;  1K9M U;  2OTL A;  1SF9 A;  3VU3 C;  3CCQ A;  4M7A G;  2VV5 A;  4FT4 A;  2MI6 A;  3L2V A;  1D1C A;  1KC8 R;  1BI1 A;  3FDR A;  4WTO B;  2HMA A;  3OSV A;  4ME7 A;  2JW4 A;  2ZPB B;  2FZG B;  3EFR A;  1YJ9 T;  3JB9 J;  4N4G A;  1NEB A;  4FU6 A;  3CD6 T;  4IUR A;  5GAN 4;  2LX7 A;  1OZ2 A;  2HBW A;  3CCE A;  1OV3 A;  2IG0 A;  4BDZ A;  1YJ9 Q;  2DL7 A;  5FRM A;  1W2B S;  3CD6 Q;  3CBO A;  2JNG A;  3PGG A;  3EG2 A;  4E7L A;  2JM9 A;  5GAO q;  5LJ5 j;  4EIK A;  3C4S A;  4M4Z A;  1QCO A;  1SSF A;  2EJF A;  2L0A A;  2DPP B;  1VQK T;  3GF5 A;  1X27 A;  2QI2 A;  2V26 A;  2O4X B;  3R6O A;  3LX7 A;  1HJD A;  1MMD A;  2E6Z A;  2CZ1 B;  4C5I A;  3OYE A;  2LNH B;  1JXM A;  1RAH B;  4QVC A;  4OP0 A;  1GXI E;  4FIB A;  2F5T X;  4VUB A;  4XTW A;  2DKG A;  2JS2 A;  4FW2 A;  2BZ8 A;  2DXC A;  3TU4 K;  3VUB A;  3UDC A;  4HKE A;  1BCM A;  1QKW A;  2LNV A;  1RL2 A;  1EX4 A;  4Q5W A;  2EBP A;  1AEY A;  1KC8 C;  4B9X A;  4J9I A;  1X2K A;  2F2V A;  4KBM B;  4ELZ C;  3GIB A;  3EG9 B;  2GNC A;  1VQ6 Q;  2K2M A;  3PVQ A;  1KHI A;  5GAO p;  1FMW A;  1NG2 A;  4E7J A;  1UEB A;  2YHT A;  4EMH A;  2D8H A;  2FZC B;  2GTO A;  2WSF E;  2QEX T;  4A53 A;  3CQT A;  5CKB A;  5I21 A;  4QQ6 A;  1VQ5 T;  3HFN A;  1OU8 A;  4LUD A;  3S3O A;  1GBQ A;  2K4Y A;  2PNI A;  1UB4 A;  3HTR A;  2QEX Q;  4C8Q C;  3LYI A;  4M77 D;  4ZGJ B;  4QQG A;  1UJY A;  4OF1 A;  3VS3 A;  1VQ5 Q;  5FWB A;  4AG2 C;  4LDX A;  1YNZ A;  4BB7 A;  4RKU E;  1QKX A;  1K73 U;  4HXJ A;  1YJW T;  1KQS S;  1KSW A;  2E5Q A;  2DX1 A;  2VC8 A;  1QVG S;  3RES A;  1HYO A;  1SHG A;  3OQ5 A;  2IIM A;  3PIO A;  3VYH B;  1JO8 A;  3MET A;  3MEW A;  4JJC A;  1YJW Q;  5GMK i;  5J26 A;  1KQS A;  3J81 E;  1JU5 C;  4RTT A;  3QPH A;  2A37 A;  4PJO E;  4ANJ A;  4K11 A;  1YJ9 A;  4LD9 K;  3M5A A;  3CD6 A;  1LOJ A;  2YLB A;  4D6W A;  1OYX A;  1DJ7 B;  2YUP A;  2O9V A;  2QQA A;  3UT1 A;  2K5I A;  2EGC A;  3LW5 E;  4DBF A;  4M7A F;  2RJE A;  4BY6 C;  2X4X A;  1VYT A;  4M75 G;  5GAM e;  1R0C B;  2DLP A;  3VS0 A;  2EYQ A;  4C5G A;  3OYC A;  4BE0 A;  3VS4 A;  4HT8 A;  3QHS A;  2KRO A;  2JMC A;  4M78 G;  2RI5 A;  1AOJ A;  2D0Q B;  3M59 A;  4LN2 A;  3CC7 T;  2D9T A;  1TWB A;  2XMF A;  2F2W A;  1H3Z A;  4PJO A;  3MEU A;  2VXE A;  3I35 A;  1K76 A;  3QJY A;  5GAN h;  4ZGD B;  3CC7 Q;  1V29 B;  2FO0 A;  1M3C A;  3CC4 Q;  5IH2 A;  2FEI A;  3PT9 A;  2X3X D;  1VQ6 A;  2MCN A;  3U23 A;  2PQW A;  4C92 G;  3FC3 A;  4RTZ A;  1ARK A;  1I5O B;  2FB7 A;  1KIK A;  1Y07 A;  3EHR A;  3JCM h;  3MEV A;  2KK4 A;  4J7F A;  1N8R R;  5FRN A;  2PVO B;  2DER A;  1T0H A;  4XTZ A;  2QK0 A;  5KYY A;  3HP9 A;  2J6K A;  1AD5 A;  3CC2 T;  2PU9 B;  3BFM A;  4RTV A;  3QSU A;  3LWH A;  1WHK A;  2QEX A;  3JCM W;  3HSB A;  1GL5 A;  4F7U E;  3NGP A;  3L2R A;  1QLY A;  2LT1 A;  1VQ5 A;  2DTI A;  2ZZD A;  1WQW A;  3CC2 Q;  2DE0 X;  1Y57 A;  1NJI U;  4XU2 A;  2KRS A;  2V8J A;  2JTE A;  2O88 A;  3FRN A;  1T0J A;  2KT8 A;  2B8A A;  1YJW A;  2EYX A;  5HK0 A;  1Q86 R;  4Y28 E;  1C6V X;  1S1N A;  1SRM A;  3EGD A;  3MJX A;  4C8Q B;  3A8M B;  4F14 A;  2RI2 A;  3RR6 A;  1YJN T;  3EG1 A;  3JAM E;  1RLP C;  2RNA A;  3INZ A;  4PK4 A;  3JRZ A;  3R6N A;  2FG0 A;  3QUI A;  5IXB A;  3FIF A;  1YJN Q;  1E6G A;  3MP1 A;  2CDT A;  2KRN A;  3REA B;  1JJ2 P;  4PFZ A;  2DJZ A;  1JBM A;  1KG1 A;  4F7U A;  1OU9 A;  1VQL T;  1JEG A;  3SDZ A;  2DD5 A;  3OYD A;  1M2V A;  1VQ7 T;  3QYH B;  2P0Q A;  2BUD A;  5A2Q E;  1N8R C;  1Q82 C;  2MAM A;  2VKN A;  3EAE A;  1VQL Q;  2VGM A;  3OYB A;  3REB B;  1VQ7 Q;  4RMO A;  5GAO m;  1WHJ A;  2GTJ A;  5KYX A;  4M7A A;  3JB9 I;  3SD4 A;  1OX8 A;  3WVE B;  2KVQ G;  4J6X A;  3OYN A;  4M7A C;  1PD0 A;  3H0H A;  1M4Z A;  3HPW A;  4BY6 B;  4KUL A;  3V8L A;  2DYI A;  1I8F A;  2M9U A;  1X43 A;  5GAM h;  1X69 A;  5EG2 A;  4M7D D;  4A4E A;  3G71 T;  3CC7 A;  1TH7 A;  5GAN 3;  1BIB A;  2EQU A;  3CC4 A;  1IRX A;  3L42 A;  5FW9 A;  1UGV A;  1Q81 R;  4EMK C;  3GLX A;  4M75 F;  3G71 Q;  3M0U A;  2A28 A;  2YUQ A;  1RAF B;  1M3A A;  1G8X A;  1WHM A;  2DET A;  2AHJ B;  4FYV B;  1JQQ A;  4RTY A;  4C0Z A;  3BDU A;  3RDV A;  1XNI A;  3CCR T;  2ROL A;  1W4S A;  3JCM V;  4OMM A;  4M78 F;  3EGU A;  5IAY A;  5KE2 A;  9ATC B;  2YUO A;  2EJG A;  1MNE A;  1M90 R;  4FL6 A;  3CCR Q;  1TXQ A;  5FU6 C;  2RH2 A;  2MOX A;  2LTO A;  1M8V A;  1YP5 A;  1EIF A;  1Y71 A;  2RF0 A;  4NL2 A;  2J06 A;  4XAX B;  3QBY A;  3CC2 A;  3E19 A;  1G3T A;  1MHN A;  2V8I A;  2EYY A;  1QP3 A;  1VOM A;  2BIV A;  4F04 B;  1AHJ B;  1UHF A;  3L2Z A;  1C1A A;  1RAA B;  4MDX A;  1K4U S;  3URG A;  4C92 F;  1V1C A;  3E2U A;  5KYY B;  1PRM C;  2V8K A;  5KE3 A;  1FMV A;  1YI2 T;  2PVG B;  2RB6 A;  2DL8 A;  2LZ6 B;  2RQW A;  2QQR A;  4EDU A;  1M1F A;  1WA7 A;  2JZ2 A;  2AKL A;  2QQ9 A;  3CCL T;  1FWZ A;  2FVU A;  2EW3 A;  4JRP A;  5LJ3 g;  4JRQ A;  1Q86 U;  3TSW A;  3I9Q A;  1K8A C;  3OY9 A;  4AFQ C;  3CCL Q;  5C6S A;  3NTI A;  1YJN A;  1JRI A;  2DZC A;  1LJO A;  2E65 A;  3F70 A;  1CKB A;  1WJR A;  3TVT A;  1UE9 A;  1KD1 R;  2X35 A;  1HSQ A;  2HKN A;  3EGD B;  3JCM b;  3P8B B;  3OW2 P;  1IO6 A;  2DVJ A;  3V7R A;  2VXF A;  4J6W A;  3A8O B;  5GAM f;  1YBY A;  1VQL A;  2J7I A;  1VQ7 A;  5I22 A;  1JJ2 S;  4EMG A;  2H8H A;  3EG9 A;  2COZ A;  3KUF A;  3GBQ A;  1TTH B;  2D8J A;  1BB9 A;  2HZY A;  3I56 T;  2OAW A;  4J9C A;  5GAO r;  3OB9 A;  2G6F X;  4N4I A;  4ESR A;  5IHK A;  3OYA A;  5LL6 S;  3UF4 A;  3I56 Q;  2W0Z A;  1K9A A;  2HKQ B;  1WNL A;  2MYS A;  3EHQ A;  2HQX A;  5GAO n;  2CP2 A;  1XQH A;  3G71 A;  4AMC A;  4A4F A;  5AYF A;  2DAQ A;  2EGE A;  3EH2 A;  3VJP A;  2ZCF B;  5LJ5 g;  2CT4 A;  2RK1 A;  4M7A B;  2M16 A;  2PVD B;  1JXO A;  1G3W A;  2ZPH B;  1Q81 U;  4KGZ B;  3JB9 D;  2F69 A;  3A8H B;  3EG0 A;  3ZBD A;  4YTL A;  2KYB A;  2GFA A;  3CCR A;  2A36 A;  2M0O A;  4HCK A;  3GPL A;  4M75 C;  3G6E T;  3OS5 A;  3S3M A;  1LPL A;  5GAN 6;  3C12 A;  4EMK B;  2DEU A;  4L59 A;  4OVA A;  3CXC S;  1KD1 C;  1VUB A;  2L8D A;  4R56 A;  4XU3 A;  1SHF A;  4IUP A;  3WVD B;  3G6E Q;  4M78 A;  4M77 F;  1M90 U;  1OPK A;  2LMJ A;  4HCB A;  4M78 C;  1TG0 A;  3CXC A;  1WHH A;  2GF7 A;  4KH0 B;  3TEE A;  2JJ9 A;  2CP7 A;  2CP0 A;  1D1A A;  5FU6 B;  1WPY A;  1ZX6 A;  4HVW A;  4E47 A;  4Z89 A;  1QQJ A;  2JTF A;  4J9F A;  2NUZ A;  4AFZ C;  4J83 A;  4LD6 A;  4CC7 A;  2OTJ T;  2E6N A;  2AK5 A;  2DRK A;  2CP5 A;  1YFN A;  2ROT A;  3CCL A;  5L23 A;  5IT9 E;  5CVI A;  4C92 A;  5CO7 A;  4OMP A;  1NYG A;  2KSS A;  2OTJ Q;  1T3S A;  2HQE A;  3SHW A;  4C92 C;  2SRC A;  5D6Y A;  2PUK B;  1E7O A;  4XTV A;  2E1H A;  3H41 A;  4QT7 A;  3EGX B;  2XDD A;  3A98 A;  3V8K A;  1W2B A;  1VQO T;  1IHV A;  2CUD A;  5A0D A;  3H0I A;  3M53 A;  3M0P A;  3PVL A;  1VQK Q;  4DEX A;  2XIC A;  4C8Q E;  1VQO Q;  2DO3 A;  1R77 A;  2C0O A;  2RMO A;  4KUI A;  3OMG A;  2LP5 A;  3KFV A;  1VQM T;  4X9D A;  4PLI A;  2KMT A;  1NZ9 A;  3I56 A;  3LH0 A;  3MCA B;  2XD0 A;  2FYK A;  1S72 T;  1VQM Q;  2FHD A;  4J8O A;  1U1S A;  5GAN 7;  2H3E B;  3CPW P;  1AWX A;  4J7I A;  1S72 Q;  2L2P A;  4LUE A;  4CC3 A;  3VS6 A;  2VAS A;  3AT1 B;  1MMA A;  3OBW A;  2K57 A;  5CKF A;  1WDX A;  5FWC A;  4HT9 A;  2W10 A;  1V76 A;  3MO8 A;  4OMN A;  5D6X A;  1Q7Y C;  1BI2 A;  3H6Z A;  1WHL A;  5CQY A;  1PC0 A;  3DKM A;  4C8Q A;  3QJ6 A;  4C5H A;  5GAN j;  2XK0 A;  4WF2 A;  1PKS A;  1W6X A;  3PMI A;  5I2M A;  4MZT A;  3G6E A;  4IIM A;  4BD3 A;  1D3B B;  2X51 A;  2CZ0 B;  1RAD B;  3LGF A;  3OYK A;  1M1K C;  2FPE A;  2LQ8 A;  4JZ3 A;  3M4G A;  1LVK A;  2GCX A;  1ZBX A;  4BE2 A;  4M75 B;  4NOY A;  1QVG A;  4J9H A;  4B9W A;  2GBQ A;  1X6G A;  1KC8 U;  2K9G A;  5GAN 8;  2E41 A;  3A8L B;  2GQI A;  2X9H A;  1M9S A;  1ZSZ A;  2DBM A;  2E10 A;  4M78 B;  4QW2 A;  2HAX A;  2LCS A;  1FYN A;  4R55 A;  2OTJ A;  2K7A A;  2MK5 A;  3PE0 A;  1ZSZ C;  2SEM A;  1VQN T;  5CCA A;  1IHW A;  3CPF A;  4RCB A;  2CRE A;  3SFM A;  4RG2 A;  5KH6 A;  4AFS C;  2EVR A;  2JS0 A;  1VQK A;  5LJ3 f;  2M1H A;  4FSS A;  2ZPE B;  4Z8A A;  5GMK m;  1WZO A;  1VQO A;  2RHY A;  1UFF A;  3C94 A;  3SWN C;  2R5A A;  4C92 B;  3A8G B;  2LJ3 A;  3GOX A;  3QO3 A;  1VA7 A;  3H0F A;  3MHX A;  1ZA2 B;  4JJN K;  1M1G A;  1GFD A;  4PJO D;  3SEM A;  2D6F A;  3OYF A;  5GAN 5;  3D7S B;  2K3Y A;  1NEG A;  2YDL A;  3E9F A;  1VQM A;  3QII A;  1UGP B;  4FT2 A;  2NWM A;  1NJI C;  4QQD A;  3MP6 A;  2RQT A;  3OYM A;  1WI7 A;  2JVV A;  5GJV B;  5KYU A;  1QWE A;  4M7D F;  1RUW A;  4DA4 A;  1S72 A;  1QCF A;  2F1L A;  5LJ3 d;  4F17 A;  1VQ9 T;  2MF2 A;  2HQH A;  1UDL A;  2E70 A;  3DLM A;  4ORZ A;  2DJQ A;  2LX9 A;  3FB9 A;  1U1T A;  4EPC A;  2K6D A;  4WCI A;  2LDM A;  3JCM P;  4AFU C;  1VQ9 Q;  3GNG A;  3JCM c;  2K79 A;  1G3Y A;  1GBR A;  1Q82 R;  4AT1 B;  2CSI A;  2RHI A;  4ZN3 A;  3QG1 A;  4AG1 C;  3CPW S;  4IUV A;  3RIR A;  4B6M A;  5GAM j;  2GGR A;  2K3X A;  1AZE A;  4Y92 A;  3JV3 A;  2EYW A;  1RI9 A;  2COW A;  2ZPI B;  4FYY B;  3CPW A;  4DBR A;  2DYB A;  2B86 A;  5FU7 C;  7AT1 B;  3ULR B;  2ABL A;  1OEB A;  1RAG B;  3VS1 A;  2DXT A;  3C95 A;  4C0D C;  4M7A E;  1M5Q 1;  1M2O A;  3NTK A;  2EAY A;  2QA4 T;  3CMA T;  5CKE A;  1D1B A;  4KGX B;  3M0R A;  2RO0 A;  1GFC A;  3CMA Q;  4C0F A;  1N9S A;  2DXU A;  4MZM A;  1Z9Z A;  4E6R A;  3HHT B;  2QTV A;  5CK9 A;  2LQW A;  1H92 A;  2JN0 A;  1KHC A;  1UJ0 A;  2M51 A;  5LJ5 d;  2RD1 A;  4OB3 B;  1LNX A;  2Y4X A;  4JUV A;  4KH1 B;  4X1V A;  1KQ2 A;  5KYW B;  1R8O B;  2VB6 A;  1G2B A;  4M77 B;  4QVD A;  2JUF A;  2FRY A;  2LC4 A;  1BI0 A;  1ZLM A;  2WAC A;  2C06 A;  3H9N A;  5A0L A;  2P84 A;  3P8D A;  2GFU A;  1OUL A;  4M7A D;  1D0Y A;  1ZSZ B;  2LCC A;  1UEC A;  2RJC A;  1SKU B;  4R0K A;  3BDL A;  5GMK e;  2DL3 A;  4KGV B;  3G4S T;  4IUT A;  2DF6 A;  4XU1 A;  2QAZ A;  4C0G A;  1OX9 A;  1RAE B;  3A1P A;  3G4S Q;  1C0M A;  1KFZ A;  3RBB B;  1K8A R;  2KGT A;  4CRI A;  1XTD A;  4OGC A;  4M77 G;  2DFU A;  1TU0 B;  2CZ6 B;  1U8R A;  4EMK A;  4JZ4 A;  3SWN B;  1M27 C;  2DXB A;  1YCY A;  3CME T;  3S3N A;  2DMO A;  4MML A;  1YWP A;  2A3L A;  2CZ7 B;  1FX7 A;  4BI4 A;  4Z88 A;  2OJ2 A;  1VQ9 A;  3CME Q;  4BI8 B;  1ABO A;  4JDS A;  3M9Q A;  1GCQ C;  1ABQ A;  2XDB A;  3JB9 H;  2ZPF B;  2E3H A;  1RLQ C;  2HDA A;  4M7D C;  3JB9 F;  3L2Q A;  1WJQ A;  1N8R U;  3M56 A;  3NTH A;  1Q82 U;  3T9N A;  1H64 1;  2CP3 A;  1BKB A;  5KYU B;  2DK3 A;  3UPU A;  4X34 A;  4HA8 A;  2FPF A;  2P4T A;  4PFP A;  3JCM d;  4PL6 A;  1NBE B;  4F16 A;  1K9M R;  4PJJ A;  5IHN A;  2ED0 A;  3EGX A;  2KNB B;  1Y0M A;  3FLG A;  2BE9 B;  1TUD A;  3X20 B;  4J9E A;  2HCK A;  5I11 A;  3CMA A;  1WXU A;  3N5B B;  3OSS C;  3M4Y A;  2HD0 A;  2BE7 D;  5FU7 B;  1YI2 Q;  2R57 A;  2O31 A;  1KJW A;  3M0T A;  3X26 B;  1NPR A;  4ELY C;  2O9S A;  2NYS A;  2BZX A;  3EG3 A;  2LRQ A;  1MMG A;  4HVU A;  4C0D B;  4GLK A;  2YUN A;  1WIE A;  3L1A A;  4RTX A;  3OBY A;  2CS7 A;  3TRE A;  2ECZ A;  3M55 A;  4FYX B;  2QDL A;  2R5M A;  3EFO A;  1P92 A;  4Y91 A;  2XHC A;  4JJB A;  3OMC A;  5LJ3 e;  2HNI A;  2K2V A;  5HCK A;  4M75 E;  2F2X A;  2KT1 A;  2KI7 A;  2LT4 A;  3CBM A;  3RKW A;  1PM3 A;  3EFS A;  2AZS A;  4LDY A;  4A4K A;  4FW1 A;  2LQK A;  4DQ2 A;  2VVK A;  5GAN 2;  1X6O A;  1Q95 G;  2LVM A;  2VYT A;  3M58 A;  2XU8 A;  1QW1 A;  2E4H A;  4M78 E;  3I5R A;  2H3J A;  1JJ2 A;  1K0S A;  2EKO A;  3G4S A;  2VUB A;  2L3R A;  1G83 A;  2K5L A;  3LGL A;  1YHQ T;  2BKD N;  4DBQ A;  3NHN A;  4ZGE B;  2P4R A;  5KYN A;  1K9M C;  1ACM B;  4PKC C;  2DEQ A;  1K0X A;  3HL8 A;  1YHQ Q;  1B07 A;  1MND A;  3CCJ T;  2RK2 A;  4JLG A;  3HFO A;  1IRE B;  2EFI A;  2R58 A;  5GMK h;  5ECA A;  3I55 T;  3QZ9 B;  4JJD A;  3CME A;  2EYZ A;  1D3B A;  2RQV A;  1WXB A;  1I0C A;  4A4H A;  3CCJ Q;  4C92 E;  2WSC E;  3ZL7 C;  3I55 Q;  2EWN A;  1W1F A;  3E1S A;  4M75 A;  4O6J A;  3QWY A;  3KXT A;  3PTA A;  4II1 A;  5CKD A;  1MUZ A;  1SPK A;  1IGU A;  4M78 D;  1J3T A;  5DLO A;  4RG8 A;  1N27 A;  2DM1 A;  4RCC A;  5LJ5 e;  2DA9 A;  1U06 A;  1QMC A;  4LDV A;  2PZ1 A;  2AZV A;  3LH5 A;  4F7U G;  4HCC A;  1KQS P;  4PJL A;  1KQ1 A;  3SB2 A;  3AHU A;  3G1J A;  2MMP A;  2YWW A;  4M7D B;  5DLQ E;  3VRZ A;  2JT4 A;  2D1X A;  2J05 A;  2O01 E;  2KBT A;  2ZGW A;  1WYX A;  4OB0 B;  3O5Z A;  5GAO l;  1VQ8 T;  1YI2 A;  3X28 B;  4C92 D;  4FCY A;  3GNF B;  1X75 C;  1A0N B;  4CC2 A;  1UTI A;  1ZHI A;  3OS0 A;  1VQ8 Q;  1Q7Y R;  2QAS A;  3MEA A;  1N6A A;  5DY9 A;  3RKY A;  1H3H A;  4PFO A;  2CKK A;  2LCL A;  4IIO A;  1UGS B;  2HSP A;  3ZFJ A;  3PNW C;  2JXB A;  1NPP A;  4ZN1 A;  2Y4Y A;  5GAN g;  1MGQ A;  3X24 B;  4M7D G;  1D0Z A;  2BZY A;  2J6O A;  2PUO B;  2RJF A;  3S6W A;  3UWN A;  3DLL A;  4IKF A;  1BCO A;  4P5N A;  1KD1 U;  1N9R A;  4QKU A;  1WX6 A;  3UA6 A;  1M1K R;  3HRT A;  2EQJ A;  3A5Z B;  4DEY A;  2HEQ A;  4DOV A;  1B7T A;  3JCM g;  4D8K A;  3G7Z A;  4PNO A;  3OW2 S;  1I5L A;  2DRM A;  2YRC A;  2X4W A;  1SEM A;  3NMZ C;  5GAN e;  5KCO A;  3KBG A;  1WGS A;  4IUU A;  2RN8 A;  3OW2 A;  2G3R A;  3EFO B;  5LJ3 h;  3CCM T;  4PJO F;  4JS4 A;  2FZK B;  1ZUK A;  1D09 B;  1U3O A;  4N0A A;  1YHQ A;  1BI3 A;  1UHC A;  4M77 E;  1K73 C;  4OMQ A;  3CCM Q;  2YSQ A;  2DNU A;  3JCM e;  4N0A C;  3UAT A;  2FPD A;  2QQB A;  2E5K A;  1MV3 A;  3OS2 A;  3CCJ A;  3H8Z A;  1AZG B;  2E64 A;  3I55 A;  1B34 B;  2VWF A;  1VQ6 T;  1SG5 A;  1OI1 A;  3I5S A;  1D0X A;  4C8Q D;  2IPO B;  5EC7 A;  2PTK A;  1YIT T;  2DIG A;  2DZ9 A;  3QKJ A;  3M57 A;  5DM7 R;  1UG1 A;  2HBP A;  8ATC B;  1VYV A;  3TCJ A;  1WFW A;  1Y7X A;  5IN1 A;  5HKC A;  1YIT Q;  2FL7 A;  2NLU A;  1AWW A;  3QWX X;  1MV0 B;  1CKA A;  4C5E A;  4FYW B;  1VQ4 T;  5CR2 A;  1NJI R;  1ZUY A;  2ENM A;  3RER A;  1XOV A;  4E7K A;  5I2S A;  5KYW A;  3QYG B;  2DL5 A;  1QWF A;  1QVF P;  1VQ4 Q;  2CH4 A;  4M77 A;  4GLM A;  3RUX A;  3UA7 A;  4M77 C;  1IB8 A;  2OI3 A;  1WJS A;  2NUT A;  3VS2 A;  5LJ5 h;  4CI0 C;  4GY5 A;  1VQ8 A;  2QQS A;  2RM4 A;  1AT1 B;  2NUP B;  2RHX A;  3MKD A;  4D8D A;  1PRL C;  3THK A;  1FMK A;  1ZA1 B;  1UGR B;  2L3S A;  4N4H A;  1PD1 A;  4J9G A;  5D7U A;  1JB0 E;  3CCU T;  1IGQ A;  4TVR A;  1B3Q A;  1Y96 B;  5GAM g;  1YCS B;  2JM8 A;  1W70 A;  1Q7Y U;  3OYL A;  1VQN Q;  4F7U F;  2BTT A;  2HL3 A;  3M0S A;  3CCU Q;  4ZTF A;  2ATC B;  1WLP B;  4A54 A;  3SWN A;  1PWT A;  2YRD A;  1PG5 B;  4OML A;  5CAI A;  5C0M A;  3JCM X;  1CSK A;  4A63 B;  4ZNX A;  2Z0W A;  4XK8 E;  3JB9 G;  1M1K U;  1TS9 A;  2CT3 A;  2OX7 A;  5HY6 A;  3CCV T;  1N5Z A;  4RUG A;  1ZBJ A;  2RQR A;  2V1Q A;  4KT0 E;  2GQV A;  3LLR A;  2L3P A;  4BUG A;  1PNJ A;  1OOT A;  2EGA A;  3CCV Q;  4JS5 A;  2EIF A;  2XG8 D;  5AT1 B;  1OPL A;  1TUG B;  1XJW B;  1I81 A;  4KUD K;  2XDP A;  8AT1 B;  3CCM A; 
#chains in the Genus database with same CATH homology
 4M77 G;  1WQ7 A;  3TU4 K;  3OYA A;  2CZ6 B;  4MDW A;  5LL6 S;  3UDC A;  3VUB A;  4EMK A;  1U8R A;  3SWN B;  3OYY A;  4HKE A;  1VIF A;  2JTM A;  2DXB A;  1WNL A;  2DVE A;  2LNV A;  1YCY A;  2HQX A;  3CME T;  3CC4 T;  3S3N A;  5GAO n;  3V7C A;  1XQH A;  1RL2 A;  4MMK A;  4MML A;  3G71 A;  2A3L A;  4Q5W A;  2CZ7 B;  4A4F A;  1KC8 C;  1FX7 A;  5AYF A;  4B9X A;  4BI4 A;  1VQP T;  2DAQ A;  3RKX A;  3VJP A;  1VQ9 A;  4PJO C;  2ZCF B;  4BI8 B;  5LJ5 g;  4M7A B;  2RK1 A;  4JDS A;  2M16 A;  2PVD B;  2RJD A;  4KBM B;  4ELZ C;  3GIB A;  2XID A;  3M9Q A;  1G3W A;  2ZPH B;  2XDB A;  3JB9 H;  1KHI A;  5GAO p;  2ZPF B;  3VKI A;  4BAC A;  1Q81 U;  5CQX A;  1QP2 A;  3OA6 A;  3JB9 D;  3CCS T;  4E7J A;  1UEB A;  2F69 A;  2XKO C;  2YHT A;  4EMH A;  4M7D C;  3JB9 F;  4PLL A;  1ZQ1 A;  3A8H B;  4BE1 A;  1YIT A;  3L2Q A;  1WJQ A;  3ZBD A;  4ZTJ A;  4YTL A;  1N8R U;  3M56 A;  3NTH A;  1Q82 U;  2GFA A;  3T9N A;  3CCR A;  1H64 1;  2WSF E;  2QEX T;  4A53 A;  1BKB A;  2DK3 A;  2M0O A;  5CKB A;  3GPL A;  4M75 C;  3G6E T;  3OS5 A;  3UPU A;  1G3S A;  5I21 A;  3S3M A;  5GAN 6;  4QQ6 A;  3C12 A;  4EMK B;  5LJ5 f;  3HFN A;  1VQ5 T;  3HKS A;  4L59 A;  3S3O A;  4OVA A;  4X34 A;  3CXC S;  1KD1 C;  4HA8 A;  2K4Y A;  1VUB A;  2L8D A;  1UB4 A;  2ZPG B;  4R56 A;  4C8Q C;  3LYI A;  4M77 D;  2P4T A;  4XU3 A;  3JCM Q;  4IUP A;  4ZGJ B;  4QQG A;  3WVD B;  4M78 A;  4M77 F;  3JCM d;  1M90 U;  4PL6 A;  4OF1 A;  1QVP A;  3RMQ A;  4LDX A;  4HCB A;  4BB7 A;  2RHU A;  1VQ4 A;  4M78 C;  2DIQ A;  4RKU E;  3CXC A;  3VYG A;  2GF7 A;  3TEE A;  3FLG A;  1K73 U;  1YJW T;  1KQS S;  2E5Q A;  1QVG S;  2VC8 A;  3L2W A;  3X20 B;  4QVZ A;  3RES A;  4J5Y A;  3OQ5 A;  4MZP A;  5FU6 B;  2EQK A;  3PIO A;  1WPY A;  4OB1 B;  3M54 A;  3VYH B;  3CMA A;  3N5B B;  3OSS C;  3WXM B;  3M4Y A;  4E47 A;  2HD0 A;  3MET A;  3MEW A;  5FU7 B;  2JTF A;  5GMK i;  2R57 A;  4XTU A;  5J26 A;  1KQS A;  3OYJ A;  4J83 A;  4LD6 A;  3J81 E;  2L89 A;  1QVF S;  2E6N A;  3X25 B;  1NPR A;  3X26 B;  4ELY C;  2OTJ T;  1VIE A;  3QPH A;  3CCL A;  3OYG A;  2LRQ A;  4PJO E;  5IT9 E;  5HK3 A;  5CVI A;  4C0D B;  4C92 A;  5A0G A;  1PSE A;  4GLK A;  5CO7 A;  3HRU A;  1YJ9 A;  2KSS A;  3L1A A;  4LD9 K;  2KQW A;  1VQN A;  2HQE A;  3OBY A;  3M5A A;  4C92 C;  3CD6 A;  5D6Y A;  1QVF A;  2CS7 A;  2PUK B;  3CBP A;  3CCU A;  3TRE A;  1LOJ A;  2JOY A;  2YLB A;  4XTV A;  4M7D E;  1O9S A;  4D6W A;  3M55 A;  1OYX A;  2E1H A;  3BY7 A;  2R5M A;  1P92 A;  1BIA A;  4Y91 A;  1DJ7 B;  1UGQ B;  2XHC A;  2XDD A;  3OMC A;  3V8K A;  5LJ3 e;  2HNI A;  2QQA A;  4L5G A;  3UT1 A;  3OYI A;  1W2B A;  2K5I A;  2K2V A;  1VQO T;  3LWI A;  4M75 E;  3CBM A;  3LW5 E;  2LT4 A;  3RKW A;  4M7A F;  2RJE A;  5A0D A;  3M53 A;  5CIU A;  3EFS A;  4JRI A;  4BY6 C;  2X4X A;  4M75 G;  4FM4 B;  5GAM e;  3GP8 A;  2XIC A;  4LDY A;  4OMF B;  2EYQ A;  3ME9 A;  4C8Q E;  3MP8 A;  4A4K A;  2LQK A;  4C5G A;  5J3B A;  4DQ2 A;  3OYC A;  4BE0 A;  2DO3 A;  5GAN 2;  3ASK A;  4Z02 A;  1X6O A;  4C8Q G;  2LVM A;  2CYZ B;  2VYT A;  2XU8 A;  3M58 A;  3QHS A;  4HT8 A;  1QW1 A;  5GAN f;  4M78 E;  2H3J A;  2P0K A;  3CCV A;  1JJ2 A;  4KUI A;  5D6W A;  2EKO A;  3G4S A;  3OMG A;  5FRO A;  2DTH A;  4M78 G;  2RI5 A;  2CGH A;  2VUB A;  2L3R A;  3VV0 A;  2D0Q B;  2EJ9 A;  3FJP A;  1VQM T;  3DB3 A;  3M59 A;  4X9D A;  1O75 A;  2K5L A;  3LGL A;  2KMT A;  4PLI A;  1YHQ T;  1YJN A;  2BKD N;  3L2U A;  1NZ9 A;  3ER0 A;  4HCZ A;  3I56 A;  3LH0 A;  4ZGE B;  3CC7 T;  1YIJ T;  3MCA B;  2XD0 A;  2FYK A;  4X9C A;  2MWO A;  1S72 T;  1K9M C;  2D9T A;  4PKC C;  2DEQ A;  3HL8 A;  1H3Z A;  2FHD A;  3JCM f;  2KAF A;  3MEU A;  4PJO A;  3P8H A;  4XU0 A;  2VXE A;  3RMS A;  3CCJ T;  4J8O A;  3QJY A;  5GAN h;  2RK2 A;  1U1S A;  4JLG A;  4LDW A;  3HFO A;  4ZGD B;  5GAN 7;  1IRE B;  2EFI A;  1V29 B;  2R58 A;  3CEY A;  5GMK h;  2KDS A;  4J7I A;  3I55 T;  3QZ9 B;  3CME A;  1D3B A;  3PT9 A;  4M7D A;  4A4H A;  2DD4 A;  4C92 E;  1VQ6 A;  2WSC E;  1Q86 C;  2EWN A;  2PQW A;  4C92 G;  3FC3 A;  1VQP A;  3OBW A;  5GAN d;  2K57 A;  3E1S A;  2FB7 A;  1Y07 A;  5CKF A;  4M75 A;  3JCM h;  3MEV A;  4O6J A;  2KK4 A;  4OB2 B;  3KXT A;  4HT9 A;  4J7F A;  3PTA A;  4XTX A;  5FRN A;  2PVO B;  3MO8 A;  4II1 A;  4XTZ A;  5D6X A;  1Q7Y C;  1BI2 A;  2OAU A;  3H6Z A;  5CQY A;  5CKD A;  3CCS A;  3DKM A;  3HP9 A;  4C8Q A;  3QJ6 A;  3PFS A;  4NS5 A;  4C5H A;  5GAN j;  4M78 D;  5DLO A;  5GMK j;  4RG8 A;  3CC2 T;  2PU9 B;  1N27 A;  3BFM A;  3QSU A;  4RCC A;  3LWH A;  5LJ5 e;  3J7A F;  2XK0 A;  4WF2 A;  2QEX A;  3JCM W;  3HSB A;  4PJO B;  3PMI A;  4F7U E;  5I2M A;  3L2R A;  4MZT A;  3G6E A;  4LDU A;  2LT1 A;  4LDV A;  1VQ5 A;  2DTI A;  4F7U G;  4HCC A;  2ZZD A;  2DTO A;  1WQW A;  3V8J A;  3AHU A;  1KQ1 A;  3SB2 A;  1NJI C;  4BD3 A;  1D3B B;  2KY9 A;  2OTL T;  3VUZ A;  2MMP A;  3ZEH A;  5GMK l;  1NJI U;  2CZ0 B;  4M7D B;  1OZ3 A;  5DLQ E;  3CCQ T;  3LGF A;  2Y90 A;  3OYK A;  1M1K C;  2LQ8 A;  2EQM A;  4XU2 A;  2A7Y A;  2O01 E;  3OS1 A;  3M4G A;  2QA4 A;  2V8J A;  2GCX A;  1ZBX A;  2ZGW A;  4OB0 B;  3FRN A;  4BE2 A;  2F5K A;  4M75 B;  4J6Y A;  4NOY A;  5GAO l;  2B8A A;  1VQ8 T;  1YJW A;  5HK0 A;  4Y28 E;  1YI2 A;  4B9W A;  1QVG A;  2YLC A;  3X28 B;  1BYM A;  4C92 D;  3GNF B;  1X75 C;  4NL3 A;  1KC8 U;  4C8Q B;  5GAN 8;  2E41 A;  3A8M B;  3A8L B;  1ZHI A;  3OS0 A;  2QTX A;  2RI2 A;  3QXE B;  4PJO G;  1M9S A;  1YJN T;  2YRV A;  3MEA A;  3J80 E;  2E10 A;  1N6A A;  2O4X A;  4M78 B;  4QW2 A;  3FEO A;  5DY9 A;  2RI3 A;  3RKY A;  3JAM E;  4R55 A;  2HAX A;  3CCE T;  3INZ A;  3JCM J;  2CKK A;  2OTJ A;  1G5V A;  3JRZ A;  2LCL A;  1UGS B;  3ZFJ A;  3OYH A;  3QDR B;  1VQN T;  3QUI A;  3PNW C;  3O8V A;  3DB4 A;  1NPP A;  3E9G A;  3FIF A;  4ZN1 A;  1PSF A;  5CCA A;  2Y4Y A;  3CPF A;  5GAN g;  1MGQ A;  3MP1 A;  3X24 B;  4M7D G;  4M7D D;  4RCB A;  2PUO B;  4A4G A;  2RJF A;  3S6W A;  3UWN A;  3SFM A;  2VGN A;  3DLL A;  4IKF A;  2IVW A;  4IUQ A;  2XI9 A;  2DJZ A;  4FSX A;  4RG2 A;  5KH6 A;  1JBM A;  4P5N A;  1KG1 A;  1KD1 U;  1N9R A;  4F7U A;  1Q81 C;  4BI3 A;  2X4J A;  3HRT A;  2EQJ A;  1VQL T;  3SDZ A;  4UC4 A;  1VQK A;  2DD5 A;  2P0P A;  3A5Z B;  5LJ3 f;  3OYD A;  2M1H A;  2I2L A;  3QYH B;  5L8R E;  2ZPE B;  4DOV A;  1VQ7 T;  5FLX E;  2P0Q A;  5GMK m;  2BUD A;  1VQO A;  3JCM g;  2RHY A;  5A2Q E;  1N8R C;  1Q82 C;  3G7Z A;  3SWN C;  2MAM A;  3C94 A;  4PNO A;  1B34 A;  3OW2 S;  1I5L A;  2R5A A;  3EAE A;  4C92 B;  2VGM A;  3OYB A;  3A8G B;  4L6V 5;  2X4W A;  3V7S A;  3GOX A;  3QO3 A;  2RHZ A;  4RMO A;  5GAN e;  5GAO m;  4V2S A;  5KCO A;  3KBG A;  3MHX A;  2L5Q A;  1WGS A;  4M7A A;  3JB9 I;  3SD4 A;  4IUU A;  4JJN K;  1M1G A;  1X01 A;  3WVE B;  2KVQ G;  4J6X A;  3OW2 A;  2G3R A;  1M90 C;  3OYN A;  2D6F A;  4PJO D;  5LJ3 h;  4M7A C;  4JRK A;  3CCM T;  4PJO F;  3OYF A;  2X4Y A;  4JS4 A;  5GAN 5;  2QXF A;  2K3Y A;  1M4Z A;  3E9F A;  3HPW A;  1K8A U;  4BY6 B;  1VQM A;  4KUL A;  3QII A;  1UGP B;  4FT2 A;  4N0A A;  3V8L A;  1HXD A;  1I8F A;  2M9U A;  1BI3 A;  1YHQ A;  4M77 E;  1K73 C;  5GAM h;  5EG2 A;  4QQD A;  3MP6 A;  1I4K 1;  3JCM e;  4A4E A;  4N0A C;  5M9O A;  2JVV A;  4F7U B;  3OYM A;  3G71 T;  3CC7 A;  4M7D F;  1YIJ A;  1TH7 A;  4DOW A;  1BIB A;  2QDY B;  2EQU A;  2QQB A;  5GAN 3;  4DA4 A;  1S72 A;  3CC4 A;  4OGE A;  5LJ3 d;  1FXX A;  5J39 A;  1VQ9 T;  2MF2 A;  3JSC A;  3OS2 A;  4XQ3 A;  2E70 A;  3DLM A;  3L42 A;  3CCJ A;  4E7H A;  4M75 D;  3H8Z A;  3BW1 A;  2WSE E;  2E64 A;  2LX9 A;  4EMK C;  1HK9 A;  1NE8 A;  3FB9 A;  3GLX A;  4M75 F;  1B34 B;  5KCH A;  1U1T A;  2RA2 A;  4EPC A;  3I55 A;  4E7I A;  2LDM A;  1RI0 A;  1VQ6 T;  3JCM P;  5GAM d;  1OI1 A;  2AHJ B;  3GNG A;  3JCM c;  4BDY A;  4C8Q D;  1G3Y A;  5LJ3 j;  2RHI A;  4C0Z A;  4C8Q F;  4ZN3 A;  3BDU A;  1YIT T;  2DIG A;  2DZ9 A;  1XNI A;  3QG1 A;  3CPW S;  4IUV A;  3QKJ A;  3Q1J A;  3CCR T;  1W4S A;  3M57 A;  5DM7 R;  3RIR A;  3JCM V;  2HBP A;  2E12 A;  4M78 F;  5GAM j;  3TCJ A;  2K3X A;  1Y7X A;  1IZ6 A;  4O5V A;  5IN1 A;  5HKC A;  5IAY A;  5KE2 A;  2MWP A;  2FL7 A;  2EJG A;  2NLU A;  4FL6 A;  2ZPI B;  5FU6 C;  3CPW A;  2RH2 A;  4XTY A;  2LTO A;  1M8V A;  1EIF A;  1Y71 A;  5FU7 C;  3NFC A;  3PMT A;  4NL2 A;  4XAX B;  4C5E A;  3QBY A;  3CC2 A;  4ATO A;  3E19 A;  1Y96 A;  1VQ4 T;  2K5F A;  5CR2 A;  1G3T A;  1MHN A;  2V8I A;  4JLI A;  3RER A;  1XOV A;  3HRS A;  3PIP A;  4E7K A;  2DXT A;  3QZ5 B;  1QP3 A;  5I2S A;  2BIV A;  3C95 A;  5CKH A;  4C0D C;  3QYG B;  4M7A E;  1M5Q 1;  1K9M U;  2OTL A;  3NTK A;  4M77 A;  3VU3 C;  1AHJ B;  2EAY A;  3RUX A;  2QA4 T;  3CMA T;  3CCQ A;  4M7A G;  2VV5 A;  3L2Z A;  4FT4 A;  4MDX A;  5CKE A;  2MI6 A;  3URG A;  4M77 C;  4C92 F;  3L2V A;  2V8K A;  1WJS A;  5KE3 A;  2RO0 A;  1BI1 A;  3FDR A;  2PVG B;  2RB6 A;  1YI2 T;  5LJ5 h;  3OSV A;  4ME7 A;  2QQR A;  4EDU A;  4GY5 A;  1M1F A;  4CI0 C;  2JZ2 A;  1VQ8 A;  2QQ9 A;  2QQS A;  1FWZ A;  2RM4 A;  2FVU A;  2RHX A;  2ZPB B;  3CCL T;  4JRP A;  4C0F A;  5LJ3 g;  4JRQ A;  1N9S A;  1Q86 U;  2DXU A;  3EFR A;  4MZM A;  1YJ9 T;  3JB9 J;  4N4G A;  1UGR B;  3HHT B;  5CK9 A;  4FU6 A;  1K8A C;  3OY9 A;  3CD6 T;  5C6S A;  4IUR A;  2JN0 A;  3NTI A;  4N4H A;  5GAN 4;  1JB0 E;  1JRI A;  3CCU T;  1KHC A;  2DZC A;  1LJO A;  1Y96 B;  4TVR A;  5LJ5 d;  5GAM g;  1OZ2 A;  2E65 A;  3CCE A;  2IG0 A;  3F70 A;  4BDZ A;  1Q7Y U;  2RD1 A;  5FRM A;  3OYL A;  4OB3 B;  4F7U F;  1LNX A;  2Y4X A;  1W2B S;  4JUV A;  3CBO A;  2JNG A;  1KQ2 A;  1WJR A;  3PGG A;  1R8O B;  4ZTF A;  4E7L A;  4A54 A;  4M77 B;  4QVD A;  5GAO q;  2X35 A;  5LJ5 j;  3SWN A;  2JUF A;  3JCM b;  3C4S A;  3P8B B;  3V7R A;  1SSF A;  2LC4 A;  1BI0 A;  2EJF A;  2WAC A;  5CAI A;  2C06 A;  2VXF A;  2DPP B;  1VQK T;  3GF5 A;  5C0M A;  4J6W A;  5A0L A;  3JCM X;  2QI2 A;  3A8O B;  3P8D A;  2GFU A;  5GAM f;  1YBY A;  1VQL A;  4M7A D;  4XK8 E;  2LCC A;  1VQ7 A;  2O4X B;  3R6O A;  3LX7 A;  2RJC A;  3JB9 G;  1M1K U;  5HY6 A;  3CCV T;  1JJ2 S;  3BDL A;  2E6Z A;  5GMK e;  3G4S T;  4EMG A;  2CZ1 B;  4IUT A;  4XU1 A;  3KUF A;  4C5I A;  3OYE A;  4KT0 E;  2GQV A;  4QVC A;  1GXI E;  3LLR A;  4OP0 A;  4C0G A;  4BUG A;  4FIB A;  2F5T X;  4VUB A;  2EIF A;  4XTW A;  3I56 T;  2XG8 D;  4JS5 A;  2DKG A;  5GAO r;  3OB9 A;  2DXC A;  1I81 A;  4KUD K;  4CRI A;  1XTD A;  4N4I A;  2XDP A;  4OGC A;  3CCM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...