4MATA

E.coli methionine aminopeptidase his79ala mutant
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
271
structure length
271
Chain Sequence
AISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGQGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISHDELVPRGSLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Escherichia coli methionine aminopeptidase: implications of crystallographic analyses of the native, mutant, and inhibited enzymes for the mechanism of catalysis.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords PROTEIN (METHIONINE AMINOPEPTIDASE)
total genus 89
structure length 271
sequence length 271
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 1999-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 4matA00
4IDYA 2BWWA 2ZSGA 4IKTA 2Q95A 1YJ3A 1XGSA 1Y1NA 1R5GA 3FMRA 2HOWA 1W7VA 3PKDA 4IPAA 2EA2A 4RZYA 1WY2A 5CNXA 1YW7A 5E5BA 2BHBA 4U75A 1WBQA 5JFRA 1B6AA 2GG8A 1R58A 2GU4A 2V3XA 5CDLA 3IG4A 2BHAA 5CDVA 4U6JA 1C23A 4U70A 2B3HA 4U6ZA 4JUQA 1WLRA 1KQ0A 5CE6A 3FM3A 2BN7A 3PKCA 4IKRA 4QR8A 1QXWA 2BB7A 3BIPA 1C22A 3BIQA 2G6PA 2BWTA 3PKAA 4EGEA 2B3LA 1R5HA 4ZWPA 2P9AA 4FKCA 4HXXA 1N51A 1YVMA 3D27A 1KP0A 3L7GA 5CLSA 4IKUA 1BOAA 2NQ6A 3MX6A 1WL6A 4U69A 3TAVA 4OOKA 1O0XA 3BITA 3PKBA 4FLLA 1WL9A 4FO7A 4FO8A 2GZ5A 4PV4A 5D6FA 1C21A 1JAWA 2GGBA 3PKEA 2GG7A 3IU7A 1QXYA 2BHDA 4ZWUA 4U71A 4ZNGA 4S2TP 1WKMA 2BWUA 1QXZA 4U6CA 2P99A 2GG9A 4B28A 4IECA 4U73A 4S00A 1PV9A 4S2RP 2BH3A 4IF7A 2EVOA 3CTZA 2BWSA 1YW8A 2GGCA 1QZYA 3TB5A 2GTXA 5CIKA 2EVMA 4RGZ1 4U1BA 1XGMA 2Q94A 3RVAA 4U76A 2Q93A 3MATA 2GA2A 2V3YA 4IU6A 4U6WA 1XNZA 3IU9A 2Q96A 2Q8KA 1C24A 4A6VA 2GG2A 4U6EA 4S01A 4A6WA 4PNCA 1XGNA 1YW9A 4Z7MA 2Q92A 3IU8A 4KM3A 2DFIA 3FMQA 3Q6DA 1M35A 2IW2A 4R60A 1BN5A 4FLKA 1MATA 2V6CA 1A16A 2BWYA 2GU7A 2P98A 4RZZA 2GU6A 2EVCA 2OKNA 2GG0A 3CB6A 2BHCA 4IKSA 2B3KA 5D6EA 3MR1A 2BWXA 2EA4A 4FLJA 5CDEA 3L24A 1C27A 2OAZA 5JHUA 5FCHA 1W2MA 2BWVA 5FCFA 1B59A 2NQ7A 1CHMA 2V3ZA 1WN1A 3RORA 4ZWOA 2GU5A 4MATA 2GG5A 4FUKA 1KQ9A 1XGOA 2GG3A 3CB5A 4FLIA 5JI6A 2ADUA 3S6BA 2MATA
chains in the Genus database with same CATH superfamily
4IDYA 2BWWA 2ZSGA 4IKTA 2Q95A 1YJ3A 1XGSA 1Y1NA 1R5GA 3FMRA 2HOWA 1W7VA 3PKDA 4IPAA 2EA2A 4RZYA 1WY2A 5CNXA 1YW7A 5E5BA 2BHBA 4U75A 1WBQA 5JFRA 1B6AA 2GG8A 1R58A 2GU4A 2V3XA 5CDLA 3IG4A 2BHAA 5CDVA 4U6JA 1C23A 4U70A 2B3HA 4U6ZA 4JUQA 1WLRA 1KQ0A 5CE6A 3FM3A 2BN7A 3PKCA 4IKRA 4QR8A 1QXWA 2BB7A 3BIPA 1C22A 3BIQA 2G6PA 2BWTA 3PKAA 4EGEA 2B3LA 1R5HA 4ZWPA 2P9AA 4FKCA 4HXXA 1N51A 1YVMA 3D27A 1KP0A 3L7GA 5CLSA 4IKUA 1BOAA 2NQ6A 3MX6A 1WL6A 4U69A 3TAVA 4OOKA 1O0XA 3BITA 3PKBA 4FLLA 1WL9A 4FO7A 4FO8A 2GZ5A 4PV4A 5D6FA 1C21A 1JAWA 2GGBA 3PKEA 2GG7A 3IU7A 1QXYA 2BHDA 4ZWUA 4U71A 4ZNGA 4S2TP 1WKMA 2BWUA 1QXZA 4U6CA 2P99A 2GG9A 4B28A 4IECA 4U73A 4S00A 1PV9A 4S2RP 2BH3A 4IF7A 2EVOA 3CTZA 2BWSA 1YW8A 2GGCA 1QZYA 3TB5A 2GTXA 5CIKA 2EVMA 4RGZ1 4U1BA 1XGMA 2Q94A 3RVAA 4U76A 2Q93A 3MATA 2GA2A 2V3YA 4IU6A 4U6WA 1XNZA 3IU9A 2Q96A 2Q8KA 1C24A 4A6VA 2GG2A 4U6EA 4S01A 4A6WA 4PNCA 1XGNA 1YW9A 4Z7MA 2Q92A 3IU8A 4KM3A 2DFIA 3FMQA 3Q6DA 1M35A 2IW2A 4R60A 1BN5A 4FLKA 1MATA 2V6CA 1A16A 2BWYA 2GU7A 2P98A 4RZZA 2GU6A 2EVCA 2OKNA 2GG0A 3CB6A 2BHCA 4IKSA 2B3KA 5D6EA 3MR1A 2BWXA 2EA4A 4FLJA 5CDEA 3L24A 1C27A 2OAZA 5JHUA 5FCHA 1W2MA 2BWVA 5FCFA 1B59A 2NQ7A 1CHMA 2V3ZA 1WN1A 3RORA 4ZWOA 2GU5A 4MATA 2GG5A 4FUKA 1KQ9A 1XGOA 2GG3A 3CB5A 4FLIA 5JI6A 2ADUA 3S6BA 2MATA
chains in the Genus database with same CATH topology
4IDYA 2BWWA 2ZSGA 4IKTA 2Q95A 1YJ3A 1XGSA 1Y1NA 1R5GA 3FMRA 2HOWA 1W7VA 3PKDA 4IPAA 2EA2A 4RZYA 1WY2A 5CNXA 1YW7A 5E5BA 2BHBA 4U75A 1WBQA 5JFRA 1B6AA 2GG8A 1R58A 2GU4A 2V3XA 5CDLA 3IG4A 2BHAA 5CDVA 4U6JA 1C23A 4U70A 2B3HA 4U6ZA 4JUQA 1WLRA 1KQ0A 5CE6A 3FM3A 2BN7A 3PKCA 4IKRA 4QR8A 1QXWA 2BB7A 3BIPA 1C22A 3BIQA 2G6PA 2BWTA 3PKAA 4EGEA 2B3LA 1R5HA 4ZWPA 2P9AA 4FKCA 4HXXA 1N51A 1YVMA 3D27A 1KP0A 3L7GA 5CLSA 4IKUA 1BOAA 2NQ6A 3MX6A 1WL6A 4U69A 3TAVA 4OOKA 1O0XA 3BITA 3PKBA 4FLLA 1WL9A 4FO7A 4FO8A 2GZ5A 4PV4A 5D6FA 1C21A 1JAWA 2GGBA 3PKEA 2GG7A 3IU7A 1QXYA 2BHDA 4ZWUA 4U71A 4ZNGA 4S2TP 1WKMA 2BWUA 1QXZA 4U6CA 2P99A 2GG9A 4B28A 4IECA 4U73A 4S00A 1PV9A 4S2RP 2BH3A 4IF7A 2EVOA 3CTZA 2BWSA 1YW8A 2GGCA 1QZYA 3TB5A 2GTXA 5CIKA 2EVMA 4RGZ1 4U1BA 1XGMA 2Q94A 3RVAA 4U76A 2Q93A 3MATA 2GA2A 2V3YA 4IU6A 4U6WA 1XNZA 3IU9A 2Q96A 2Q8KA 1C24A 4A6VA 2GG2A 4U6EA 4S01A 4A6WA 4PNCA 1XGNA 1YW9A 4Z7MA 2Q92A 3IU8A 4KM3A 2DFIA 3FMQA 3Q6DA 1M35A 2IW2A 4R60A 1BN5A 4FLKA 1MATA 2V6CA 1A16A 2BWYA 2GU7A 2P98A 4RZZA 2GU6A 2EVCA 2OKNA 2GG0A 3CB6A 2BHCA 4IKSA 2B3KA 5D6EA 3MR1A 2BWXA 2EA4A 4FLJA 5CDEA 3L24A 1C27A 2OAZA 5JHUA 5FCHA 1W2MA 2BWVA 5FCFA 1B59A 2NQ7A 1CHMA 2V3ZA 1WN1A 3RORA 4ZWOA 2GU5A 4MATA 2GG5A 4FUKA 1KQ9A 1XGOA 2GG3A 3CB5A 4FLIA 5JI6A 2ADUA 3S6BA 2MATA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IDY A;  2BWW A;  2ZSG A;  4IKT A;  2Q95 A;  1YJ3 A;  1XGS A;  1Y1N A;  1R5G A;  3FMR A;  2HOW A;  1W7V A;  3PKD A;  4IPA A;  2EA2 A;  4RZY A;  1WY2 A;  5CNX A;  1YW7 A;  5E5B A;  2BHB A;  4U75 A;  1WBQ A;  5JFR A;  1B6A A;  2GG8 A;  1R58 A;  2GU4 A;  2V3X A;  5CDL A;  3IG4 A;  2BHA A;  5CDV A;  4U6J A;  1C23 A;  4U70 A;  2B3H A;  4U6Z A;  4JUQ A;  1WLR A;  1KQ0 A;  5CE6 A;  3FM3 A;  2BN7 A;  3PKC A;  4IKR A;  4QR8 A;  1QXW A;  2BB7 A;  3BIP A;  1C22 A;  3BIQ A;  2G6P A;  2BWT A;  3PKA A;  4EGE A;  2B3L A;  1R5H A;  4ZWP A;  2P9A A;  4FKC A;  4HXX A;  1N51 A;  1YVM A;  3D27 A;  1KP0 A;  3L7G A;  5CLS A;  4IKU A;  1BOA A;  2NQ6 A;  3MX6 A;  1WL6 A;  4U69 A;  3TAV A;  4OOK A;  1O0X A;  3BIT A;  3PKB A;  4FLL A;  1WL9 A;  4FO7 A;  4FO8 A;  2GZ5 A;  4PV4 A;  5D6F A;  1C21 A;  1JAW A;  2GGB A;  3PKE A;  2GG7 A;  3IU7 A;  1QXY A;  2BHD A;  4ZWU A;  4U71 A;  4ZNG A;  4S2T P;  1WKM A;  2BWU A;  1QXZ A;  4U6C A;  2P99 A;  2GG9 A;  4B28 A;  4IEC A;  4U73 A;  4S00 A;  1PV9 A;  4S2R P;  2BH3 A;  4IF7 A;  2EVO A;  3CTZ A;  2BWS A;  1YW8 A;  2GGC A;  1QZY A;  3TB5 A;  2GTX A;  5CIK A;  2EVM A;  4RGZ 1;  4U1B A;  1XGM A;  2Q94 A;  3RVA A;  4U76 A;  2Q93 A;  3MAT A;  2GA2 A;  2V3Y A;  4IU6 A;  4U6W A;  1XNZ A;  3IU9 A;  2Q96 A;  2Q8K A;  1C24 A;  4A6V A;  2GG2 A;  4U6E A;  4S01 A;  4A6W A;  4PNC A;  1XGN A;  1YW9 A;  4Z7M A;  2Q92 A;  3IU8 A;  4KM3 A;  2DFI A;  3FMQ A;  3Q6D A;  1M35 A;  2IW2 A;  4R60 A;  1BN5 A;  4FLK A;  1MAT A;  2V6C A;  1A16 A;  2BWY A;  2GU7 A;  2P98 A;  4RZZ A;  2GU6 A;  2EVC A;  2OKN A;  2GG0 A;  3CB6 A;  2BHC A;  4IKS A;  2B3K A;  5D6E A;  3MR1 A;  2BWX A;  2EA4 A;  4FLJ A;  5CDE A;  3L24 A;  1C27 A;  2OAZ A;  5JHU A;  5FCH A;  1W2M A;  2BWV A;  5FCF A;  1B59 A;  2NQ7 A;  1CHM A;  2V3Z A;  1WN1 A;  3ROR A;  4ZWO A;  2GU5 A;  4MAT A;  2GG5 A;  4FUK A;  1KQ9 A;  1XGO A;  2GG3 A;  3CB5 A;  4FLI A;  5JI6 A;  2ADU A;  3S6B A;  2MAT A; 
#chains in the Genus database with same CATH topology
 4IDY A;  2BWW A;  2ZSG A;  4IKT A;  2Q95 A;  1YJ3 A;  1XGS A;  1Y1N A;  1R5G A;  3FMR A;  2HOW A;  1W7V A;  3PKD A;  4IPA A;  2EA2 A;  4RZY A;  1WY2 A;  5CNX A;  1YW7 A;  5E5B A;  2BHB A;  4U75 A;  1WBQ A;  5JFR A;  1B6A A;  2GG8 A;  1R58 A;  2GU4 A;  2V3X A;  5CDL A;  3IG4 A;  2BHA A;  5CDV A;  4U6J A;  1C23 A;  4U70 A;  2B3H A;  4U6Z A;  4JUQ A;  1WLR A;  1KQ0 A;  5CE6 A;  3FM3 A;  2BN7 A;  3PKC A;  4IKR A;  4QR8 A;  1QXW A;  2BB7 A;  3BIP A;  1C22 A;  3BIQ A;  2G6P A;  2BWT A;  3PKA A;  4EGE A;  2B3L A;  1R5H A;  4ZWP A;  2P9A A;  4FKC A;  4HXX A;  1N51 A;  1YVM A;  3D27 A;  1KP0 A;  3L7G A;  5CLS A;  4IKU A;  1BOA A;  2NQ6 A;  3MX6 A;  1WL6 A;  4U69 A;  3TAV A;  4OOK A;  1O0X A;  3BIT A;  3PKB A;  4FLL A;  1WL9 A;  4FO7 A;  4FO8 A;  2GZ5 A;  4PV4 A;  5D6F A;  1C21 A;  1JAW A;  2GGB A;  3PKE A;  2GG7 A;  3IU7 A;  1QXY A;  2BHD A;  4ZWU A;  4U71 A;  4ZNG A;  4S2T P;  1WKM A;  2BWU A;  1QXZ A;  4U6C A;  2P99 A;  2GG9 A;  4B28 A;  4IEC A;  4U73 A;  4S00 A;  1PV9 A;  4S2R P;  2BH3 A;  4IF7 A;  2EVO A;  3CTZ A;  2BWS A;  1YW8 A;  2GGC A;  1QZY A;  3TB5 A;  2GTX A;  5CIK A;  2EVM A;  4RGZ 1;  4U1B A;  1XGM A;  2Q94 A;  3RVA A;  4U76 A;  2Q93 A;  3MAT A;  2GA2 A;  2V3Y A;  4IU6 A;  4U6W A;  1XNZ A;  3IU9 A;  2Q96 A;  2Q8K A;  1C24 A;  4A6V A;  2GG2 A;  4U6E A;  4S01 A;  4A6W A;  4PNC A;  1XGN A;  1YW9 A;  4Z7M A;  2Q92 A;  3IU8 A;  4KM3 A;  2DFI A;  3FMQ A;  3Q6D A;  1M35 A;  2IW2 A;  4R60 A;  1BN5 A;  4FLK A;  1MAT A;  2V6C A;  1A16 A;  2BWY A;  2GU7 A;  2P98 A;  4RZZ A;  2GU6 A;  2EVC A;  2OKN A;  2GG0 A;  3CB6 A;  2BHC A;  4IKS A;  2B3K A;  5D6E A;  3MR1 A;  2BWX A;  2EA4 A;  4FLJ A;  5CDE A;  3L24 A;  1C27 A;  2OAZ A;  5JHU A;  5FCH A;  1W2M A;  2BWV A;  5FCF A;  1B59 A;  2NQ7 A;  1CHM A;  2V3Z A;  1WN1 A;  3ROR A;  4ZWO A;  2GU5 A;  4MAT A;  2GG5 A;  4FUK A;  1KQ9 A;  1XGO A;  2GG3 A;  3CB5 A;  4FLI A;  5JI6 A;  2ADU A;  3S6B A;  2MAT A; 
#chains in the Genus database with same CATH homology
 4IDY A;  2BWW A;  2ZSG A;  4IKT A;  2Q95 A;  1YJ3 A;  1XGS A;  1Y1N A;  1R5G A;  3FMR A;  2HOW A;  1W7V A;  3PKD A;  4IPA A;  2EA2 A;  4RZY A;  1WY2 A;  5CNX A;  1YW7 A;  5E5B A;  2BHB A;  4U75 A;  1WBQ A;  5JFR A;  1B6A A;  2GG8 A;  1R58 A;  2GU4 A;  2V3X A;  5CDL A;  3IG4 A;  2BHA A;  5CDV A;  4U6J A;  1C23 A;  4U70 A;  2B3H A;  4U6Z A;  4JUQ A;  1WLR A;  1KQ0 A;  5CE6 A;  3FM3 A;  2BN7 A;  3PKC A;  4IKR A;  4QR8 A;  1QXW A;  2BB7 A;  3BIP A;  1C22 A;  3BIQ A;  2G6P A;  2BWT A;  3PKA A;  4EGE A;  2B3L A;  1R5H A;  4ZWP A;  2P9A A;  4FKC A;  4HXX A;  1N51 A;  1YVM A;  3D27 A;  1KP0 A;  3L7G A;  5CLS A;  4IKU A;  1BOA A;  2NQ6 A;  3MX6 A;  1WL6 A;  4U69 A;  3TAV A;  4OOK A;  1O0X A;  3BIT A;  3PKB A;  4FLL A;  1WL9 A;  4FO7 A;  4FO8 A;  2GZ5 A;  4PV4 A;  5D6F A;  1C21 A;  1JAW A;  2GGB A;  3PKE A;  2GG7 A;  3IU7 A;  1QXY A;  2BHD A;  4ZWU A;  4U71 A;  4ZNG A;  4S2T P;  1WKM A;  2BWU A;  1QXZ A;  4U6C A;  2P99 A;  2GG9 A;  4B28 A;  4IEC A;  4U73 A;  4S00 A;  1PV9 A;  4S2R P;  2BH3 A;  4IF7 A;  2EVO A;  3CTZ A;  2BWS A;  1YW8 A;  2GGC A;  1QZY A;  3TB5 A;  2GTX A;  5CIK A;  2EVM A;  4RGZ 1;  4U1B A;  1XGM A;  2Q94 A;  3RVA A;  4U76 A;  2Q93 A;  3MAT A;  2GA2 A;  2V3Y A;  4IU6 A;  4U6W A;  1XNZ A;  3IU9 A;  2Q96 A;  2Q8K A;  1C24 A;  4A6V A;  2GG2 A;  4U6E A;  4S01 A;  4A6W A;  4PNC A;  1XGN A;  1YW9 A;  4Z7M A;  2Q92 A;  3IU8 A;  4KM3 A;  2DFI A;  3FMQ A;  3Q6D A;  1M35 A;  2IW2 A;  4R60 A;  1BN5 A;  4FLK A;  1MAT A;  2V6C A;  1A16 A;  2BWY A;  2GU7 A;  2P98 A;  4RZZ A;  2GU6 A;  2EVC A;  2OKN A;  2GG0 A;  3CB6 A;  2BHC A;  4IKS A;  2B3K A;  5D6E A;  3MR1 A;  2BWX A;  2EA4 A;  4FLJ A;  5CDE A;  3L24 A;  1C27 A;  2OAZ A;  5JHU A;  5FCH A;  1W2M A;  2BWV A;  5FCF A;  1B59 A;  2NQ7 A;  1CHM A;  2V3Z A;  1WN1 A;  3ROR A;  4ZWO A;  2GU5 A;  4MAT A;  2GG5 A;  4FUK A;  1KQ9 A;  1XGO A;  2GG3 A;  3CB5 A;  4FLI A;  5JI6 A;  2ADU A;  3S6B A;  2MAT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...