4M7DF

Crystal structure of lsm2-8 complex bound to the rna fragment cguuu
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
80
structure length
66
Chain Sequence
b'AILDLAKYKDSKIRVKLMGGKLVIGVLKGYDQLMNLVLDDTVEYMNARKLGLTVIRGTILVSLSSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords U6 snRNA-associated Sm-like protein LSm8
publication title Crystal structures of the Lsm complex bound to the 3' end sequence of U6 small nuclear RNA.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Rna binding protein
total genus 9
structure length 66
sequence length 80
chains with identical sequence M
ec nomenclature
pdb deposition date 2013-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4m7dF00
3BDUA 1X01A 3L1AA 1KQ2A 4M7AB 4M7DG 1I4K1 4M77E 5GANf 4EMKB 5LJ5j 3JB9F 4HT9A 1H641 5GANd 2RA2A 1TH7A 4M78G 4HT8A 1LJOA 4C8QE 2JN0A 4M7DD 4WF2A 3VU3C 5LJ5e 5GAOr 2DKGA 2DVEA 2HNIA 4NL2A 2DZ9A 4XTUA 4M75C 4PJOG 4C92G 3RERA 4A54A 4C8QA 5GAN2 1WNLA 4M78D 4NOYA 5LJ5f 1HXDA 4M7AE 4XU3A 5GAOq 4JRIA 5GAOm 5GAMj 3JCMc 4C92D 3L2ZA 4PJOD 4N0AC 4XU0A 1MGQA 5GAMe 4HA8A 4JUVA 4MMLA 4M75F 5GMKe 5LJ5h 2K57A 1KQ1A 3JCMf 2QTXA 4PNOA 4XTYA 2RM4A 3JB9J 3HFNA 3JCMd 5GAMf 4M78F 3QHSA 3SB2A 3QSUA 1BIAA 2E10A 5GAOl 5GANg 5GAMd 3HFOA 3SWNC 4NL3A 4X9CA 4XTXA 5GAN8 3JB9H 2FYKA 3FJPA 4X9DA 2YHTA 1WPYA 4N0AA 3JCMh 5GMKm 3RUXA 3JCMQ 2I2LA 1WQ7A 1D3BA 2EJGA 4M75B 5GAMh 5GMKh 5GAN7 4M77G 4J6XA 3BW1A 3V8JA 2DTIA 4M7DC 4J6WA 2DEQA 1I8FA 2FB7A 3FB9A 4XTWA 4C8QG 3SWNA 4Y91A 4F7UF 4M77D 5GMKl 1LNXA 5GAN6 4M78C 3AHUA 5LJ5d 5GAN4 1D3BB 4A53A 5DY9A 5GMKj 3JCMW 3EFRA 4M75E 4C8QD 4C92C 3JCMg 4M7AG 4PJOC 4RCBA 3V7SA 4M7DF 3V7RA 3RKWA 5GAN3 4M7DA 4V2SA 4M75A 3SWNB 2DXUA 2VXEA 3QUIA 4M7AD 4F7UB 3FIFA 4M77F 5GAOn 4M78A 3HSBA 1N9RA 4C92F 4PJOF 4QVCA 5GMKi 4OP0A 2EWNA 5LJ3j 3PGGA 4M7DB 5I21A 4RCCA 1JRIA 4DQ2A 3M4GA 5LJ3e 2E65A 1BIBA 5LJ5g 3BY7A 4M78B 4F7UE 2VXFA 2RB6A 4J6YA 4JRKA 5LJ3f 3V8KA 3BFMA 1HK9A 2CGHA 4C92B 4PJOB 3INZA 4XU2A 4F7UA 5LJ3d 2ZGWA 4M77C 1WQWA 4JLIA 4M7DE 2EJ9A 5GANe 2EAYA 2DTOA 3EFSA 1U1SA 3RKYA 4C8QC 4EMGA 5LJ3h 1Y96B 1U1TA 2DJZA 4M78E 3JCMX 5GAMg 1I5LA 4M75G 4XTVA 1M5Q1 2VC8A 2YLCA 1B34A 4XU1A 4C92E 4PJOE 4M7AC 2EJFA 3V7CA 4M77A 4EMKC 2DXTA 4M75D 5CAIA 3RKXA 1M8VA 3QO3A 1I81A 4C8QF 2RD1A 4C92A 4QVDA 5GANh 3JB9I 3V8LA 2E64A 3GIBA 4PJOA 1LOJA 3JCMP 3JB9G 5GAN5 3JCMJ 1B34B 3JCMb 4J5YA 2DTHA 5LJ3g 2E41A 4M7AF 4EMHA 1N9SA 2DZCA 1Y96A 3JCMe 4M77B 1JBMA 4XQ3A 3JCMV 3RESA 3JB9D 1YCYA 4M7AA 4EMKA 4MMKA 3RIRA 5GANj 5GAOp 4XTZA 4F7UG 2E1HA 4C8QB 2YLBA 2Y90A
chains in the Genus database with same CATH superfamily
1UGQB 2XU8A 2P4TA 3QIIA 1WXBA 3ZBDA 1XOVA 2A3LA 5GANd 3UPUA 1TH7A 4BY6C 5HKCA 2KBTA 2R57A 4LUEA 1HXDA 3TVTA 3EG0A 2JTEA 4A4FA 2O01E 1MGQA 1Q95G 1Q82R 2HAXA 3PTAA 4C0GA 3QSUA 1BIAA 3LW5E 3PIPA 3CCUA 1PD1A 1ZSZB 4F04B 2CREA 2K3BA 1VQOA 2AHJB 2E5KA 4RG2A 2DBKA 2XG8D 2MIOA 3I56Q 4M77D 2IIMA 5GAN4 2PQWA 2KYBA 2DL8A 3EFRA 1VYVA 1M90U 1VQ5A 3RDVA 4QVCA 1VQ4A 1ZBXA 4OMFB 1H92A 8ATCB 4IUTA 3NGPA 3KFVA 2CGHA 3LGFA 5IN1A 1OU9A 1VQKQ 2DM1A 2DX1A 5FU7B 2DTOA 2XKOC 3EAEA 2F2VA 2X4WA 1M27C 1M5Q1 2QGGA 3NHNA 1JU5C 3CCSA 2QQSA 5FWCA 1YJWA 3E19A 1ABOA 2XK0A 4OMOA 4QVDA 1VQ5Q 4PJOA 2YSQA 4ESRA 5GANh 1NE8A 2CYZB 1VIFA 3MEWA 2QI2A 3EGXB 5KE3A 4M7AF 3RR6A 1NEBA 3C94A 1QVFP 2PNIA 3FC3A 4OB1B 3SEMA 1YJ9A 3ME9A 4CC3A 2MWPA 2EQMA 4FL6A 5GANf 1N6AA 3META 2J6OA 2L2PA 4MZMA 2ABLA 2J06A 4HT8A 1QMCA 1PC0A 2PUOB 1LPLA 2YRCA 4F14A 5IHKA 1QVGA 4C8QA 2MOXA 4NOYA 4XU3A 2WSEE 1YJWQ 2ED0A 3UDCA 2NUZA 3MEVA 1KIKA 3ER0A 5KYYB 5GAMd 4OF1A 3O5ZA 4XTXA 3RMQA 4HKEA 2DFUA 1OZ2A 1D3BA 2FVUA 1XNIA 4FM4B 1VQ6T 3LWHA 1Z9ZA 4D6WA 2HSPA 2KVQG 4Y91A 4M78C 5M9OA 1BI0A 1N8RC 3P8DA 1KSWA 1NLPC 5FLXE 3CCQQ 3CCRA 2CP7A 3LGLA 3CXCS 3CMAT 4AMCA 1VQMQ 4M78A 4J9CA 2V8IA 3M0UA 1UJ0A 1WLPB 1NBEB 1NM7A 1GBQA 4HVUA 1NJIC 5LJ5g 2JMAA 2EKOA 1YNZA 3VS7A 1KD1U 2P84A 1M4ZA 4JJDA 4OMLA 4HVWA 3VS5A 1Q86R 1Q7YU 1YIJT 1M1GA 4GLMA 2XDPA 1ZQ1A 1JQQA 1QVGP 2CZ7B 1VYUA 1D0XA 1KFZA 4LDWA 1W2BP 1WHJA 3VS1A 1CKAA 1TTHB 3EFOB 2JUFA 5IHIA 6AT1B 2E3HA 3PT9A 5J3BA 2I0NA 1WHHA 2HDAA 4JZ4A 2COZA 2KQWA 2O31A 1YJNA 2L5QA 3JB9F 2K2MA 4M78G 4RUGA 4NL2A 4BUGA 3RERA 3CPFA 1FWZA 3DB3A 1VUBA 4PJOD 3L2ZA 3PFSA 3CC4Q 1X75C 2KSSA 2CZ1B 2LDMA 4FYWB 4HA8A 5GMKe 2JT4A 3J80E 2JS0A 3QDRB 5GAMf 3TQ7P 3SWNC 2XDDA 1C6VX 1QKXA 3JB9H 3JCMQ 2MPXC 2LJ0A 4Z8AA 3BW1A 1UJYA 1YI2A 2AKLA 3CD6A 2FB7A 3SWNA 3AHUA 3EGDB 3ASKA 3M0SA 3OS2A 1AZEA 5AYFA 4C8QD 3OW2A 4M7DF 1XQHA 2E4HA 3RKWA 5KYUA 4M77F 2L3PA 3M53A 5IXFA 2RI3A 1WZOA 2BUDA 2O2OA 2BKDN 3I55A 2OTJA 2VXFA 1VQ7A 4PJMA 1QLYA 2XHCA 1UGRB 4J9EA 1G8XA 1R8OB 3PMTA 3WVDB 2AK5A 1YI2Q 4OMMA 1D0ZA 2XD0A 3QJYA 1OI1A 1RABB 5DLOA 2JXBA 4BB7A 4LUDA 2F2XA 4E7LA 3CBPA 4M7AC 2QK0A 2PVDB 1K8AR 1RL2A 2DERA 2WSCE 3RKXA 1BI3A 2QAZA 1S72Q 2ZPHB 1S1NA 1E6HA 3A98A 1MMNA 2M16A 4C0FA 3QPHA 3G4ST 2SEMA 2CDTA 2DVJA 4IURA 4M7AA 1WHLA 1YCYA 5GANj 2A37A 4AFSC 2BTTA 2YLBA 2OTJQ 4ZGEB 1VQ7Q 1YHQT 1ARKA 4HXJA 4DEXA 1TU0B 3SFMA 2CUDA 3FEOA 2QA4T 1K4US 5C0MA 4WF2A 3VU3C 2ZPEB 5GJVB 3OW2P 3DLMA 2OAUA 5GAN2 5CKHA 4JRIA 2DE0X 3JCMc 3ZFJA 5A2QE 1TOVA 5GJWB 1VQNT 3VS4A 4B9WA 5GAOl 5GANg 3OA6A 3G71A 4FT4A 3JV3A 2HMAA 1AWWA 4JPBW 4C5GA 5FRNA 4ZNXA 4PJLA 4IIMA 4M7AG 2V8JA 2EYXA 3V7RA 5A0GA 2A36A 2RQWA 1Q81R 2CS7A 4J9FA 1IRXA 1PM3A 3L2WA 3LLRA 2DYIA 2EWNA 2AZVA 4KGVB 2LCCA 3C4SA 5KCHA 2K3XA 5LJ3e 4ORZA 1QP3A 2E65A 1KG1A 5AT1B 2LP5A 1M90C 2MMPA 4C0DC 3M9QA 3UWNA 4XU2A 3THKA 1YITA 3R6NA 2K9GA 1U1SA 2QEXA 1IZ6A 1DJ7B 1UDLA 1M1KC 2R5AA 4HCKA 2E41A 4XQ3A 1G5VA 4OB2B 1OEBA 4C5EA 2YUOA 2Y90A 2K2VA 1Y07A 3C12A 1X01A 2YUNA 2YRVA 4R56A 1YITQ 2K6DA 2QEXQ 1LVKA 1PG5B 3M0RA 2HQHA 4LNPA 3OYEA 5GAMj 2AZSA 4J9BA 1KHIA 5CKBA 3CC2T 1EZZB 2CP6A 2DAQA 2EW3A 4M75F 1RI9A 3VS2A 1TG0A 5KCOA 3OSSC 2VYTA 4JS5A 3QHSA 2YDLA 1I07A 1E6GA 1K1ZA 3OYGA 1WJSA 3CCJA 1WQ7A 2KE9A 3AT1B 4UC4A 1WJQA 4FU6A 4M7DC 1QP2A 1I8FA 3G6ET 1KQSA 4F7UF 2YT6A 3CCVA 2OTLA 1WHKA 2K3YA 2DJQA 3UATA 1VQPT 4M7DA 4ELZC 3OYFA 2CP3A 4RMOA 1VA7A 1UEBA 4OP0A 5D7UA 3OYMA 2V26A 2JOYA 3X25B 4JRQA 1BB9A 1JRIA 1UUEA 1N8RR 3PE0A 3IQLA 2QQBA 2J6FA 2B86A 3CCJQ 4RTWA 3INZA 3CC7T 2KNBB 4FSSA 3CCMT 1WQWA 3OW2S 1VOMA 4FT2A 1U1TA 4M78E 3GNGA 8AT1B 2F69A 3CBMA 1NJIR 2DD5A 3QO3A 5DM7R 3LX7A 1OYXA 5CCAA 4CC4B 1VQ9Q 2E6NA 4EPCA 5A0DA 2RF0A 4M7DG 2OAWA 1H641 2L3QA 1R0BG 2JN0A 2KYMA 2D1XA 2JM9A 3NPFA 3CXCP 1WHGA 3TSZA 2FZCB 1NPRA 2DXBA 1AOJA 1X6GA 1ZA2B 5I11A 2K57A 4FYYB 3H0IA 3GLXA 2YRDA 2RM4A 3HFNA 3JCMd 1PKTA 3A8GB 3OBWA 1ZA1B 4IUPA 3CPWA 2NYSA 4BI3A 3RUXA 1ZHIA 2EJGA 3I56A 3TEEA 1ZUUA 1BI1A 2DTIA 3TREA 1AHJB 2VWFA 3M5AA 3CMEA 4OMPA 2MI6A 1SSHA 2YUQA 2PZ1A 2KRSA 1D3BB 5FW9A 3JCMW 2LQWA 2XIDA 3BDLA 3H6ZA 1PD0A 1Y57A 3OYIA 1VQ4T 2VB6A 5GAOn 3CC7Q 3UT1A 1OX8A 1VIEA 2RJFA 4C92F 4KRTA 4E2FB 4ZGDB 2LC4A 3OYHA 3MCAB 2P4RA 3MEAA 1B07A 2XDBA 1VQKA 1WIEA 4L5GA 4M78B 4LDVA 2DYBA 4D8DA 5CKFA 2CSQA 4PFZA 2EBPA 4JLIA 2W0ZA 2EAYA 3CMEQ 1Y96B 2RNAA 3X24B 3CCST 1NYGA 1I5LA 1GCQC 2OI3A 1M3CA 4EDUA 4ZN1A 3JCMb 1GCQA 2HCKA 1D09B 2MF2A 4FSXA 1TWBA 1M1KU 3JCMV 2F5TX 3RIRA 1AT1B 4PJJA 2H8HA 4PL6A 1E7OA 4N4GA 1G3WA 1WX6A 2O4XB 3OYYA 5LJ5e 4RTVA 4M75C 4A54A 2RI2A 4M7AE 2EPDA 4ANJA 2LNHB 2KDSA 1D1BA 4XU0A 4RTYA 4PFOA 3JCMf 3JB9J 3GP8A 2ENMA 3CCET 3HFOA 3GPLA 1SG5A 2FPEA 2YHTA 5FU6C 3QBYA 4KH0B 1WYXA 2VKNA 1H8KA 3EHRA 3L42A 3VYGA 1BKBA 2GCXA 3CCQA 3EG1A 4WCIA 2COWA 4A53A 3OQ5A 4Z89A 1OZ3A 4Y28E 2PVGB 1VQMA 1M30A 2DD4A 4V2SA 2A28A 3SWNB 3C0CA 2VXEA 4B9XA 4E7KA 2LCLA 2VVKA 3E1SA 5CR2A 3VRZA 2Y4YA 1O75A 1GL5A 2EVRA 1NZ9A 5IT9E 5KYUB 3TU4K 1MMAA 2FRWA 4JRPA 2AIRB 3JAME 1M1FA 3RNJA 1ZX6A 1KQSS 5LJ3d 1AD5A 3M4YA 1WHMA 5KYXA 2LMJA 1SHGA 4DBFA 2SRCA 4BACA 2ESWA 1QW1A 2ZPFB 2COYA 2DJZA 3JCMX 1RADB 4M75G 4DBRA 2O9SA 1ACMB 4LD6A 1M90R 2DXTA 3KXTA 4QVZA 1JXMA 2JJ9A 3V8LA 1X2KA 2VASA 3J81E 3VS3A 4JS4A 4J8OA 4AG2C 5HK0A 1Y96A 1K9MR 3VUBA 1J3TA 5D6YA 5GAOp 3OYAA 4F7UG 1KC8C 2KMTA 2YXYA 3OB9A 2B8AA 1FMWA 2FRYA 3WXMB 2L3RA 1M3AA 4M7AB 4AFZC 3VS0A 3OS1A 3VRYA 4IKFA 2BZ8A 1Z9QA 3CCEQ 3CC4A 2ZCFB 3OYBA 3VV0A 1VQ6A 2E12A 5HY6A 1BU1A 2QGFB 1MV0B 1SF9A 2E5QA 1W70A 4MMLA 2KXCA 2O4XA 2KI7A 3VKIA 1WFWA 3HTRA 1PRMC 2EKHA 1TS9A 4X34A 2JTMA 4CI0C 3FJPA 5A0LA 5GAMh 1V76A 3CD6T 3MJXA 1QCOA 2QXFA 9ATCB 3I5RA 3FB9A 2KRNA 1NEGA 1T0HA 5DY9A 3OYDA 4C92C 4RCBA 2K5FA 4JJBA 4BE1A 1UTIA 1VQ6Q 1UECA 2EQJA 3VYHB 2FL7A 1JXOA 3QUIA 1QVPA 2NLUA 2ZPIB 3CPWS 4MZTA 3QWXX 3I55T 1N5ZA 1FMKA 3HHTB 2FPDA 2KT1A 4E47A 4DA4A 1UGSB 1VYTA 3CMAQ 3OY9A 2ZAEA 5LJ3f 2J7IA 1U3OA 4FCYA 2ZGWA 4KH1B 4C5HA 4ZN3A 3M55A 4M7DE 4MDWA 5GANe 2H3JA 4LXCA 1AVZC 3MO8A 1QQJA 4BDYA 4OMNA 1S72A 1AEYA 1M2VB 2ATCB 4XU1A 4ZTJA 1O9SA 1YIJQ 2E64A 3JCMP 5J39A 1X6OA 4C0DB 2EFIA 4C0ZA 2E1HA 4RG8A 3QYHB 1Y0MA 1KD1R 2O9VA 5ECAA 1Q7YR 1AWXA 2OJ2A 2WSFE 3M56A 5CKEA 2LQ8A 1RAEB 3FJ5A 2CP2A 2DZ9A 4C92G 2RK2A 1V1CA 2D9TA 4M78D 1R0CB 5GAOm 1T3SA 4GLKA 1C1AA 3M59A 2DEUA 1P92A 2CP5A 2C0IA 3G71T 3SB2A 5IHNA 2DO3A 2FYKA 4X9DA 3X28B 4IUQA 2GFAA 2KT8A 1ZBJA 2AKKA 5GMKl 1VQ8T 2L0AA 2EIFA 1UFFA 4RTTA 1D1AA 3JCMg 1IHWA 2EQUA 1RAGB 4M4ZA 4BDZA 3KUFA 1OPLA 2EYQA 3L2UA 5C6SA 2P0PA 3SHWA 4M7DB 4BI4A 1OULA 4OGEA 1BIBA 2JNGA 3G7ZA 5IAYA 2HKQB 2M9UA 1VQLT 3HRTA 3V8KA 3G4SA 4RTZA 1BI2A 2KEAA 1JJ2A 4DOWA 1U06A 3QJ6A 1CSKA 2HQEA 4LDYA 1MUZA 2DNUA 3NFCA 4LN2A 1UHCA 2JS2A 2RHUA 1K0SA 3GNFB 4KUIA 4TVRA 2RHXA 2BE7D 2GF7A 4J9DA 1ZLMA 2DZCA 2JTFA 3OYCA 1M2VA 1IREB 3M58A 3F70A 3G4SQ 1KQ2A 1WXUA 1VQNA 1PWTA 3MHXA 3UA6A 3DLLA 3CCLT 1KC8U 2RA2A 2LTOA 1SPKA 2D0QB 3OS5A 1GCPA 1YHQQ 4A63B 1U8RA 4B6MA 3E9FA 4Q5WA 1KK7A 5GAOq 2K4YA 2QA4Q 4FW2A 3VJPA 1K73U 1ZUKA 4ZTFA 2LJ1A 1IGUA 3L2QA 4KT0E 2DIQA 4XTYA 2FZGB 4Y92A 1Q86C 2JMCA 2EYWA 1IB8A 2VUBA 5GAN8 1X27A 2PTKA 2X3XD 2RK1A 2OTLT 1VQNQ 2DEQA 2DILA 4O6JA 5I22A 5GAN6 2KROA 1TXQA 2PUKB 4M75E 2NUPA 3JRZA 1BCMA 2DXUA 2VGNA 4RKUE 4M7AD 1RACB 1VQLQ 3OYNA 1RLQC 3HSBA 4PJOF 2MWOA 5LJ3j 3PGGA 2FEIA 2RJEA 1T3LA 1TSFA 1Y71A 4F7UE 4OVAA 3I35A 2D6FA 5IXBA 4J6YA 4JRKA 3X20B 1I5OB 1OU8A 4M77C 4JJNK 1UG1A 1UHFA 2RN8A 2ROLA 1X69A 4IUVA 4FYVB 3RKYA 5GAMg 4XAXB 4PK4A 4ZGJB 4XTVA 1WJRA 2IVWA 4FYXB 4M77A 2LQKA 2EQKA 4KUDK 4E6RA 4C8QF 2RD1A 2XI9A 3GIBA 2RQVA 3JB9G 3CBOA 3RBBB 4J5YA 1GFCA 2G3RA 4QW2A 5LJ3g 1Q82U 1VQ9A 3UF4A 3DB4A 3M0PA 5D6XA 2ZPGB 3DKMA 4RTXA 2RO0A 4JUVA 1H3HA 2RH2A 4LDUA 2C06A 2FHDA 2IG0A 3PVQA 2Y4XA 1LJOA 5KH6A 2OX7A 4E7IA 3NTHA 5KYNA 2QQRA 2NUTA 2D8JA 2M51A 3T9NA 2CUBA 5LJ5f 1QCNA 3G6EA 2CP0A 3CEYA 3WVEB 4LE9A 2M0OA 3A1PA 1AWJA 4M78F 1W6XA 1X2QA 1X43A 4R0KA 1KQSP 1WPYA 3CC2Q 2GTJA 3TCJA 4M75B 1M2OA 4E7ZA 4M77G 1TUGB 4LDXA 3LH0A 4BE2A 4J6WA 5FRMA 4HVVA 1I0CA 3CQTA 2DK3A 2L89A 2F1LA 2DF6A 2PU9B 2RJDA 2DRKA 1RAAB 3CC7A 3CCMA 3N5BB 1MHNA 1OX9A 2J6KA 4DBHA 3CCUT 3G6EQ 4F7UB 5FU6B 1N9RA 1NG2A 1WI7A 1GBRA 3S3MA 1VQOT 4DBQA 4KBMB 3X26B 1SRLA 1VQPQ 5HK3A 3NMZC 4JDSA 2FPFA 5EG2A 2RI5A 3TSWA 2KAFA 4L59A 1QWFA 2RHIA 2C0TA 1VQ5T 3EFSA 4EMGA 5J26A 4QKUA 5I2MA 4C92E 3C95A 4J9HA 5KYXB 1JB0E 2BE9B 4EMKC 3CCMQ 2DBMA 1M8VA 3SD4A 1LOJA 4E7JA 2JZ2A 4FIBA 4EMKA 4XK8E 2CH4A 2G6FX 1R77A 3MP1A 2LT1A 1JJ2S 4N4IA 2HSEB 5CQYA 5DLQE 1YJWT 2D8HA 1QVFA 3I5SA 4ELYC 1Q81C 4M7DD 1F1BB 2M0YA 2HNIA 2W10A 2HL5C 1WNLA 4HCZA 2GTOA 3CPWP 2J05A 2GGRA 1YJ9T 4CC2A 1V29B 5IH2A 1B3QA 4A4HA 1ZUYA 3QG1A 4K11A 2E10A 3OYLA 3HRSA 1G2BA 3EG2A 3EH1A 4X9CA 4NL3A 3JCMh 4BI8B 1K9MU 2I2LA 2DA9A 1W1FA 5GMKh 2KY9A 1Q86U 3LYIA 3CCUQ 2EGCA 3CCQT 1G3YA 2ZZDA 2X9HA 1LNXA 1VQMT 4R55A 1VQOQ 3PVLA 5FROA 4PJOC 3MKDA 3VUZA 5GAN3 4M75A 1EIFA 3ZL7C 5CKDA 2ECZA 3FLGA 1HYOA 3NTKA 5I21A 3P8BB 4KULA 1VQ4Q 1SKUB 2GQVA 2HBWA 1UE9A 4VUBA 4C92B 4F7UA 1NPPA 4JJCA 5KYWB 2EJ9A 3CCRT 2PVOB 1TUCA 1OV3A 4C8QC 1PKSA 2DL4A 4E7HA 2VC8A 2YLCA 5FWBA 1B34A 3L2VA 3O8VA 3V7CA 3A8LB 3EG9B 3H0HA 2JVVA 2LQNA 2QYZA 5EC7A 2KGTA 3CCSQ 4F17A 2DTHA 3A8OB 2K5LA 1N9SA 4EMHA 2V1QA 1JBMA 1W2BA 3RESA 2DL7A 1YWPA 3EG3A 4RTUA 3PMIA 3QYGB 1RLPC 1PNJA 3FRNA 3L1AA 4IIOA 1KHCA 2RMOA 1YP5A 3CCEA 5LJ5j 3REAB 1YJ9Q 1QCFA 3OBYA 3MP6A 2L3SA 2X4JA 3CC4T 1ZSZC 4CC7A 1YFNA 4XTUA 4PJOG 4L6V5 2DXCA 1YN8A 4WTOB 2EYZA 4KGXB 3MPUB 1ZSZA 2YUPA 2CT3A 4PNOA 2X3WD 4OB0B 3GF5A 2VV5A 1YJNT 1M1KR 2K7AA 4JZ3A 2LX9A 1D1CA 2DPPB 3HRUA 1JO8A 1K73C 2JM8A 3JSCA 1C0MA 4J6XA 3V8JA 5CK9A 3MEUA 4XTWA 4C8QG 1RI0A 2F5KA 3QWYA 4A4GA 1M3BA 3G1JA 2HZYA 1K8AU 1FXXA 1B7TA 2NWMA 4PJNA 5FU7C 2MYSA 3E9GA 4QT7A 4II1A 5GMKi 2RJCA 1K76A 3CMAA 3CCRQ 1YI2T 3SDZA 5L23A 1XJWB 3BY7A 4C5IA 2A0FB 1OPKA 1HK9A 2H3EB 2X51A 2CKKA 2ROTA 1S72T 5LJ3h 1YIJA 3J7AF 2QTVA 4N4HA 3EGXA 1GFDA 4M75D 5CAIA 4C92A 2OTJT 1UB4A 1WXTA 2V1RA 1VQ7T 2CZ0B 1H3ZA 5KYWA 2KK4A 1BCOA 2LNVA 3JCMe 1FYNA 3LWIA 2YWWA 4XTZA 3ULRB 3EG9A 1G3SA 2E3IA 1AZGB 1I4K1 4M77E 4HT9A 2QG9B 5CO7A 1Q82C 1K0XA 4ME7A 3PIOA 2DKGA 3RMSA 3GOXA 1YJNQ 3H8ZA 2X4XA 4PKCC 1BYMA 2RPNA 2RHYA 3HKSA 5KYYA 4IUUA 1Q81U 2P0QA 2BZXA 2KXDA 2IPOB 1FMVA 3QZ9B 2CT4A 2F2WA 2GQIA 5GMKm 4PLLA 1NYFA 3HP9A 4J83A 1QVFS 4AFQC 1Y7XA 1MMGA 5GAN7 2O88A 1MMDA 3A8HB 3PNWC 5CVIA 2L8DA 2BZYA 4MDXA 2WACA 2QDYB 1PRLC 3OSVA 5GMKj 5LL6S 1JEGA 3CD6Q 1GXIE 3V7SA 4E7SA 1UGVA 2HBPA 2CZ6B 3E2UA 3I9QA 3FIFA 1YBYA 1HJDA 3URGA 3KBGA 2NUPB 1SSFA 1CKBA 2ED1A 3M4GA 2RQRA 2LVMA 1G3TA 2AT1B 2HQXA 4GY5A 4CRIA 3S3OA 2HD0A 2KR3A 1K9AA 3BFMA 3EGUA 3EH2A 3MP8A 4BD3A 2Z0WA 2XMFA 5CIUA 3I55Q 1IO6A 3P8HA 3ZEHA 3EFOA 1LCKA 2K79A 4OMQA 2R5MA 5CQXA 3QKJA 2FO0A 2LX7A 2BIVA 1YITT 4M77B 3REBB 2MCNA 4MMKA 3U23A 2HEQA 2JW4A 3UA7A 2QEXT 2RQUA 3BDUA 4A4EA 1YHQA 1U5SA 1NLOC 4NS5A 1OOTA 3A5ZB 1W4SA 4FW1A 2QA4A 5GAOr 2DVEA 2V8KA 4J9GA 2DMOA 1QVGS 1AWOA 2QASA 2MAMA 1IHVA 1XTDA 4C92D 1KJWA 5KE2A 1A0NB 2NUTB 1W2BS 1VQ8A 5GAMe 3HPWA 2XICA 3M0TA 1QWEA 3HL8A 4AFUC 1N8RU 2MK5A 2DRMA 1FX7A 2X35A 2DIGA 3EGDA 4X1VA 3H9NA 1D0YA 1MNDA 1UGPB 4QQDA 4MZPA 3G71Q 1HD3A 4DOVA 3OYKA 4DEYA 3R6OA 5LJ5d 3Q1JA 2CH4W 1VQLA 5I2SA 1NJIU 1WA7A 1K9MC 1RUWA 4PFPA 4Z02A 5D6WA 1VQ8Q 3CCJT 4J7FA 1BBZA 4RCCA 1JJ2P 4BE0A 3CCVT 4J9IA 2EYYA 3OS0A 1YWOA 4F16A 2LT4A 1SEMA 2HL3A 3FDRA 7AT1B 3S6WA 3M0QA 4J7IA 3GBQA 2ZPBB 2C0OA 2GFUA 3NTIA 4PLIA 2X4YA 4PJOE 1WGSA 3BE3A 3CCLA 1I81A 1IGQA 3JB9I 1VQ9T 2FZKB 5GAN5 3JCMJ 3QXEB 4EIKA 2EGEA 2K5IA 3QZ5B 2FG0A 3OYJA 1PCXA 2VGMA 1BK2A 1ABQA 1EX4A 3M57A 1T0JA 4BY6B 4EMKB 2LJ3A 4C8QE 2QQ9A 1MNEA 1PHTA 1M8MA 1RAHB 2D0NA 4HCCA 1M9SA 2M02A 4A4KA 2P0KA 4OB3B 4AG1C 1WDXA 3A8MB 1N27A 2DL3A 3CCLQ 3LH5A 2CSIA 4N0AC 5LJ5h 1G83A 1KQ1A 1IXDA 2QDLA 2QTXA 3CXCA 3CC2A 4YTLA 2DLPA 1SRMA 4AT1B 3VS6A 2LZ6B 4N0AA 2EGAA 1HSQA 2QQAA 1QKWA 2LRQA 3H0FA 1X6BA 1PSEA 2E70A 1KC8R 4ATOA 2M1HA 3OMGA 4LD9K 3CCVQ 4P5NA 2OTLQ 2A08A 2KRMA 4JLGA 1K73R 2EQIA 2DL5A 1VQPA 1KD1C 3I56T 3D7SB 3M54A 1GRIA 1RAFB 1Q7YC 4DQ2A 3CMET 1K8AC 2RB6A 4QQ6A 1MV3A 4GBQA 1EFNA 4QQGA 2LCSA 1OQKA 4PJOB 5L8RE 3QDFA 3EHQA 4O5VA 2A7YA 2RHZA 2GNCA 4OGCA 3L2RA 1I1JA 1ZSGA 1YCSB 4D8KA 4Z88A 2EJFA 1RAIB 1PSFA 2HKNA 1VQKT 1SHFA 2E6ZA 1B34B 2RQTA 3S3NA 2DETA 2R58A 1TUDA 2GBQA 4HCBA 3JB9D 5HCKA 4KGZB 4C8QB 3OMCA 3H41A
chains in the Genus database with same CATH topology
1UGQB 3PMIA 3QYGB 1Y07A 2XU8A 1X01A 2P4TA 3C12A 3FRNA 3QIIA 3L1AA 2YRVA 1KHCA 3ZBDA 4R56A 1XOVA 2A3LA 3CCEA 5LJ5j 5GANd 2WSFE 3OBYA 3UPUA 1TH7A 3M56A 3MP6A 4BY6C 2X4JA 2LQ8A 5CKEA 5HKCA 3CC4T 4XTUA 2DZ9A 4PJOG 4L6V5 4C92G 2R57A 2RK2A 2D9TA 4M78D 2DXCA 1HXDA 3OYEA 5GAOm 5GAMj 4A4FA 4GLKA 1KHIA 2O01E 5CKBA 1MGQA 3M59A 2DAQA 3CC2T 1P92A 4M75F 4PNOA 4OB0B 3GF5A 5KCOA 3PTAA 2VV5A 2VYTA 3OSSC 3QHSA 3SB2A 4C0GA 3G71T 1BIAA 3LW5E 4JS5A 1YJNT 3QSUA 2DO3A 2LX9A 3PIPA 3CCUA 2FYKA 4X9DA 2DPPB 3HRUA 3OYGA 1WJSA 3CCJA 1WQ7A 3X28B 1K73C 4UC4A 1VQOA 2AHJB 3JSCA 4IUQA 1WJQA 4FU6A 4J6XA 3V8JA 2GFAA 4M7DC 5CK9A 4RG2A 2XG8D 1QP2A 1I8FA 3MEUA 4XTWA 4C8QG 4F7UF 3G6ET 1KQSA 5GMKl 4M77D 3CCVA 2OTLA 1RI0A 2F5KA 1VQ8T 5GAN4 2PQWA 2EIFA 2K3YA 1VQ6T 4A4GA 3EFRA 3JCMg 2EQUA 1K8AU 1M90U 1VQPT 1FXXA 4M7DA 4BDZA 3KUFA 2EYQA 5FU7C 1VQ5A 3E9GA 4ELZC 3OYFA 3L2UA 5C6SA 2P0PA 4RMOA 4II1A 4QVCA 5GMKi 1VQ4A 1ZBXA 2RJCA 1UEBA 4OP0A 4OMFB 3CMAA 3OYMA 2JOYA 3X25B 4M7DB 4BI4A 4JRQA 1JRIA 1YI2T 3SDZA 4OGEA 1BIBA 2JNGA 3BY7A 3G7ZA 2QQBA 4IUTA 5IAYA 4C5IA 2M9UA 1VQLT 3HRTA 3V8KA 1HK9A 2CGHA 3G4SA 3INZA 3CC7T 3LGFA 5IN1A 3CCMT 1WQWA 2CKKA 1BI2A 1S72T 1JJ2A 5FU7B 2DTOA 2XKOC 4DOWA 3EAEA 3OW2S 5LJ3h 4FT2A 1U1TA 2X4WA 4M78E 1YIJA 3GNGA 3QJ6A 3J7AF 2HQEA 1M5Q1 4LDYA 4N4HA 2F69A 3CBMA 3NFCA 3CCSA 2QQSA 1YJWA 3E19A 4M75D 5CAIA 2DD5A 2RHUA 2XK0A 3QO3A 4C92A 4QVDA 3GNFB 1UB4A 4KUIA 5GANh 4PJOA 1NE8A 2OTJT 1VQ7T 4TVRA 2CZ0B 2CYZB 1VIFA 2RHXA 2GF7A 3MEWA 5DM7R 1H3ZA 2KK4A 2QI2A 1OYXA 3LX7A 2LNVA 5KE3A 4M7AF 2DZCA 3JCMe 2JTFA 5CCAA 3OYCA 3C94A 3LWIA 4XTZA 3FC3A 4OB1B 1IREB 3M58A 1YJ9A 3ME9A 3F70A 2E6NA 1G3SA 4EPCA 5A0DA 1KQ2A 4M7DG 2MWPA 1I4K1 2EQMA 4FL6A 4M77E 1N6AA 5GANf 1VQNA 3MHXA 3META 4HT9A 5CO7A 1H641 3DLLA 3CCLT 1KC8U 2RA2A 1Q82C 2LTOA 4MZMA 4ME7A 3PIOA 4HT8A 2JN0A 2PUOB 2D0QB 3OS5A 2DKGA 3RMSA 3GOXA 1U8RA 1QVGA 3H8ZA 4C8QA 2X4XA 3E9FA 4NOYA 4PKCC 1BYMA 4Q5WA 4XU3A 2WSEE 5GAOq 2RHYA 3HKSA 2K4YA 4IUUA 3VJPA 1K73U 4ZTFA 1Q81U 1NPRA 2P0QA 2DXBA 3L2QA 4KT0E 2K57A 3UDCA 2DIQA 3MEVA 4XTYA 3GLXA 3QZ9B 2RM4A 3HFNA 3JCMd 1Q86C 3A8GB 3ER0A 3OBWA 5GAMd 4OF1A 4IUPA 3CPWA 2VUBA 4XTXA 5GAN8 5GMKm 4PLLA 3RMQA 4HKEA 4BI3A 3RUXA 3HP9A 1OZ2A 4J83A 1QVFS 1Y7XA 1D3BA 1ZHIA 2EJGA 3I56A 3TEEA 2FVUA 5GAN7 1BI1A 1XNIA 2RK1A 4FM4B 2DTIA 3A8HB 3LWHA 4D6WA 2OTLT 3PNWC 5CVIA 3TREA 2KVQG 1AHJB 2L8DA 2DEQA 3M5AA 3CMEA 4O6JA 2MI6A 4Y91A 4MDXA 2WACA 4M78C 5GAN6 2QDYB 1BI0A 5M9OA 1N8RC 1D3BB 3P8DA 3OSVA 5GMKj 3JCMW 5LL6S 2PUKB 3BDLA 2XIDA 4M75E 3H6ZA 1GXIE 3V7SA 2HBPA 3JRZA 5FLXE 3CCRA 2CZ6B 2DXUA 2VGNA 3LGLA 3OYIA 4RKUE 3CXCS 1VQ4T 4M7AD 3OYNA 3CMAT 3FIFA 5GAOn 4M78A 3HSBA 3UT1A 1VIEA 2RJFA 1YBYA 4PJOF 4C92F 3URGA 3KBGA 2MWOA 5LJ3j 3PGGA 1SSFA 2V8IA 4ZGDB 2LC4A 2RJEA 3OYHA 3MCAB 3MEAA 2XDBA 3M4GA 2LVMA 1G3TA 2HQXA 1NJIC 4GY5A 5LJ5g 4CRIA 1Y71A 4L5GA 4M78B 4F7UE 2EKOA 4LDVA 1KD1U 4OVAA 3S3OA 2D6FA 1M4ZA 4J6YA 4JRKA 2HD0A 4BD3A 3BFMA 5CKFA 3MP8A 3X20B 5CIUA 4JJNK 4M77C 1Q7YU 4JLIA 1YIJT 1M1GA 3P8HA 4IUVA 2EAYA 2XDPA 1ZQ1A 3RKYA 3ZEHA 1Y96B 3X24B 5GAMg 3CCST 4XAXB 1I5LA 4ZGJB 4XTVA 1WJRA 4EDUA 2CZ7B 2IVWA 4ZN1A 4LDWA 4M77A 2LQKA 2EQKA 2R5MA 5CQXA 4KUDK 3QKJA 4C8QF 2RD1A 2XI9A 3GIBA 3JB9G 3CBOA 2JUFA 3JCMb 2BIVA 4J5YA 2MF2A 2G3RA 4QW2A 5LJ3g 1Q82U 1VQ9A 1YITT 4FSXA 4M77B 3DB4A 3PT9A 5D6XA 5J3BA 3JCMV 1M1KU 2F5TX 2ZPGB 4MMKA 3RIRA 3DKMA 2RO0A 4JUVA 2RH2A 4LDUA 2QEXT 2C06A 4PL6A 3BDUA 4A4EA 2KQWA 4N4GA 2FHDA 1G3WA 1YJNA 1YHQA 2L5QA 3JB9F 2O4XB 4NS5A 2IG0A 2Y4XA 4M78G 3A5ZB 1LJOA 1W4SA 3OYYA 5KH6A 5LJ5e 4E7IA 3NTHA 2QA4A 2QQRA 5GAOr 2DVEA 2V8KA 4NL2A 4BUGA 3RERA 4M75C 3T9NA 4A54A 3CPFA 1QVGS 1FWZA 2RI2A 5LJ5f 4M7AE 3DB3A 2MAMA 1VUBA 1XTDA 4C92D 3L2ZA 4PJOD 3G6EA 2KDSA 4XU0A 3CEYA 3PFSA 3WVEB 5KE2A 1W2BS 5GAMe 1VQ8A 1X75C 2KSSA 2CZ1B 2LDMA 2M0OA 3HPWA 4HA8A 5GMKe 3JCMf 3J80E 2XICA 3JB9J 3HL8A 3QDRB 4M78F 5GAMf 3GP8A 3CCET 1N8RU 3HFOA 3SWNC 3GPLA 2XDDA 3JB9H 1FX7A 2X35A 2DIGA 1WPYA 2YHTA 5FU6C 3JCMQ 3QBYA 3TCJA 4M75B 1UGPB 4M77G 4QQDA 4LDXA 3LH0A 3BW1A 4BE2A 4MZPA 4J6WA 5FRMA 4DOVA 1YI2A 3L42A 3OYKA 1VQKA 2FB7A 3CD6A 3VYGA 1BKBA 3SWNA 2DK3A 2L89A 3ASKA 2GCXA 3R6OA 3AHUA 5LJ5d 3CCQA 2PU9B 2RJDA 3OS2A 4A53A 3Q1JA 3OQ5A 5AYFA 1OZ3A 4Y28E 1VQLA 4C8QD 2PVGB 5I2SA 3OW2A 3CC7A 1VQMA 1NJIU 4M7DF 1K9MC 1XQHA 2DD4A 3RKWA 3CCMA 3N5BB 1MHNA 4V2SA 3SWNB 2VXEA 3CCUT 4B9XA 4Z02A 5D6WA 2LCLA 4F7UB 3E1SA 4M77F 5FU6B 5CR2A 4E7KA 3CCJT 2Y4YA 1N9RA 1O75A 3S3MA 1VQOT 3M53A 4J7FA 1NZ9A 5IT9E 4KBMB 3TU4K 4RCCA 3X26B 2RI3A 2BUDA 4BE0A 4JRPA 5HK3A 2BKDN 3CCVT 3JAME 3I55A 2OTJA 1M1FA 2VXFA 1VQ7A 3OS0A 4JDSA 2XHCA 5EG2A 1UGRB 1KQSS 2RI5A 1R8OB 2LT4A 5LJ3d 2KAFA 3PMTA 3M4YA 4L59A 3WVDB 2RHIA 3FDRA 1VQ5T 3S6WA 4BACA 3EFSA 1QW1A 2ZPFB 4J7IA 2ZPBB 5J26A 4EMGA 3JCMX 2DJZA 2GFUA 2XD0A 3QJYA 1OI1A 3NTIA 4M75G 5I2MA 5DLOA 4PLIA 2X4YA 4BB7A 4C92E 4PJOE 4E7LA 3CBPA 1WGSA 4M7AC 3C95A 1JB0E 2PVDB 1RL2A 4LD6A 2DXTA 2WSCE 4EMKC 3RKXA 1BI3A 3CCLA 1M8VA 1I81A 2ZPHB 3JB9I 4QVZA 3KXTA 3V8LA 1VQ9T 3SD4A 1LOJA 2M16A 3J81E 5GAN5 3JCMJ 4C0FA 3QPHA 3QXEB 3G4ST 4JS4A 4J8OA 5HK0A 4E7JA 1Y96A 2K5IA 3QZ5B 4IURA 3VUBA 2JZ2A 4M7AA 1YCYA 4FIBA 3OYJA 4EMKA 5GANj 2VGMA 5D6YA 5GAOp 4XK8E 4F7UG 3OYAA 1KC8C 2YLBA 4ZGEB 2KMTA 3MP1A 2LT1A 3OB9A 1YHQT 1JJ2S 4N4IA 2B8AA 3WXMB 5CQYA 3FEOA 2L3RA 3M57A 5DLQE 4M7AB 3SFMA 3OS1A 1YJWT 4BY6B 4EMKB 2QA4T 1QVFA 4C8QE 2QQ9A 4ELYC 4WF2A 3VU3C 5C0MA 1Q81C 2ZPEB 4IKFA 4M7DD 3DLMA 2HNIA 2OAUA 4HCCA 5GAN2 3CC4A 1M9SA 1WNLA 2ZCFB 4A4KA 5CKHA 3OYBA 3VV0A 2P0KA 4OB3B 1VQ6A 2E12A 4JRIA 5HY6A 3JCMc 3A8MB 1N27A 4HCZA 3ZFJA 4N0AC 1YJ9T 2E5QA 5A2QE 1V29B 4MMLA 2O4XA 5LJ5h 1KQ1A 2QTXA 3VKIA 3CXCA 4A4HA 3CC2A 1VQNT 4B9WA 3QG1A 4X34A 4YTLA 2E10A 5GAOl 5GANg 3OYLA 3OA6A 3HRSA 4NL3A 4X9CA 2JTMA 4CI0C 4FT4A 3FJPA 3JCMh 3G71A 4N0AA 4BI8B 1K9MU 2I2LA 5A0LA 5GAMh 4C5GA 5FRNA 5GMKh 3CD6T 2QQAA 2KY9A 1Q86U 3LYIA 2LRQA 2QXFA 3CCQT 1PSEA 2E70A 1G3YA 3FB9A 2ZZDA 4ATOA 1LNXA 1VQMT 4R55A 5DY9A 2M1HA 5FROA 3OYDA 4C92C 4M7AG 4PJOC 3OMGA 4RCBA 4LD9K 2V8JA 2K5FA 4BE1A 5A0GA 3V7RA 3VUZA 4P5NA 2EQJA 3VYHB 5GAN3 4M75A 1EIFA 2FL7A 3QUIA 4JLGA 2CS7A 5CKDA 1VQPA 1KD1C 1QVPA 2NLUA 3FLGA 3L2WA 3I56T 3LLRA 2ZPIB 3CPWS 3M54A 4MZTA 2EWNA 2LCCA 3I55T 3C4SA 3NTKA 5KCHA 2K3XA 3HHTB 3P8BB 4DQ2A 5I21A 3CMET 1Q7YC 4E47A 5LJ3e 4DA4A 1QP3A 2E65A 1UGSB 4KULA 1KG1A 1K8AC 1M90C 2MMPA 2GQVA 2RB6A 4QQ6A 4C0DC 3OY9A 3M9QA 5LJ3f 4QQGA 4VUBA 4C92B 4PJOB 5L8RE 4XU2A 3UWNA 4F7UA 2ZGWA 1NPPA 1YITA 4C5HA 4O5VA 4ZN3A 2A7YA 3M55A 2RHZA 2EJ9A 4M7DE 3CCRT 4MDWA 5GANe 2PVOB 2H3JA 4OGCA 1U1SA 4C8QC 3L2RA 4BDYA 3MO8A 4E7HA 2QEXA 1S72A 2VC8A 2YLCA 3L2VA 1B34A 3O8VA 4XU1A 2HAXA 1DJ7B 1IZ6A 4ZTJA 2EJFA 3V7CA 1M1KC 1O9SA 3A8LB 1PSFA 2JVVA 2R5AA 1VQKT 2E64A 2E6ZA 3JCMP 5J39A 1X6OA 1B34B 4C0DB 3S3NA 2DTHA 3A8OB 2E41A 2K5LA 1N9SA 4EMHA 2R58A 4HCBA 1JBMA 4XQ3A 3JB9D 3RESA 2EFIA 1W2BA 1G5VA 4C0ZA 4OB2B 2E1HA 4C5EA 4C8QB 3OMCA 4RG8A 3QYHB 2Y90A 2K2VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BDU A;  1X01 A;  3L1A A;  1KQ2 A;  4M7A B;  4M7D G;  1I4K 1;  4M77 E;  5GAN f;  4EMK B;  5LJ5 j;  3JB9 F;  4HT9 A;  1H64 1;  5GAN d;  2RA2 A;  1TH7 A;  4M78 G;  4HT8 A;  1LJO A;  4C8Q E;  2JN0 A;  4M7D D;  4WF2 A;  3VU3 C;  5LJ5 e;  5GAO r;  2DKG A;  2DVE A;  2HNI A;  4NL2 A;  2DZ9 A;  4XTU A;  4M75 C;  4PJO G;  4C92 G;  3RER A;  4A54 A;  4C8Q A;  5GAN 2;  1WNL A;  4M78 D;  4NOY A;  5LJ5 f;  1HXD A;  4M7A E;  4XU3 A;  5GAO q;  4JRI A;  5GAO m;  5GAM j;  3JCM c;  4C92 D;  3L2Z A;  4PJO D;  4N0A C;  4XU0 A;  1MGQ A;  5GAM e;  4HA8 A;  4JUV A;  4MML A;  4M75 F;  5GMK e;  5LJ5 h;  2K57 A;  1KQ1 A;  3JCM f;  2QTX A;  4PNO A;  4XTY A;  2RM4 A;  3JB9 J;  3HFN A;  3JCM d;  5GAM f;  4M78 F;  3QHS A;  3SB2 A;  3QSU A;  1BIA A;  2E10 A;  5GAO l;  5GAN g;  5GAM d;  3HFO A;  3SWN C;  4NL3 A;  4X9C A;  4XTX A;  5GAN 8;  3JB9 H;  2FYK A;  3FJP A;  4X9D A;  2YHT A;  1WPY A;  4N0A A;  3JCM h;  5GMK m;  3RUX A;  3JCM Q;  2I2L A;  1WQ7 A;  1D3B A;  2EJG A;  4M75 B;  5GAM h;  5GMK h;  5GAN 7;  4M77 G;  4J6X A;  3BW1 A;  3V8J A;  2DTI A;  4M7D C;  4J6W A;  2DEQ A;  1I8F A;  2FB7 A;  3FB9 A;  4XTW A;  4C8Q G;  3SWN A;  4Y91 A;  4F7U F;  4M77 D;  5GMK l;  1LNX A;  5GAN 6;  4M78 C;  3AHU A;  5LJ5 d;  5GAN 4;  1D3B B;  4A53 A;  5DY9 A;  5GMK j;  3JCM W;  3EFR A;  4M75 E;  4C8Q D;  4C92 C;  3JCM g;  4M7A G;  4PJO C;  4RCB A;  3V7S A;  4M7D F;  3V7R A;  3RKW A;  5GAN 3;  4M7D A;  4V2S A;  4M75 A;  3SWN B;  2DXU A;  2VXE A;  3QUI A;  4M7A D;  4F7U B;  3FIF A;  4M77 F;  5GAO n;  4M78 A;  3HSB A;  1N9R A;  4C92 F;  4PJO F;  4QVC A;  5GMK i;  4OP0 A;  2EWN A;  5LJ3 j;  3PGG A;  4M7D B;  5I21 A;  4RCC A;  1JRI A;  4DQ2 A;  3M4G A;  5LJ3 e;  2E65 A;  1BIB A;  5LJ5 g;  3BY7 A;  4M78 B;  4F7U E;  2VXF A;  2RB6 A;  4J6Y A;  4JRK A;  5LJ3 f;  3V8K A;  3BFM A;  1HK9 A;  2CGH A;  4C92 B;  4PJO B;  3INZ A;  4XU2 A;  4F7U A;  5LJ3 d;  2ZGW A;  4M77 C;  1WQW A;  4JLI A;  4M7D E;  2EJ9 A;  5GAN e;  2EAY A;  2DTO A;  3EFS A;  1U1S A;  3RKY A;  4C8Q C;  4EMG A;  5LJ3 h;  1Y96 B;  1U1T A;  2DJZ A;  4M78 E;  3JCM X;  5GAM g;  1I5L A;  4M75 G;  4XTV A;  1M5Q 1;  2VC8 A;  2YLC A;  1B34 A;  4XU1 A;  4C92 E;  4PJO E;  4M7A C;  2EJF A;  3V7C A;  4M77 A;  4EMK C;  2DXT A;  4M75 D;  5CAI A;  3RKX A;  1M8V A;  3QO3 A;  1I81 A;  4C8Q F;  2RD1 A;  4C92 A;  4QVD A;  5GAN h;  3JB9 I;  3V8L A;  2E64 A;  3GIB A;  4PJO A;  1LOJ A;  3JCM P;  3JB9 G;  5GAN 5;  3JCM J;  1B34 B;  3JCM b;  4J5Y A;  2DTH A;  5LJ3 g;  2E41 A;  4M7A F;  4EMH A;  1N9S A;  2DZC A;  1Y96 A;  3JCM e;  4M77 B;  1JBM A;  4XQ3 A;  3JCM V;  3RES A;  3JB9 D;  1YCY A;  4M7A A;  4EMK A;  4MMK A;  3RIR A;  5GAN j;  5GAO p;  4XTZ A;  4F7U G;  2E1H A;  4C8Q B;  2YLB A;  2Y90 A; 
#chains in the Genus database with same CATH topology
 1UGQ B;  2XU8 A;  2P4T A;  3QII A;  1WXB A;  3ZBD A;  1XOV A;  2A3L A;  5GAN d;  3UPU A;  1TH7 A;  4BY6 C;  5HKC A;  2KBT A;  2R57 A;  4LUE A;  1HXD A;  3TVT A;  3EG0 A;  2JTE A;  4A4F A;  2O01 E;  1MGQ A;  1Q95 G;  1Q82 R;  2HAX A;  3PTA A;  4C0G A;  3QSU A;  1BIA A;  3LW5 E;  3PIP A;  3CCU A;  1PD1 A;  1ZSZ B;  4F04 B;  2CRE A;  2K3B A;  1VQO A;  2AHJ B;  2E5K A;  4RG2 A;  2DBK A;  2XG8 D;  2MIO A;  3I56 Q;  4M77 D;  2IIM A;  5GAN 4;  2PQW A;  2KYB A;  2DL8 A;  3EFR A;  1VYV A;  1M90 U;  1VQ5 A;  3RDV A;  4QVC A;  1VQ4 A;  1ZBX A;  4OMF B;  1H92 A;  8ATC B;  4IUT A;  3NGP A;  3KFV A;  2CGH A;  3LGF A;  5IN1 A;  1OU9 A;  1VQK Q;  2DM1 A;  2DX1 A;  5FU7 B;  2DTO A;  2XKO C;  3EAE A;  2F2V A;  2X4W A;  1M27 C;  1M5Q 1;  2QGG A;  3NHN A;  1JU5 C;  3CCS A;  2QQS A;  5FWC A;  1YJW A;  3E19 A;  1ABO A;  2XK0 A;  4OMO A;  4QVD A;  1VQ5 Q;  4PJO A;  2YSQ A;  4ESR A;  5GAN h;  1NE8 A;  2CYZ B;  1VIF A;  3MEW A;  2QI2 A;  3EGX B;  5KE3 A;  4M7A F;  3RR6 A;  1NEB A;  3C94 A;  1QVF P;  2PNI A;  3FC3 A;  4OB1 B;  3SEM A;  1YJ9 A;  3ME9 A;  4CC3 A;  2MWP A;  2EQM A;  4FL6 A;  5GAN f;  1N6A A;  3MET A;  2J6O A;  2L2P A;  4MZM A;  2ABL A;  2J06 A;  4HT8 A;  1QMC A;  1PC0 A;  2PUO B;  1LPL A;  2YRC A;  4F14 A;  5IHK A;  1QVG A;  4C8Q A;  2MOX A;  4NOY A;  4XU3 A;  2WSE E;  1YJW Q;  2ED0 A;  3UDC A;  2NUZ A;  3MEV A;  1KIK A;  3ER0 A;  5KYY B;  5GAM d;  4OF1 A;  3O5Z A;  4XTX A;  3RMQ A;  4HKE A;  2DFU A;  1OZ2 A;  1D3B A;  2FVU A;  1XNI A;  4FM4 B;  1VQ6 T;  3LWH A;  1Z9Z A;  4D6W A;  2HSP A;  2KVQ G;  4Y91 A;  4M78 C;  5M9O A;  1BI0 A;  1N8R C;  3P8D A;  1KSW A;  1NLP C;  5FLX E;  3CCQ Q;  3CCR A;  2CP7 A;  3LGL A;  3CXC S;  3CMA T;  4AMC A;  1VQM Q;  4M78 A;  4J9C A;  2V8I A;  3M0U A;  1UJ0 A;  1WLP B;  1NBE B;  1NM7 A;  1GBQ A;  4HVU A;  1NJI C;  5LJ5 g;  2JMA A;  2EKO A;  1YNZ A;  3VS7 A;  1KD1 U;  2P84 A;  1M4Z A;  4JJD A;  4OML A;  4HVW A;  3VS5 A;  1Q86 R;  1Q7Y U;  1YIJ T;  1M1G A;  4GLM A;  2XDP A;  1ZQ1 A;  1JQQ A;  1QVG P;  2CZ7 B;  1VYU A;  1D0X A;  1KFZ A;  4LDW A;  1W2B P;  1WHJ A;  3VS1 A;  1CKA A;  1TTH B;  3EFO B;  2JUF A;  5IHI A;  6AT1 B;  2E3H A;  3PT9 A;  5J3B A;  2I0N A;  1WHH A;  2HDA A;  4JZ4 A;  2COZ A;  2KQW A;  2O31 A;  1YJN A;  2L5Q A;  3JB9 F;  2K2M A;  4M78 G;  4RUG A;  4NL2 A;  4BUG A;  3RER A;  3CPF A;  1FWZ A;  3DB3 A;  1VUB A;  4PJO D;  3L2Z A;  3PFS A;  3CC4 Q;  1X75 C;  2KSS A;  2CZ1 B;  2LDM A;  4FYW B;  4HA8 A;  5GMK e;  2JT4 A;  3J80 E;  2JS0 A;  3QDR B;  5GAM f;  3TQ7 P;  3SWN C;  2XDD A;  1C6V X;  1QKX A;  3JB9 H;  3JCM Q;  2MPX C;  2LJ0 A;  4Z8A A;  3BW1 A;  1UJY A;  1YI2 A;  2AKL A;  3CD6 A;  2FB7 A;  3SWN A;  3AHU A;  3EGD B;  3ASK A;  3M0S A;  3OS2 A;  1AZE A;  5AYF A;  4C8Q D;  3OW2 A;  4M7D F;  1XQH A;  2E4H A;  3RKW A;  5KYU A;  4M77 F;  2L3P A;  3M53 A;  5IXF A;  2RI3 A;  1WZO A;  2BUD A;  2O2O A;  2BKD N;  3I55 A;  2OTJ A;  2VXF A;  1VQ7 A;  4PJM A;  1QLY A;  2XHC A;  1UGR B;  4J9E A;  1G8X A;  1R8O B;  3PMT A;  3WVD B;  2AK5 A;  1YI2 Q;  4OMM A;  1D0Z A;  2XD0 A;  3QJY A;  1OI1 A;  1RAB B;  5DLO A;  2JXB A;  4BB7 A;  4LUD A;  2F2X A;  4E7L A;  3CBP A;  4M7A C;  2QK0 A;  2PVD B;  1K8A R;  1RL2 A;  2DER A;  2WSC E;  3RKX A;  1BI3 A;  2QAZ A;  1S72 Q;  2ZPH B;  1S1N A;  1E6H A;  3A98 A;  1MMN A;  2M16 A;  4C0F A;  3QPH A;  3G4S T;  2SEM A;  2CDT A;  2DVJ A;  4IUR A;  4M7A A;  1WHL A;  1YCY A;  5GAN j;  2A37 A;  4AFS C;  2BTT A;  2YLB A;  2OTJ Q;  4ZGE B;  1VQ7 Q;  1YHQ T;  1ARK A;  4HXJ A;  4DEX A;  1TU0 B;  3SFM A;  2CUD A;  3FEO A;  2QA4 T;  1K4U S;  5C0M A;  4WF2 A;  3VU3 C;  2ZPE B;  5GJV B;  3OW2 P;  3DLM A;  2OAU A;  5GAN 2;  5CKH A;  4JRI A;  2DE0 X;  3JCM c;  3ZFJ A;  5A2Q E;  1TOV A;  5GJW B;  1VQN T;  3VS4 A;  4B9W A;  5GAO l;  5GAN g;  3OA6 A;  3G71 A;  4FT4 A;  3JV3 A;  2HMA A;  1AWW A;  4JPB W;  4C5G A;  5FRN A;  4ZNX A;  4PJL A;  4IIM A;  4M7A G;  2V8J A;  2EYX A;  3V7R A;  5A0G A;  2A36 A;  2RQW A;  1Q81 R;  2CS7 A;  4J9F A;  1IRX A;  1PM3 A;  3L2W A;  3LLR A;  2DYI A;  2EWN A;  2AZV A;  4KGV B;  2LCC A;  3C4S A;  5KCH A;  2K3X A;  5LJ3 e;  4ORZ A;  1QP3 A;  2E65 A;  1KG1 A;  5AT1 B;  2LP5 A;  1M90 C;  2MMP A;  4C0D C;  3M9Q A;  3UWN A;  4XU2 A;  3THK A;  1YIT A;  3R6N A;  2K9G A;  1U1S A;  2QEX A;  1IZ6 A;  1DJ7 B;  1UDL A;  1M1K C;  2R5A A;  4HCK A;  2E41 A;  4XQ3 A;  1G5V A;  4OB2 B;  1OEB A;  4C5E A;  2YUO A;  2Y90 A;  2K2V A;  1Y07 A;  3C12 A;  1X01 A;  2YUN A;  2YRV A;  4R56 A;  1YIT Q;  2K6D A;  2QEX Q;  1LVK A;  1PG5 B;  3M0R A;  2HQH A;  4LNP A;  3OYE A;  5GAM j;  2AZS A;  4J9B A;  1KHI A;  5CKB A;  3CC2 T;  1EZZ B;  2CP6 A;  2DAQ A;  2EW3 A;  4M75 F;  1RI9 A;  3VS2 A;  1TG0 A;  5KCO A;  3OSS C;  2VYT A;  4JS5 A;  3QHS A;  2YDL A;  1I07 A;  1E6G A;  1K1Z A;  3OYG A;  1WJS A;  3CCJ A;  1WQ7 A;  2KE9 A;  3AT1 B;  4UC4 A;  1WJQ A;  4FU6 A;  4M7D C;  1QP2 A;  1I8F A;  3G6E T;  1KQS A;  4F7U F;  2YT6 A;  3CCV A;  2OTL A;  1WHK A;  2K3Y A;  2DJQ A;  3UAT A;  1VQP T;  4M7D A;  4ELZ C;  3OYF A;  2CP3 A;  4RMO A;  1VA7 A;  1UEB A;  4OP0 A;  5D7U A;  3OYM A;  2V26 A;  2JOY A;  3X25 B;  4JRQ A;  1BB9 A;  1JRI A;  1UUE A;  1N8R R;  3PE0 A;  3IQL A;  2QQB A;  2J6F A;  2B86 A;  3CCJ Q;  4RTW A;  3INZ A;  3CC7 T;  2KNB B;  4FSS A;  3CCM T;  1WQW A;  3OW2 S;  1VOM A;  4FT2 A;  1U1T A;  4M78 E;  3GNG A;  8AT1 B;  2F69 A;  3CBM A;  1NJI R;  2DD5 A;  3QO3 A;  5DM7 R;  3LX7 A;  1OYX A;  5CCA A;  4CC4 B;  1VQ9 Q;  2E6N A;  4EPC A;  5A0D A;  2RF0 A;  4M7D G;  2OAW A;  1H64 1;  2L3Q A;  1R0B G;  2JN0 A;  2KYM A;  2D1X A;  2JM9 A;  3NPF A;  3CXC P;  1WHG A;  3TSZ A;  2FZC B;  1NPR A;  2DXB A;  1AOJ A;  1X6G A;  1ZA2 B;  5I11 A;  2K57 A;  4FYY B;  3H0I A;  3GLX A;  2YRD A;  2RM4 A;  3HFN A;  3JCM d;  1PKT A;  3A8G B;  3OBW A;  1ZA1 B;  4IUP A;  3CPW A;  2NYS A;  4BI3 A;  3RUX A;  1ZHI A;  2EJG A;  3I56 A;  3TEE A;  1ZUU A;  1BI1 A;  2DTI A;  3TRE A;  1AHJ B;  2VWF A;  3M5A A;  3CME A;  4OMP A;  2MI6 A;  1SSH A;  2YUQ A;  2PZ1 A;  2KRS A;  1D3B B;  5FW9 A;  3JCM W;  2LQW A;  2XID A;  3BDL A;  3H6Z A;  1PD0 A;  1Y57 A;  3OYI A;  1VQ4 T;  2VB6 A;  5GAO n;  3CC7 Q;  3UT1 A;  1OX8 A;  1VIE A;  2RJF A;  4C92 F;  4KRT A;  4E2F B;  4ZGD B;  2LC4 A;  3OYH A;  3MCA B;  2P4R A;  3MEA A;  1B07 A;  2XDB A;  1VQK A;  1WIE A;  4L5G A;  4M78 B;  4LDV A;  2DYB A;  4D8D A;  5CKF A;  2CSQ A;  4PFZ A;  2EBP A;  4JLI A;  2W0Z A;  2EAY A;  3CME Q;  1Y96 B;  2RNA A;  3X24 B;  3CCS T;  1NYG A;  1I5L A;  1GCQ C;  2OI3 A;  1M3C A;  4EDU A;  4ZN1 A;  3JCM b;  1GCQ A;  2HCK A;  1D09 B;  2MF2 A;  4FSX A;  1TWB A;  1M1K U;  3JCM V;  2F5T X;  3RIR A;  1AT1 B;  4PJJ A;  2H8H A;  4PL6 A;  1E7O A;  4N4G A;  1G3W A;  1WX6 A;  2O4X B;  3OYY A;  5LJ5 e;  4RTV A;  4M75 C;  4A54 A;  2RI2 A;  4M7A E;  2EPD A;  4ANJ A;  2LNH B;  2KDS A;  1D1B A;  4XU0 A;  4RTY A;  4PFO A;  3JCM f;  3JB9 J;  3GP8 A;  2ENM A;  3CCE T;  3HFO A;  3GPL A;  1SG5 A;  2FPE A;  2YHT A;  5FU6 C;  3QBY A;  4KH0 B;  1WYX A;  2VKN A;  1H8K A;  3EHR A;  3L42 A;  3VYG A;  1BKB A;  2GCX A;  3CCQ A;  3EG1 A;  4WCI A;  2COW A;  4A53 A;  3OQ5 A;  4Z89 A;  1OZ3 A;  4Y28 E;  2PVG B;  1VQM A;  1M30 A;  2DD4 A;  4V2S A;  2A28 A;  3SWN B;  3C0C A;  2VXE A;  4B9X A;  4E7K A;  2LCL A;  2VVK A;  3E1S A;  5CR2 A;  3VRZ A;  2Y4Y A;  1O75 A;  1GL5 A;  2EVR A;  1NZ9 A;  5IT9 E;  5KYU B;  3TU4 K;  1MMA A;  2FRW A;  4JRP A;  2AIR B;  3JAM E;  1M1F A;  3RNJ A;  1ZX6 A;  1KQS S;  5LJ3 d;  1AD5 A;  3M4Y A;  1WHM A;  5KYX A;  2LMJ A;  1SHG A;  4DBF A;  2SRC A;  4BAC A;  2ESW A;  1QW1 A;  2ZPF B;  2COY A;  2DJZ A;  3JCM X;  1RAD B;  4M75 G;  4DBR A;  2O9S A;  1ACM B;  4LD6 A;  1M90 R;  2DXT A;  3KXT A;  4QVZ A;  1JXM A;  2JJ9 A;  3V8L A;  1X2K A;  2VAS A;  3J81 E;  3VS3 A;  4JS4 A;  4J8O A;  4AG2 C;  5HK0 A;  1Y96 A;  1K9M R;  3VUB A;  1J3T A;  5D6Y A;  5GAO p;  3OYA A;  4F7U G;  1KC8 C;  2KMT A;  2YXY A;  3OB9 A;  2B8A A;  1FMW A;  2FRY A;  3WXM B;  2L3R A;  1M3A A;  4M7A B;  4AFZ C;  3VS0 A;  3OS1 A;  3VRY A;  4IKF A;  2BZ8 A;  1Z9Q A;  3CCE Q;  3CC4 A;  2ZCF B;  3OYB A;  3VV0 A;  1VQ6 A;  2E12 A;  5HY6 A;  1BU1 A;  2QGF B;  1MV0 B;  1SF9 A;  2E5Q A;  1W70 A;  4MML A;  2KXC A;  2O4X A;  2KI7 A;  3VKI A;  1WFW A;  3HTR A;  1PRM C;  2EKH A;  1TS9 A;  4X34 A;  2JTM A;  4CI0 C;  3FJP A;  5A0L A;  5GAM h;  1V76 A;  3CD6 T;  3MJX A;  1QCO A;  2QXF A;  9ATC B;  3I5R A;  3FB9 A;  2KRN A;  1NEG A;  1T0H A;  5DY9 A;  3OYD A;  4C92 C;  4RCB A;  2K5F A;  4JJB A;  4BE1 A;  1UTI A;  1VQ6 Q;  1UEC A;  2EQJ A;  3VYH B;  2FL7 A;  1JXO A;  3QUI A;  1QVP A;  2NLU A;  2ZPI B;  3CPW S;  4MZT A;  3QWX X;  3I55 T;  1N5Z A;  1FMK A;  3HHT B;  2FPD A;  2KT1 A;  4E47 A;  4DA4 A;  1UGS B;  1VYT A;  3CMA Q;  3OY9 A;  2ZAE A;  5LJ3 f;  2J7I A;  1U3O A;  4FCY A;  2ZGW A;  4KH1 B;  4C5H A;  4ZN3 A;  3M55 A;  4M7D E;  4MDW A;  5GAN e;  2H3J A;  4LXC A;  1AVZ C;  3MO8 A;  1QQJ A;  4BDY A;  4OMN A;  1S72 A;  1AEY A;  1M2V B;  2ATC B;  4XU1 A;  4ZTJ A;  1O9S A;  1YIJ Q;  2E64 A;  3JCM P;  5J39 A;  1X6O A;  4C0D B;  2EFI A;  4C0Z A;  2E1H A;  4RG8 A;  3QYH B;  1Y0M A;  1KD1 R;  2O9V A;  5ECA A;  1Q7Y R;  1AWX A;  2OJ2 A;  2WSF E;  3M56 A;  5CKE A;  2LQ8 A;  1RAE B;  3FJ5 A;  2CP2 A;  2DZ9 A;  4C92 G;  2RK2 A;  1V1C A;  2D9T A;  4M78 D;  1R0C B;  5GAO m;  1T3S A;  4GLK A;  1C1A A;  3M59 A;  2DEU A;  1P92 A;  2CP5 A;  2C0I A;  3G71 T;  3SB2 A;  5IHN A;  2DO3 A;  2FYK A;  4X9D A;  3X28 B;  4IUQ A;  2GFA A;  2KT8 A;  1ZBJ A;  2AKK A;  5GMK l;  1VQ8 T;  2L0A A;  2EIF A;  1UFF A;  4RTT A;  1D1A A;  3JCM g;  1IHW A;  2EQU A;  1RAG B;  4M4Z A;  4BDZ A;  3KUF A;  1OPL A;  2EYQ A;  3L2U A;  5C6S A;  2P0P A;  3SHW A;  4M7D B;  4BI4 A;  1OUL A;  4OGE A;  1BIB A;  2JNG A;  3G7Z A;  5IAY A;  2HKQ B;  2M9U A;  1VQL T;  3HRT A;  3V8K A;  3G4S A;  4RTZ A;  1BI2 A;  2KEA A;  1JJ2 A;  4DOW A;  1U06 A;  3QJ6 A;  1CSK A;  2HQE A;  4LDY A;  1MUZ A;  2DNU A;  3NFC A;  4LN2 A;  1UHC A;  2JS2 A;  2RHU A;  1K0S A;  3GNF B;  4KUI A;  4TVR A;  2RHX A;  2BE7 D;  2GF7 A;  4J9D A;  1ZLM A;  2DZC A;  2JTF A;  3OYC A;  1M2V A;  1IRE B;  3M58 A;  3F70 A;  3G4S Q;  1KQ2 A;  1WXU A;  1VQN A;  1PWT A;  3MHX A;  3UA6 A;  3DLL A;  3CCL T;  1KC8 U;  2RA2 A;  2LTO A;  1SPK A;  2D0Q B;  3OS5 A;  1GCP A;  1YHQ Q;  4A63 B;  1U8R A;  4B6M A;  3E9F A;  4Q5W A;  1KK7 A;  5GAO q;  2K4Y A;  2QA4 Q;  4FW2 A;  3VJP A;  1K73 U;  1ZUK A;  4ZTF A;  2LJ1 A;  1IGU A;  3L2Q A;  4KT0 E;  2DIQ A;  4XTY A;  2FZG B;  4Y92 A;  1Q86 C;  2JMC A;  2EYW A;  1IB8 A;  2VUB A;  5GAN 8;  1X27 A;  2PTK A;  2X3X D;  2RK1 A;  2OTL T;  1VQN Q;  2DEQ A;  2DIL A;  4O6J A;  5I22 A;  5GAN 6;  2KRO A;  1TXQ A;  2PUK B;  4M75 E;  2NUP A;  3JRZ A;  1BCM A;  2DXU A;  2VGN A;  4RKU E;  4M7A D;  1RAC B;  1VQL Q;  3OYN A;  1RLQ C;  3HSB A;  4PJO F;  2MWO A;  5LJ3 j;  3PGG A;  2FEI A;  2RJE A;  1T3L A;  1TSF A;  1Y71 A;  4F7U E;  4OVA A;  3I35 A;  2D6F A;  5IXB A;  4J6Y A;  4JRK A;  3X20 B;  1I5O B;  1OU8 A;  4M77 C;  4JJN K;  1UG1 A;  1UHF A;  2RN8 A;  2ROL A;  1X69 A;  4IUV A;  4FYV B;  3RKY A;  5GAM g;  4XAX B;  4PK4 A;  4ZGJ B;  4XTV A;  1WJR A;  2IVW A;  4FYX B;  4M77 A;  2LQK A;  2EQK A;  4KUD K;  4E6R A;  4C8Q F;  2RD1 A;  2XI9 A;  3GIB A;  2RQV A;  3JB9 G;  3CBO A;  3RBB B;  4J5Y A;  1GFC A;  2G3R A;  4QW2 A;  5LJ3 g;  1Q82 U;  1VQ9 A;  3UF4 A;  3DB4 A;  3M0P A;  5D6X A;  2ZPG B;  3DKM A;  4RTX A;  2RO0 A;  4JUV A;  1H3H A;  2RH2 A;  4LDU A;  2C06 A;  2FHD A;  2IG0 A;  3PVQ A;  2Y4X A;  1LJO A;  5KH6 A;  2OX7 A;  4E7I A;  3NTH A;  5KYN A;  2QQR A;  2NUT A;  2D8J A;  2M51 A;  3T9N A;  2CUB A;  5LJ5 f;  1QCN A;  3G6E A;  2CP0 A;  3CEY A;  3WVE B;  4LE9 A;  2M0O A;  3A1P A;  1AWJ A;  4M78 F;  1W6X A;  1X2Q A;  1X43 A;  4R0K A;  1KQS P;  1WPY A;  3CC2 Q;  2GTJ A;  3TCJ A;  4M75 B;  1M2O A;  4E7Z A;  4M77 G;  1TUG B;  4LDX A;  3LH0 A;  4BE2 A;  4J6W A;  5FRM A;  4HVV A;  1I0C A;  3CQT A;  2DK3 A;  2L89 A;  2F1L A;  2DF6 A;  2PU9 B;  2RJD A;  2DRK A;  1RAA B;  3CC7 A;  3CCM A;  3N5B B;  1MHN A;  1OX9 A;  2J6K A;  4DBH A;  3CCU T;  3G6E Q;  4F7U B;  5FU6 B;  1N9R A;  1NG2 A;  1WI7 A;  1GBR A;  3S3M A;  1VQO T;  4DBQ A;  4KBM B;  3X26 B;  1SRL A;  1VQP Q;  5HK3 A;  3NMZ C;  4JDS A;  2FPF A;  5EG2 A;  2RI5 A;  3TSW A;  2KAF A;  4L59 A;  1QWF A;  2RHI A;  2C0T A;  1VQ5 T;  3EFS A;  4EMG A;  5J26 A;  4QKU A;  5I2M A;  4C92 E;  3C95 A;  4J9H A;  5KYX B;  1JB0 E;  2BE9 B;  4EMK C;  3CCM Q;  2DBM A;  1M8V A;  3SD4 A;  1LOJ A;  4E7J A;  2JZ2 A;  4FIB A;  4EMK A;  4XK8 E;  2CH4 A;  2G6F X;  1R77 A;  3MP1 A;  2LT1 A;  1JJ2 S;  4N4I A;  2HSE B;  5CQY A;  5DLQ E;  1YJW T;  2D8H A;  1QVF A;  3I5S A;  4ELY C;  1Q81 C;  4M7D D;  1F1B B;  2M0Y A;  2HNI A;  2W10 A;  2HL5 C;  1WNL A;  4HCZ A;  2GTO A;  3CPW P;  2J05 A;  2GGR A;  1YJ9 T;  4CC2 A;  1V29 B;  5IH2 A;  1B3Q A;  4A4H A;  1ZUY A;  3QG1 A;  4K11 A;  2E10 A;  3OYL A;  3HRS A;  1G2B A;  3EG2 A;  3EH1 A;  4X9C A;  4NL3 A;  3JCM h;  4BI8 B;  1K9M U;  2I2L A;  2DA9 A;  1W1F A;  5GMK h;  2KY9 A;  1Q86 U;  3LYI A;  3CCU Q;  2EGC A;  3CCQ T;  1G3Y A;  2ZZD A;  2X9H A;  1LNX A;  1VQM T;  4R55 A;  1VQO Q;  3PVL A;  5FRO A;  4PJO C;  3MKD A;  3VUZ A;  5GAN 3;  4M75 A;  1EIF A;  3ZL7 C;  5CKD A;  2ECZ A;  3FLG A;  1HYO A;  3NTK A;  5I21 A;  3P8B B;  4KUL A;  1VQ4 Q;  1SKU B;  2GQV A;  2HBW A;  1UE9 A;  4VUB A;  4C92 B;  4F7U A;  1NPP A;  4JJC A;  5KYW B;  2EJ9 A;  3CCR T;  2PVO B;  1TUC A;  1OV3 A;  4C8Q C;  1PKS A;  2DL4 A;  4E7H A;  2VC8 A;  2YLC A;  5FWB A;  1B34 A;  3L2V A;  3O8V A;  3V7C A;  3A8L B;  3EG9 B;  3H0H A;  2JVV A;  2LQN A;  2QYZ A;  5EC7 A;  2KGT A;  3CCS Q;  4F17 A;  2DTH A;  3A8O B;  2K5L A;  1N9S A;  4EMH A;  2V1Q A;  1JBM A;  1W2B A;  3RES A;  2DL7 A;  1YWP A;  3EG3 A;  4RTU A;  3PMI A;  3QYG B;  1RLP C;  1PNJ A;  3FRN A;  3L1A A;  4IIO A;  1KHC A;  2RMO A;  1YP5 A;  3CCE A;  5LJ5 j;  3REA B;  1YJ9 Q;  1QCF A;  3OBY A;  3MP6 A;  2L3S A;  2X4J A;  3CC4 T;  1ZSZ C;  4CC7 A;  1YFN A;  4XTU A;  4PJO G;  4L6V 5;  2DXC A;  1YN8 A;  4WTO B;  2EYZ A;  4KGX B;  3MPU B;  1ZSZ A;  2YUP A;  2CT3 A;  4PNO A;  2X3W D;  4OB0 B;  3GF5 A;  2VV5 A;  1YJN T;  1M1K R;  2K7A A;  4JZ3 A;  2LX9 A;  1D1C A;  2DPP B;  3HRU A;  1JO8 A;  1K73 C;  2JM8 A;  3JSC A;  1C0M A;  4J6X A;  3V8J A;  5CK9 A;  3MEU A;  4XTW A;  4C8Q G;  1RI0 A;  2F5K A;  3QWY A;  4A4G A;  1M3B A;  3G1J A;  2HZY A;  1K8A U;  1FXX A;  1B7T A;  2NWM A;  4PJN A;  5FU7 C;  2MYS A;  3E9G A;  4QT7 A;  4II1 A;  5GMK i;  2RJC A;  1K76 A;  3CMA A;  3CCR Q;  1YI2 T;  3SDZ A;  5L23 A;  1XJW B;  3BY7 A;  4C5I A;  2A0F B;  1OPK A;  1HK9 A;  2H3E B;  2X51 A;  2CKK A;  2ROT A;  1S72 T;  5LJ3 h;  1YIJ A;  3J7A F;  2QTV A;  4N4H A;  3EGX A;  1GFD A;  4M75 D;  5CAI A;  4C92 A;  2OTJ T;  1UB4 A;  1WXT A;  2V1R A;  1VQ7 T;  2CZ0 B;  1H3Z A;  5KYW A;  2KK4 A;  1BCO A;  2LNV A;  3JCM e;  1FYN A;  3LWI A;  2YWW A;  4XTZ A;  3ULR B;  3EG9 A;  1G3S A;  2E3I A;  1AZG B;  1I4K 1;  4M77 E;  4HT9 A;  2QG9 B;  5CO7 A;  1Q82 C;  1K0X A;  4ME7 A;  3PIO A;  2DKG A;  3RMS A;  3GOX A;  1YJN Q;  3H8Z A;  2X4X A;  4PKC C;  1BYM A;  2RPN A;  2RHY A;  3HKS A;  5KYY A;  4IUU A;  1Q81 U;  2P0Q A;  2BZX A;  2KXD A;  2IPO B;  1FMV A;  3QZ9 B;  2CT4 A;  2F2W A;  2GQI A;  5GMK m;  4PLL A;  1NYF A;  3HP9 A;  4J83 A;  1QVF S;  4AFQ C;  1Y7X A;  1MMG A;  5GAN 7;  2O88 A;  1MMD A;  3A8H B;  3PNW C;  5CVI A;  2L8D A;  2BZY A;  4MDX A;  2WAC A;  2QDY B;  1PRL C;  3OSV A;  5GMK j;  5LL6 S;  1JEG A;  3CD6 Q;  1GXI E;  3V7S A;  4E7S A;  1UGV A;  2HBP A;  2CZ6 B;  3E2U A;  3I9Q A;  3FIF A;  1YBY A;  1HJD A;  3URG A;  3KBG A;  2NUP B;  1SSF A;  1CKB A;  2ED1 A;  3M4G A;  2RQR A;  2LVM A;  1G3T A;  2AT1 B;  2HQX A;  4GY5 A;  4CRI A;  3S3O A;  2HD0 A;  2KR3 A;  1K9A A;  3BFM A;  3EGU A;  3EH2 A;  3MP8 A;  4BD3 A;  2Z0W A;  2XMF A;  5CIU A;  3I55 Q;  1IO6 A;  3P8H A;  3ZEH A;  3EFO A;  1LCK A;  2K79 A;  4OMQ A;  2R5M A;  5CQX A;  3QKJ A;  2FO0 A;  2LX7 A;  2BIV A;  1YIT T;  4M77 B;  3REB B;  2MCN A;  4MMK A;  3U23 A;  2HEQ A;  2JW4 A;  3UA7 A;  2QEX T;  2RQU A;  3BDU A;  4A4E A;  1YHQ A;  1U5S A;  1NLO C;  4NS5 A;  1OOT A;  3A5Z B;  1W4S A;  4FW1 A;  2QA4 A;  5GAO r;  2DVE A;  2V8K A;  4J9G A;  2DMO A;  1QVG S;  1AWO A;  2QAS A;  2MAM A;  1IHV A;  1XTD A;  4C92 D;  1KJW A;  5KE2 A;  1A0N B;  2NUT B;  1W2B S;  1VQ8 A;  5GAM e;  3HPW A;  2XIC A;  3M0T A;  1QWE A;  3HL8 A;  4AFU C;  1N8R U;  2MK5 A;  2DRM A;  1FX7 A;  2X35 A;  2DIG A;  3EGD A;  4X1V A;  3H9N A;  1D0Y A;  1MND A;  1UGP B;  4QQD A;  4MZP A;  3G71 Q;  1HD3 A;  4DOV A;  3OYK A;  4DEY A;  3R6O A;  5LJ5 d;  3Q1J A;  2CH4 W;  1VQL A;  5I2S A;  1NJI U;  1WA7 A;  1K9M C;  1RUW A;  4PFP A;  4Z02 A;  5D6W A;  1VQ8 Q;  3CCJ T;  4J7F A;  1BBZ A;  4RCC A;  1JJ2 P;  4BE0 A;  3CCV T;  4J9I A;  2EYY A;  3OS0 A;  1YWO A;  4F16 A;  2LT4 A;  1SEM A;  2HL3 A;  3FDR A;  7AT1 B;  3S6W A;  3M0Q A;  4J7I A;  3GBQ A;  2ZPB B;  2C0O A;  2GFU A;  3NTI A;  4PLI A;  2X4Y A;  4PJO E;  1WGS A;  3BE3 A;  3CCL A;  1I81 A;  1IGQ A;  3JB9 I;  1VQ9 T;  2FZK B;  5GAN 5;  3JCM J;  3QXE B;  4EIK A;  2EGE A;  2K5I A;  3QZ5 B;  2FG0 A;  3OYJ A;  1PCX A;  2VGM A;  1BK2 A;  1ABQ A;  1EX4 A;  3M57 A;  1T0J A;  4BY6 B;  4EMK B;  2LJ3 A;  4C8Q E;  2QQ9 A;  1MNE A;  1PHT A;  1M8M A;  1RAH B;  2D0N A;  4HCC A;  1M9S A;  2M02 A;  4A4K A;  2P0K A;  4OB3 B;  4AG1 C;  1WDX A;  3A8M B;  1N27 A;  2DL3 A;  3CCL Q;  3LH5 A;  2CSI A;  4N0A C;  5LJ5 h;  1G83 A;  1KQ1 A;  1IXD A;  2QDL A;  2QTX A;  3CXC A;  3CC2 A;  4YTL A;  2DLP A;  1SRM A;  4AT1 B;  3VS6 A;  2LZ6 B;  4N0A A;  2EGA A;  1HSQ A;  2QQA A;  1QKW A;  2LRQ A;  3H0F A;  1X6B A;  1PSE A;  2E70 A;  1KC8 R;  4ATO A;  2M1H A;  3OMG A;  4LD9 K;  3CCV Q;  4P5N A;  2OTL Q;  2A08 A;  2KRM A;  4JLG A;  1K73 R;  2EQI A;  2DL5 A;  1VQP A;  1KD1 C;  3I56 T;  3D7S B;  3M54 A;  1GRI A;  1RAF B;  1Q7Y C;  4DQ2 A;  3CME T;  1K8A C;  2RB6 A;  4QQ6 A;  1MV3 A;  4GBQ A;  1EFN A;  4QQG A;  2LCS A;  1OQK A;  4PJO B;  5L8R E;  3QDF A;  3EHQ A;  4O5V A;  2A7Y A;  2RHZ A;  2GNC A;  4OGC A;  3L2R A;  1I1J A;  1ZSG A;  1YCS B;  4D8K A;  4Z88 A;  2EJF A;  1RAI B;  1PSF A;  2HKN A;  1VQK T;  1SHF A;  2E6Z A;  1B34 B;  2RQT A;  3S3N A;  2DET A;  2R58 A;  1TUD A;  2GBQ A;  4HCB A;  3JB9 D;  5HCK A;  4KGZ B;  4C8Q B;  3OMC A;  3H41 A; 
#chains in the Genus database with same CATH homology
 1UGQ B;  3PMI A;  3QYG B;  1Y07 A;  2XU8 A;  1X01 A;  2P4T A;  3C12 A;  3FRN A;  3QII A;  3L1A A;  2YRV A;  1KHC A;  3ZBD A;  4R56 A;  1XOV A;  2A3L A;  3CCE A;  5LJ5 j;  5GAN d;  2WSF E;  3OBY A;  3UPU A;  1TH7 A;  3M56 A;  3MP6 A;  4BY6 C;  2X4J A;  2LQ8 A;  5CKE A;  5HKC A;  3CC4 T;  4XTU A;  2DZ9 A;  4PJO G;  4L6V 5;  4C92 G;  2R57 A;  2RK2 A;  2D9T A;  4M78 D;  2DXC A;  1HXD A;  3OYE A;  5GAO m;  5GAM j;  4A4F A;  4GLK A;  1KHI A;  2O01 E;  5CKB A;  1MGQ A;  3M59 A;  2DAQ A;  3CC2 T;  1P92 A;  4M75 F;  4PNO A;  4OB0 B;  3GF5 A;  5KCO A;  3PTA A;  2VV5 A;  2VYT A;  3OSS C;  3QHS A;  3SB2 A;  4C0G A;  3G71 T;  1BIA A;  3LW5 E;  4JS5 A;  1YJN T;  3QSU A;  2DO3 A;  2LX9 A;  3PIP A;  3CCU A;  2FYK A;  4X9D A;  2DPP B;  3HRU A;  3OYG A;  1WJS A;  3CCJ A;  1WQ7 A;  3X28 B;  1K73 C;  4UC4 A;  1VQO A;  2AHJ B;  3JSC A;  4IUQ A;  1WJQ A;  4FU6 A;  4J6X A;  3V8J A;  2GFA A;  4M7D C;  5CK9 A;  4RG2 A;  2XG8 D;  1QP2 A;  1I8F A;  3MEU A;  4XTW A;  4C8Q G;  4F7U F;  3G6E T;  1KQS A;  5GMK l;  4M77 D;  3CCV A;  2OTL A;  1RI0 A;  2F5K A;  1VQ8 T;  5GAN 4;  2PQW A;  2EIF A;  2K3Y A;  1VQ6 T;  4A4G A;  3EFR A;  3JCM g;  2EQU A;  1K8A U;  1M90 U;  1VQP T;  1FXX A;  4M7D A;  4BDZ A;  3KUF A;  2EYQ A;  5FU7 C;  1VQ5 A;  3E9G A;  4ELZ C;  3OYF A;  3L2U A;  5C6S A;  2P0P A;  4RMO A;  4II1 A;  4QVC A;  5GMK i;  1VQ4 A;  1ZBX A;  2RJC A;  1UEB A;  4OP0 A;  4OMF B;  3CMA A;  3OYM A;  2JOY A;  3X25 B;  4M7D B;  4BI4 A;  4JRQ A;  1JRI A;  1YI2 T;  3SDZ A;  4OGE A;  1BIB A;  2JNG A;  3BY7 A;  3G7Z A;  2QQB A;  4IUT A;  5IAY A;  4C5I A;  2M9U A;  1VQL T;  3HRT A;  3V8K A;  1HK9 A;  2CGH A;  3G4S A;  3INZ A;  3CC7 T;  3LGF A;  5IN1 A;  3CCM T;  1WQW A;  2CKK A;  1BI2 A;  1S72 T;  1JJ2 A;  5FU7 B;  2DTO A;  2XKO C;  4DOW A;  3EAE A;  3OW2 S;  5LJ3 h;  4FT2 A;  1U1T A;  2X4W A;  4M78 E;  1YIJ A;  3GNG A;  3QJ6 A;  3J7A F;  2HQE A;  1M5Q 1;  4LDY A;  4N4H A;  2F69 A;  3CBM A;  3NFC A;  3CCS A;  2QQS A;  1YJW A;  3E19 A;  4M75 D;  5CAI A;  2DD5 A;  2RHU A;  2XK0 A;  3QO3 A;  4C92 A;  4QVD A;  3GNF B;  1UB4 A;  4KUI A;  5GAN h;  4PJO A;  1NE8 A;  2OTJ T;  1VQ7 T;  4TVR A;  2CZ0 B;  2CYZ B;  1VIF A;  2RHX A;  2GF7 A;  3MEW A;  5DM7 R;  1H3Z A;  2KK4 A;  2QI2 A;  1OYX A;  3LX7 A;  2LNV A;  5KE3 A;  4M7A F;  2DZC A;  3JCM e;  2JTF A;  5CCA A;  3OYC A;  3C94 A;  3LWI A;  4XTZ A;  3FC3 A;  4OB1 B;  1IRE B;  3M58 A;  1YJ9 A;  3ME9 A;  3F70 A;  2E6N A;  1G3S A;  4EPC A;  5A0D A;  1KQ2 A;  4M7D G;  2MWP A;  1I4K 1;  2EQM A;  4FL6 A;  4M77 E;  1N6A A;  5GAN f;  1VQN A;  3MHX A;  3MET A;  4HT9 A;  5CO7 A;  1H64 1;  3DLL A;  3CCL T;  1KC8 U;  2RA2 A;  1Q82 C;  2LTO A;  4MZM A;  4ME7 A;  3PIO A;  4HT8 A;  2JN0 A;  2PUO B;  2D0Q B;  3OS5 A;  2DKG A;  3RMS A;  3GOX A;  1U8R A;  1QVG A;  3H8Z A;  4C8Q A;  2X4X A;  3E9F A;  4NOY A;  4PKC C;  1BYM A;  4Q5W A;  4XU3 A;  2WSE E;  5GAO q;  2RHY A;  3HKS A;  2K4Y A;  4IUU A;  3VJP A;  1K73 U;  4ZTF A;  1Q81 U;  1NPR A;  2P0Q A;  2DXB A;  3L2Q A;  4KT0 E;  2K57 A;  3UDC A;  2DIQ A;  3MEV A;  4XTY A;  3GLX A;  3QZ9 B;  2RM4 A;  3HFN A;  3JCM d;  1Q86 C;  3A8G B;  3ER0 A;  3OBW A;  5GAM d;  4OF1 A;  4IUP A;  3CPW A;  2VUB A;  4XTX A;  5GAN 8;  5GMK m;  4PLL A;  3RMQ A;  4HKE A;  4BI3 A;  3RUX A;  3HP9 A;  1OZ2 A;  4J83 A;  1QVF S;  1Y7X A;  1D3B A;  1ZHI A;  2EJG A;  3I56 A;  3TEE A;  2FVU A;  5GAN 7;  1BI1 A;  1XNI A;  2RK1 A;  4FM4 B;  2DTI A;  3A8H B;  3LWH A;  4D6W A;  2OTL T;  3PNW C;  5CVI A;  3TRE A;  2KVQ G;  1AHJ B;  2L8D A;  2DEQ A;  3M5A A;  3CME A;  4O6J A;  2MI6 A;  4Y91 A;  4MDX A;  2WAC A;  4M78 C;  5GAN 6;  2QDY B;  1BI0 A;  5M9O A;  1N8R C;  1D3B B;  3P8D A;  3OSV A;  5GMK j;  3JCM W;  5LL6 S;  2PUK B;  3BDL A;  2XID A;  4M75 E;  3H6Z A;  1GXI E;  3V7S A;  2HBP A;  3JRZ A;  5FLX E;  3CCR A;  2CZ6 B;  2DXU A;  2VGN A;  3LGL A;  3OYI A;  4RKU E;  3CXC S;  1VQ4 T;  4M7A D;  3OYN A;  3CMA T;  3FIF A;  5GAO n;  4M78 A;  3HSB A;  3UT1 A;  1VIE A;  2RJF A;  1YBY A;  4PJO F;  4C92 F;  3URG A;  3KBG A;  2MWO A;  5LJ3 j;  3PGG A;  1SSF A;  2V8I A;  4ZGD B;  2LC4 A;  2RJE A;  3OYH A;  3MCA B;  3MEA A;  2XDB A;  3M4G A;  2LVM A;  1G3T A;  2HQX A;  1NJI C;  4GY5 A;  5LJ5 g;  4CRI A;  1Y71 A;  4L5G A;  4M78 B;  4F7U E;  2EKO A;  4LDV A;  1KD1 U;  4OVA A;  3S3O A;  2D6F A;  1M4Z A;  4J6Y A;  4JRK A;  2HD0 A;  4BD3 A;  3BFM A;  5CKF A;  3MP8 A;  3X20 B;  5CIU A;  4JJN K;  4M77 C;  1Q7Y U;  4JLI A;  1YIJ T;  1M1G A;  3P8H A;  4IUV A;  2EAY A;  2XDP A;  1ZQ1 A;  3RKY A;  3ZEH A;  1Y96 B;  3X24 B;  5GAM g;  3CCS T;  4XAX B;  1I5L A;  4ZGJ B;  4XTV A;  1WJR A;  4EDU A;  2CZ7 B;  2IVW A;  4ZN1 A;  4LDW A;  4M77 A;  2LQK A;  2EQK A;  2R5M A;  5CQX A;  4KUD K;  3QKJ A;  4C8Q F;  2RD1 A;  2XI9 A;  3GIB A;  3JB9 G;  3CBO A;  2JUF A;  3JCM b;  2BIV A;  4J5Y A;  2MF2 A;  2G3R A;  4QW2 A;  5LJ3 g;  1Q82 U;  1VQ9 A;  1YIT T;  4FSX A;  4M77 B;  3DB4 A;  3PT9 A;  5D6X A;  5J3B A;  3JCM V;  1M1K U;  2F5T X;  2ZPG B;  4MMK A;  3RIR A;  3DKM A;  2RO0 A;  4JUV A;  2RH2 A;  4LDU A;  2QEX T;  2C06 A;  4PL6 A;  3BDU A;  4A4E A;  2KQW A;  4N4G A;  2FHD A;  1G3W A;  1YJN A;  1YHQ A;  2L5Q A;  3JB9 F;  2O4X B;  4NS5 A;  2IG0 A;  2Y4X A;  4M78 G;  3A5Z B;  1LJO A;  1W4S A;  3OYY A;  5KH6 A;  5LJ5 e;  4E7I A;  3NTH A;  2QA4 A;  2QQR A;  5GAO r;  2DVE A;  2V8K A;  4NL2 A;  4BUG A;  3RER A;  4M75 C;  3T9N A;  4A54 A;  3CPF A;  1QVG S;  1FWZ A;  2RI2 A;  5LJ5 f;  4M7A E;  3DB3 A;  2MAM A;  1VUB A;  1XTD A;  4C92 D;  3L2Z A;  4PJO D;  3G6E A;  2KDS A;  4XU0 A;  3CEY A;  3PFS A;  3WVE B;  5KE2 A;  1W2B S;  5GAM e;  1VQ8 A;  1X75 C;  2KSS A;  2CZ1 B;  2LDM A;  2M0O A;  3HPW A;  4HA8 A;  5GMK e;  3JCM f;  3J80 E;  2XIC A;  3JB9 J;  3HL8 A;  3QDR B;  4M78 F;  5GAM f;  3GP8 A;  3CCE T;  1N8R U;  3HFO A;  3SWN C;  3GPL A;  2XDD A;  3JB9 H;  1FX7 A;  2X35 A;  2DIG A;  1WPY A;  2YHT A;  5FU6 C;  3JCM Q;  3QBY A;  3TCJ A;  4M75 B;  1UGP B;  4M77 G;  4QQD A;  4LDX A;  3LH0 A;  3BW1 A;  4BE2 A;  4MZP A;  4J6W A;  5FRM A;  4DOV A;  1YI2 A;  3L42 A;  3OYK A;  1VQK A;  2FB7 A;  3CD6 A;  3VYG A;  1BKB A;  3SWN A;  2DK3 A;  2L89 A;  3ASK A;  2GCX A;  3R6O A;  3AHU A;  5LJ5 d;  3CCQ A;  2PU9 B;  2RJD A;  3OS2 A;  4A53 A;  3Q1J A;  3OQ5 A;  5AYF A;  1OZ3 A;  4Y28 E;  1VQL A;  4C8Q D;  2PVG B;  5I2S A;  3OW2 A;  3CC7 A;  1VQM A;  1NJI U;  4M7D F;  1K9M C;  1XQH A;  2DD4 A;  3RKW A;  3CCM A;  3N5B B;  1MHN A;  4V2S A;  3SWN B;  2VXE A;  3CCU T;  4B9X A;  4Z02 A;  5D6W A;  2LCL A;  4F7U B;  3E1S A;  4M77 F;  5FU6 B;  5CR2 A;  4E7K A;  3CCJ T;  2Y4Y A;  1N9R A;  1O75 A;  3S3M A;  1VQO T;  3M53 A;  4J7F A;  1NZ9 A;  5IT9 E;  4KBM B;  3TU4 K;  4RCC A;  3X26 B;  2RI3 A;  2BUD A;  4BE0 A;  4JRP A;  5HK3 A;  2BKD N;  3CCV T;  3JAM E;  3I55 A;  2OTJ A;  1M1F A;  2VXF A;  1VQ7 A;  3OS0 A;  4JDS A;  2XHC A;  5EG2 A;  1UGR B;  1KQS S;  2RI5 A;  1R8O B;  2LT4 A;  5LJ3 d;  2KAF A;  3PMT A;  3M4Y A;  4L59 A;  3WVD B;  2RHI A;  3FDR A;  1VQ5 T;  3S6W A;  4BAC A;  3EFS A;  1QW1 A;  2ZPF B;  4J7I A;  2ZPB B;  5J26 A;  4EMG A;  3JCM X;  2DJZ A;  2GFU A;  2XD0 A;  3QJY A;  1OI1 A;  3NTI A;  4M75 G;  5I2M A;  5DLO A;  4PLI A;  2X4Y A;  4BB7 A;  4C92 E;  4PJO E;  4E7L A;  3CBP A;  1WGS A;  4M7A C;  3C95 A;  1JB0 E;  2PVD B;  1RL2 A;  4LD6 A;  2DXT A;  2WSC E;  4EMK C;  3RKX A;  1BI3 A;  3CCL A;  1M8V A;  1I81 A;  2ZPH B;  3JB9 I;  4QVZ A;  3KXT A;  3V8L A;  1VQ9 T;  3SD4 A;  1LOJ A;  2M16 A;  3J81 E;  5GAN 5;  3JCM J;  4C0F A;  3QPH A;  3QXE B;  3G4S T;  4JS4 A;  4J8O A;  5HK0 A;  4E7J A;  1Y96 A;  2K5I A;  3QZ5 B;  4IUR A;  3VUB A;  2JZ2 A;  4M7A A;  1YCY A;  4FIB A;  3OYJ A;  4EMK A;  5GAN j;  2VGM A;  5D6Y A;  5GAO p;  4XK8 E;  4F7U G;  3OYA A;  1KC8 C;  2YLB A;  4ZGE B;  2KMT A;  3MP1 A;  2LT1 A;  3OB9 A;  1YHQ T;  1JJ2 S;  4N4I A;  2B8A A;  3WXM B;  5CQY A;  3FEO A;  2L3R A;  3M57 A;  5DLQ E;  4M7A B;  3SFM A;  3OS1 A;  1YJW T;  4BY6 B;  4EMK B;  2QA4 T;  1QVF A;  4C8Q E;  2QQ9 A;  4ELY C;  4WF2 A;  3VU3 C;  5C0M A;  1Q81 C;  2ZPE B;  4IKF A;  4M7D D;  3DLM A;  2HNI A;  2OAU A;  4HCC A;  5GAN 2;  3CC4 A;  1M9S A;  1WNL A;  2ZCF B;  4A4K A;  5CKH A;  3OYB A;  3VV0 A;  2P0K A;  4OB3 B;  1VQ6 A;  2E12 A;  4JRI A;  5HY6 A;  3JCM c;  3A8M B;  1N27 A;  4HCZ A;  3ZFJ A;  4N0A C;  1YJ9 T;  2E5Q A;  5A2Q E;  1V29 B;  4MML A;  2O4X A;  5LJ5 h;  1KQ1 A;  2QTX A;  3VKI A;  3CXC A;  4A4H A;  3CC2 A;  1VQN T;  4B9W A;  3QG1 A;  4X34 A;  4YTL A;  2E10 A;  5GAO l;  5GAN g;  3OYL A;  3OA6 A;  3HRS A;  4NL3 A;  4X9C A;  2JTM A;  4CI0 C;  4FT4 A;  3FJP A;  3JCM h;  3G71 A;  4N0A A;  4BI8 B;  1K9M U;  2I2L A;  5A0L A;  5GAM h;  4C5G A;  5FRN A;  5GMK h;  3CD6 T;  2QQA A;  2KY9 A;  1Q86 U;  3LYI A;  2LRQ A;  2QXF A;  3CCQ T;  1PSE A;  2E70 A;  1G3Y A;  3FB9 A;  2ZZD A;  4ATO A;  1LNX A;  1VQM T;  4R55 A;  5DY9 A;  2M1H A;  5FRO A;  3OYD A;  4C92 C;  4M7A G;  4PJO C;  3OMG A;  4RCB A;  4LD9 K;  2V8J A;  2K5F A;  4BE1 A;  5A0G A;  3V7R A;  3VUZ A;  4P5N A;  2EQJ A;  3VYH B;  5GAN 3;  4M75 A;  1EIF A;  2FL7 A;  3QUI A;  4JLG A;  2CS7 A;  5CKD A;  1VQP A;  1KD1 C;  1QVP A;  2NLU A;  3FLG A;  3L2W A;  3I56 T;  3LLR A;  2ZPI B;  3CPW S;  3M54 A;  4MZT A;  2EWN A;  2LCC A;  3I55 T;  3C4S A;  3NTK A;  5KCH A;  2K3X A;  3HHT B;  3P8B B;  4DQ2 A;  5I21 A;  3CME T;  1Q7Y C;  4E47 A;  5LJ3 e;  4DA4 A;  1QP3 A;  2E65 A;  1UGS B;  4KUL A;  1KG1 A;  1K8A C;  1M90 C;  2MMP A;  2GQV A;  2RB6 A;  4QQ6 A;  4C0D C;  3OY9 A;  3M9Q A;  5LJ3 f;  4QQG A;  4VUB A;  4C92 B;  4PJO B;  5L8R E;  4XU2 A;  3UWN A;  4F7U A;  2ZGW A;  1NPP A;  1YIT A;  4C5H A;  4O5V A;  4ZN3 A;  2A7Y A;  3M55 A;  2RHZ A;  2EJ9 A;  4M7D E;  3CCR T;  4MDW A;  5GAN e;  2PVO B;  2H3J A;  4OGC A;  1U1S A;  4C8Q C;  3L2R A;  4BDY A;  3MO8 A;  4E7H A;  2QEX A;  1S72 A;  2VC8 A;  2YLC A;  3L2V A;  1B34 A;  3O8V A;  4XU1 A;  2HAX A;  1DJ7 B;  1IZ6 A;  4ZTJ A;  2EJF A;  3V7C A;  1M1K C;  1O9S A;  3A8L B;  1PSF A;  2JVV A;  2R5A A;  1VQK T;  2E64 A;  2E6Z A;  3JCM P;  5J39 A;  1X6O A;  1B34 B;  4C0D B;  3S3N A;  2DTH A;  3A8O B;  2E41 A;  2K5L A;  1N9S A;  4EMH A;  2R58 A;  4HCB A;  1JBM A;  4XQ3 A;  3JB9 D;  3RES A;  2EFI A;  1W2B A;  1G5V A;  4C0Z A;  4OB2 B;  2E1H A;  4C5E A;  4C8Q B;  3OMC A;  4RG8 A;  3QYH B;  2Y90 A;  2K2V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...