4MAYA

Crystal structure of an immune complex
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
181
structure length
181
Chain Sequence
IVADHVASCGVNLYQFYGPSGQYTHEFDGDEQFYVDLERKETAWRWPEFSKFGGFDPQGALRNMAVAKHNLNIMIKRYNSTAATNEVPEVTVFSKSPVTLGQPNTLICLVDNIFPPVVNITWLSNGQSVTEGVSETSFLSKSDHSFFKISYLTFLPSADEIYDCKVEHWGLDQPLLKHWEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crossreactivity of a human autoimmune TCR is dominated by a single TCR loop.
pubmed doi rcsb
molecule keywords MHC class II HLA-DQ-alpha chain
molecule tags Immune system
source organism Homo sapiens
total genus 37
structure length 181
sequence length 181
ec nomenclature
pdb deposition date 2013-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00993 MHC_II_alpha Class II histocompatibility antigen, alpha domain
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4mayA02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 4mayA01
1MH5A 4OLEA 1TIUA 1SEBA 3RDTD 4WFFE 3T0BA 1SJHA 2WSKA 2A9NL 3EO1B 2VLRE 4L8CA 1QRNB 4HHAB 1DQLH 4PRIA 3BYYA 5TE4L 3HZKA 3IJYB 5EUOF 4DCQA 2HG5B 1TVBB 4RFEA 2W9EL 3F7QA 1XH3B 3BKMH 2B1HH 2DMKA 5DMKA 4LCYB 5C09D 4F58L 1ZVHA 5I1AB 1A7NH 4N0UA 4PJGA 3FQWB 3O4LA 1U8HA 5F89B 2CLVB 4HX1A 4PJBF 5AWNL 2BNRA 2J8UE 3WFHA 5FA3B 4TQEL 3C6LC 2UZYB 1OLLA 1QSEB 2UZXB 4XHQA 3OWEA 1F6FB 1UKSA 1FC2D 5HHMD 4NP4L 1OW0C 3TJHD 4XP1H 2I24N 4PREB 2I07A 3RPKA 5F7NC 4D0CA 2CKBA 2VZSA 4H8WC 4HIJA 1W72B 3H0TA 1S9WB 3THML 3PGCA 1YQVL 4Z7UE 4M61A 4OCXL 1AR2A 1YEEL 4WWKC 4PJHE 3QDMB 4CDGC 5F72S 4Q9QL 3ZHLA 3SDAC 4C4KO 3V0VA 3FO0H 1VKXA 1DBBH 4JO1L 1PLGH 2DOCA 4FQPA 1NCDL 2VISB 5GS2D 3RL2A 3S98A 4JR9H 4H25A 1NCAL 5JQ6L 3LD8B 1B4JH 3MACH 3RKPA 1YNTB 4LSTH 1MI5E 4FQJL 2MCG1 1I7RA 3WE6A 3MOQA 2PYED 4OUOA 1XGQB 3V7AE 3QP3A 1FFOA 2IFGA 2AI0H 3O6FB 5D71H 2W0LA 2X4TA 4P3CL 1MLCA 4FFWC 2VAJA 2YZ1A 2P45B 5JMOC 1BVLB 2FL5B 3WXVL 1I8MA 5IB4A 3MNWB 1ETZB 4HK3J 5B21A 3KYMA 3X17A 1OGAD 1VFBB 2AEQL 4QT5A 5I1CH 3SE9L 1KT2B 1U0QA 3FFCE 4KUCF 3WV0A 5BVJB 1NGPH 1A6VH 2DBJA 3HMXH 3RWEA 1QR4A 1IQWH 3RTQC 2R4RL 5I1IL 2DJUA 2NY3C 1OGTB 4DGIL 2VL5B 3N9GL 4RA3A 5SX4H 5CWSB 3UDWA 4F57H 5IFJB 1A47A 4KZDH 5CP3A 2VC2L 4WUUB 5EFIA 2C7UA 2HT3D 3MLUH 2YPLD 4DEPB 1ZLUH 4Z6AT 1ADQA 4MXQD 1UJ3C 1X5FA 4RRPA 4UQ3A 5D6CA 2GTWA 4XTRC 1M7DB 3VMNA 2UWEE 1T22B 3OKOA 1RU9L 2KZ1B 4LSRH 3S5LA 1BJMA 2PCPB 3BW9A 2WINA 2V5MA 4FZEL 1BQHA 4ODVL 4L4JA 1ONQA 1MI5D 3SKNB 1IT9H 3LEXB 1QEWB 4HMEA 4F7TA 1C5BL 3PL6C 3R06A 4Q74A 1DEEB 3VWJB 5BQ7B 5E6IB 1U92A 1DQJB 5IBTH 2EIZB 2C1PB 1PZ5B 3RGVA 4XNMA 1UCBH 4HGMA 2WP3T 3D3VD 4Y19B 1ED3A 3UTSA 1G0YR 1KJ2H 1KTDB 2Z8WC 2YK1L 1IAKB 3BIAX 3I50L 4DOHB 5I30L 3IB4A 2DRUA 2X70A 5HYJE 4PG9A 3VDCA 1YN6A 2EKSA 4X6DE 4JRXD 2A0LC 3A67L 4OJFH 4YGVA 2W9EH 4NO0A 4PPTA 3DHMA 4JKKA 3SEPA 4ETQA 5DYOB 5BOZG 4P5TD 4F58H 3OV6A 3D2UD 3K1DA 3BJ91 3VG0L 4PRHA 3HCVB 1Z5LA 5AWNH 2P49B 1DN0B 4M7LL 4X7CC 3VXPA 1LEIA 2APFA 4D94A 2FHFA 4NP4H 3PHOA 5CD3B 3ZKMD 1YDPA 1OTSC 1HSAB 1JNHA 4U6HA 1BOGB 2XACC 5J7CC 4ONFL 3E2HB 4P23A 5HDOA 3THMH 4I9WE 3VWKD 1YQVH 5DRWB 5MHSE 4OCXH 1CXFA 4AENA 1YEEH 2RCSH 4I18A 1M71B 2PYFA 3RX7A 2NLJA 2XZZA 4Y2DA 1FZMA 1QBAA 4JO1H 1NCDH 1LEGA 1VADB 5KSVA 2LAAA 1R5WA 3LKOB 1WTLA 4Y4HD 5JQ6H 1KLUB 2ZUXA 3MNZA 5D1QA 2EZ0C 3MRMA 3MPCA 3BVNB 3FJTA 3X12B 1AP2A 3T8XA 2M8XA 3LSOA 1I7ZB 2VNCA 2X4QB 2DDQL 4P3CH 3PXHA 4Q6YA 1WWBX 3C6LB 1MREL 3WXVH 4S1SL 4MCYA 5GSRA 3CFIC 2DQUL 5EORL 4ZO8A 4YHYC 5LAXA 1J0JA 1U8PA 4UT6L 4WGWB 3DSFL 2SEBA 3SE9H 1KLGA 4RNRB 3DWTA 2IPTL 3FB6B 4XVTL 2FBJH 2ZSWB 2IAMD 4RMWA 5HY9B 1IJ9A 4WWKB 2BNUA 2H32A 3K46A 4BJLA 3CXHK 5GS0C 3SDAB 5D93C 1WISA 1S7UA 3NIFF 1F6LL 2R4RH 4I1NB 2RGSA 3HC0B 5I1IH 1UXWA 5SWSE 4DGIH 5MERB 4U4BA 1T20A 3IETA 2D7QA 3OF6D 1C1EL 3N9GH 2VQTA 4MJ4A 4ODUA 2NYYC 4NQCB 4NM4L 1NC4A 3HUJF 2P8LA 5I2IB 3BMWA 2VMFA 3HLAA 2XN9D 4NIKB 1CXEA 3VD5A 5HHPA 2ATPB 3NFSL 4HWNA 2V9QA 5ITFB 8CGTA 2Q3ZA 1GGBH 1J1XL 1UENA 1BIIA 3NCMA 5C0CA 3MRJB 2E8YA 2QQQA 1WICA 3A6CH 1CLCA 1RU9H 2J4WH 1HHHA 4NC2B 5DMGD 1T66D 2F5AH 4UTBH 1WCBB 4EKXA 3WYRA 4LSDA 4ODVH 1IGJA 1FVCB 4NDMA 1SJVA 2HMIC 2OSLB 1X4ZA 5F3BB 2IADA 1ZVSA 3TN0A 4OZIE 1JHTB 4IJ3C 3KPMA 2OYPA 1CFVL 2CLRA 2JIXB 5D6DC 1W8NA 3RTQB 3SQOH 3QI9D 1JYNA 1MHHA 2NY3B 3MRQB 3TFKD 1WBXB 4UT9L 1E4WL 1B90A 2OXGA 4HWBL 5MENE 5DD6B 4BQ6A 1KIPA 4JHWH 3FQRB 2YK1H 2O5YH 2FEDC 5B4MC 3S4SB 5L9DL 4PUBL 2JB6B 4K3GA 3I50H 4ODTL 3OXRB 1DDHB 1B2WH 2YUWA 5KVMC 1YEFL 2MQ0A 4N5UA 5HXMA 4NO0D 1A7PH 4BZ2L 1N59B 1SBSL 4ZTPL 3C60A 4D0DB 2X44D 2VKWA 5BW7A 5FECB 1LK3L 1UCTA 1DR9A 2QTEA 1N5YL 4UINL 5E8NA 2KQMA 4M7LH 5DVOA 2A9ML 3MRKB 1QLRB 5HDBE 4HKZB 5GGUA 4PV8A 2K1MA 3RHWF 3PL6B 1H8OA 5ENWA 4JLRA 3CPLB 1Q1JL 3BP5A 3L7EA 4GBXA 4P23D 2YKLL 1PGRB 4ONFH 5ITBH 3QHFL 3MTRA 1MUJA 4LQ1A 3ARFA 2R1WA 5E8OB 2Q8AH 3QXWA 4LAJH 4IS6B 3GMNB 3ULSB 2VZ3A 1MHCA 2X4UA 3AFLA 1CICD 3EO0A 3O41B 1J8HE 3F7VB 4UB0H 5EBWA 2JELH 4B50A 4C56D 1HZHL 4U1NA 3GMMB 3DX8A 1QSFE 2YPKA 3MA7B 4KK9D 1BZ7A 1CDGA 2R56L 2YWZA 5EZJB 3QWRD 3VE0B 5GZOD 1CI5A 3N06B 4CNIA 4DWHA 3MUZ1 3EDKA 3OJ2C 2VQ1A 2P8PB 4CMHC 5HHOB 3AC0A 2IQAB 1HOCA 2DDQH 1YEHL 5JIPA 1ZLVK 1MREH 5B3JE 1RIHH 2ICEA 4X7EC 1A7BA 5DFVD 5CZVL 1OTTC 1TCMA 3OGCA 3OG4B 5CJ8A 5KN5A 4K8RL 4LVHC 4UT6H 5ERWB 5MEPA 4E0RA 2X7LA 3DSFH 1NLBL 2I9LB 3FO9A 3LV3B 4JGMA 4XCNB 4XNXH 1IFHH 2HAZA 1U3HA 4XVTH 3NCYP 4CVXB 1GIGL 5FK9B 3OKDB 5EDXA 1HWGB 3WEXA 1JWSB 5T1KB 3BP4A 3BZ4A 1X5AA 4YFLF 3HE6C 4K7PY 3QJHB 4ZDHB 2FO4A 4X83A 3B8YA 3S8WA 3TVMA 4I5BB 1C1EH 5L2JB 1D9KB 1NC4D 4M5ZL 4HJJL 2FX9H 3CFBA 1T7WA 1IM9A 1JTOA 2AV7A 3MBEA 4UNUA 1Z2KA 2FZ3B 1ORQA 4YDKL 4PV9A 3VXMD 2ARJB 4JFDB 4Y1AA 1F4HA 1ZGLM 4OD3L 5F9JA 4M6NL 1AR1C 5FYLL 3H9HA 1LO4L 3QAZC 3U0PA 4KRMB 4YHYB 3GSRB 1S7TA 4ZMAT 5C6TL 3QUXD 3C5JB 2APWA 5FKAB 4P46D 2FIKA 4NWTH 4K3EL 2OQJA 3TN0D 1VFMA 3OB0H 3DTXA 5D93B 2FGWL 3H9SB 1DUYA 1CFVH 4K07A 5EU6B 3K4ZA 4NFCA 1I85A 3FN9A 5EU3B 4KMQA 3D69B 1CD1A 5D1ZC 2OLDA 4UT9H 1E4WH 2EYRA 4LPCA 3DO7A 4JGJA 4HWBH 1VB9A 1OL0A 1CT8B 5L9DH 4TUJA 3QIUC 3U7AA 4PUBH 3X11A 4F9PC 3GBLA 4ODTH 5E6YA 3GMQA 1F90H 1YEFH 3KPRD 4APQC 4OT1L 3F8UB 4OGAD 4BH8B 2XTJC 4YXKL 4H0IA 1LEKB 3BPLC 3C60D 4LFHD 4BZ2H 2FJGB 1QLFA 4ZTPH 2PXYD 4JG0L 3BP7A 3EOBA 4NPYA 4QOKB 3LQZB 4HEME 3B9EA 3RIFF 3VFVA 5JPMB 4AT6A 1N5YH 3IYLW 2IPUK 5HPMA 3AB0C 1FFQA 4UINH 3I6KA 4F3FA 1JHKL 2A9MH 3MRLA 5HGAB 3JV6B 2RIKA 2YSSA 2XY1A 5AG9A 4GG6A 4OLUL 4D9LL 5FGBA 3HC4H 2AQ1A 1S7QA 4IJ3B 3WJJC 1XCTA 2OR8A 3QNXA 5IQ7L 1Q1JH 4JCMA 1NGWA 5D7IE 2YKLH 4L3ED 1BECA 3QHFH 3OKMB 2X4RA 3H9ZA 3GRWA 5D4QA 4WCYH 4JAMA 5BS0D 4NUGL 3TYGL 3IDJA 1CDCA 4L8BB 1S7RA 3WLBB 5BZDB 3VG9C 1OF2A 3BQUC 3VMPA 4S2SB 4UDTB 3RWIA 5FYLE 4N9OB 5CILL 2R56H 2YEZB 2R23A 5IJVA 5T1LB 3D18B 4HUXB 3ZDXF 4FABL 2M2DA 3ILPB 3DUSA 3L3OA 1UWEH 3PV6B 1WZ1L 3U9UA 4P5KB 2W92A 4GOSA 2VDML 1YEHH 3VRLE 3O8XC 3DVIA 1EEYA 4GRWE 1G6RA 5CZVH 1P7QA 2WBJC 2F54B 3SKOB 4K8RH 3ULUF 2Z31D 1WUNT 1BD2E 2VLJB 4QYOA 2NPLX 5DJ2B 4XZUB 4A6YB 1R3JA 4LF3A 1GIGH 1IARB 1HSBA 1FL5B 3SKJL 3CVHB 4JB9L 1DQML 1F4WL 4CVZA 3KDMA 1I8KB 2L7JA 2VB5A 1T3FB 4M5ZH 3L7FB 4QHUB 4PGEB 3C2SA 2VQUA 2H26A 2GCYB 1KCVL 1PFCA 5DFTA 5KSUB 3BHBB 4KJQD 2DQDL 4YDKH 5F7WC 4CADB 1FNGA 2VLLA 3ARZA 4CMHB 1U8JA 5C07B 3W39B 4ISVB 4ZFZA 4PJ5A 5IW3A 4OD3H 4NNYA 4JY6B 5E8PB 1IGTA 3ZTNL 4R7NA 5FYLH 1LO4H 4IRSA 4UI2A 1ODAA 3PP3H 5HDLA 1V3JA 3CX5J 5CAYB 4MS8D 2AKRB 4LVHB 3UPAA 1YQ2A 3LQMA 5F1IB 2VDNL 1P1ZB 4K3EH 2VXVL 5CEXA 5KSAD 1P5VA 1M7XA 3PWPA 4GRWH 3R1GH 3HE6B 3CSYB 3EHBD 3H3PL 3MZGB 4S1QH 1IZKA 2IH1B 3BWAB 4RRPG 4HHAA 4L1DA 1I3RA 3HUJB 3WDJA 3S34L 3BZDA 3QO1B 5JOEA 4Y5XA 1W0VB 5F71A 4YC2C 2J8HA 3S5LG 1XH3A 4AG4L 5HHQB 3WIFA 4NKOB 4XVUD 3S3PA 4LHUB 4OT1H 1OWWA 5GPRA 4X8XA 4E41A 4EI5D 4H1LA 3RY4A 3HE7A 3QA3B 5FA3A 1W72L 4JG0H 3IRZA 5C0BE 1U8LB 2ESVE 3SKMA 5J8OA 4PYGA 1XEDA 1TMCB 1U8NB 1BQSA 2QBWA 5AAWA 4OLUH 4D9LH 4POZD 2VDPL 3PUCA 5JXED 1S7SB 1C5DA 3QDMA 4V1DA 3MRGB 3OKEA 1EO7A 3QHZL 5D1ZB 1WFOA 1VDGA 2C3HA 3AAZB 1U8MA 1UM4L 5E2UL 4DZBA 1HILA 1M1SA 1SY6A 4UBDC 3TYGH 1OTUC 2VR9A 3L3DA 4APQB 4G6AD 1Z0NA 2XTJB 3QR2A 2HFEB 1RAMA 3BPLB 5CILH 3SO3C 3QZWB 4EQ2A 4FABH 1OP5H 2AXFB 2FL5A 3H2WA 1Q9OA 3NOIA 4HQQL 5EU7E 4YJZL 4LP5A 1WZ1H 2B2XL 3AB0B 1ETZA 5F7FA 3MRCA 3BH8A 3QT2A 3VFOB 2ADGB 2VDMH 3HZMB 2XKNA 3IU3B 4NBYB 1KT2A 5GS1C 3W0WE 5JW4N 3LIZL 1BJ8A 1J1PL 3L9RA 2F53B 3DX9B 5M95B 4E5XA 1OGTA 3G5VB 3AM8C 2VL5A 4XMKL 5EULV 3VFRB 2PW1A 1Z0MA 3SKJH 1OPGL 1U8QB 3ARBC 2DYPA 3U0WL 4Z0BL 1DQMH 4WUUA 4M6AA 3ZZ1A 2HRPL 4R97C 4B0MM 1F6AA 5TE7L 4C4KT 5KAQG 5CP7A 3VG9B 5ETUA 3BQUB 1PG7W 2CDGB 3PV7A 3QDJD 3K81A 1KCVH 2KDGA 4OLXH 2DQDH 4JZNB 1QSVA 4QF1B 1T22A 4XNQA 5INCA 1MY5A 4KAQL 2PCPA 1P4LB 3O8XB 5E00B 4KUZL 1S8DA 3RWCB 5JR1L 1LO5B 2ZG2A 3MYJB 4HZLA 1W0WB 2WBJB 1QEWA 1T0NB 4R0LC 3VWJA 5E6IA 5EZIH 3PF2A 1R6VA 1PZ5A 4HWEL 4KH2A 2VXVH 3BUYA 3IFOB 4D0BA 3OB8A 2XG4A 2ITDA 2LU3A 3F7YB 4KDTA 4ZUVA 1A6ZB 3CK0L 1KTDA 4JFOB 3S7GA 4LPVA 1QRND 2LABA 4OGZA 5IGXL 3RNQB 1EO8H 3C8DA 1CD0A 2X5PA 2Q1EA 3Q6FA 3RUGA 3S34H 1Z3GL 4TSBL 4HKJB 4AG4H 2AJSL 4OFKA 1KXQE 1R24A 5ISZB 2P5EB 4M1CD 1C16B 1FORH 1IGYB 4XAKD 3HCVA 5TDOA 2ZJSL 5C0EA 1PVHA 1DLFH 3RUGF 1JYXA 1QSED 1T5WA 5HYFA 1BFOB 2UV3A 4HS8H 3VFGL 4EUPH 5C9JB 3IGAB 2FYYB 1XAUA 4N0CC 5CD3A 4RFOL 1HSAA 3FL7A 1CDHA 1CGWA 2H41A 5DQJB 3MLZL 3VXSB 5TQ0L 2VDPH 2P4AB 3QDMD 2ZP0T 1UKQA 4NKMA 2GJ6B 1MCIA 4G7YL 3QHZH 2M26A 4ZD3L 4DKEL 4PRPE 3VFUB 1O7SA 1UM4H 1YPZF 4YXLL 5KSBB 2DL9A 3ZTJG 1VADA 5E2UH 2ZOKB 4GKSB 4OLWL 3LKOA 4MXVF 1KLUA 4KJWD 4FA8A 4XPFL 2K7PA 4YC2B 4PJEE 2BX5A 1CG9A 3L5WA 2X4SA 4L5FH 2XQYG 4DUXA 1A7RL 1HQ4A 1N64L 2X4QA 3O6FD 4NJAL 5JOFA 35C8H 5E5RB 4XCFL 3RWDB 4DN4L 4P3DB 4HQQH 4OF6A 5DD1L 4R4ND 4X6CE 2B2XH 3MYZA 1A22B 3QRGL 4XXDA 2Y5TB 4FTVB 1PBYA 2JJTC 2EICA 3ECBB 5I66B 4IMKC 2GITB 4QHLA 3U82B 4GXVL 3QXVA 5IBUB 3AS0A 5HY9A 4LVNC 3FAXA 4HK0B 1NCWL 4N9GB 3LIZH 3LKPA 4WHTB 5GJSL 1IEAA 1ZS8B 1J1PH 5F1SA 3LZFL 1OAUL 2XYCA 4OV5A 5I1EL 2A83B 2O5ZH 4M8VA 4XMKH 1KC5L 2PF6A 3NVQA 4Z0BH 4FFZH 2WQRA 2C3XA 3G6JA 2HRPH 3HKFA 5TE7H 4XRCB 4NN6C 2ATPA 3WO3B 1VFAB 2DLIA 2YS4A 4PJ8A 3C6SB 3KLHC 1DVFC 1CDBA 3I2CL 3MLRL 1LE9B 1R0AL 4KROC 3RY6A 3UTPE 3VD3A 4XNUL 1A6UL 3G6JF 1HIMH 3LKSB 2BVPB 2CUHA 3GSNB 2R15A 3MFGB 1WCBA 4KAQH 5IR1B 4CN6A 5B39B 5CGTA 1H15B 6FABL 2MOVA 4P4KA 5DDHB 2HJLB 5JR1H 2EXWD 2D3VA 3PGDA 5CBEA 4KKLC 5GS1B 1BFVL 4NO5A 3KJ6L 3JZ7A 4PBXA 2WIMA 3VWJD 4K3JL 5E6ID 3MROA 4ZPVB 32C2A 4XP5L 2VDKL 3QDGA 4HWEH 1JV5B 3HAEA 3JTSA 4Y19D 4R2GC 5DHVH 1WBXA 2X1QA 3ARBB 3T3MF 2X42A 1C7TA 3TM6A 1DUZA 3FQRA 1ZHBA 4RGNC 4R97B 5D2LE 1JYWA 3ULVL 1F45A 2NY5C 2V7NB 1G7LA 1FE8H 2GY5A 2JB6A 2ZUUA 5IGXH 1DDHA 4J4PA 3GK8L 1UB6B 4CW1B 1DLHB 2AXGB 4LMQE 4TSBH 5C3TA 1NCTA 2P5WE 1FFNB 3QCVL 2AJSH 4D0DA 2EEDA 1NDGB 4G42A 1KCLA 4WWID 4M9PA 2JK5A 5DRNB 2ZJSH 2JTDA 3HG1A 4RAUB 2LE9A 4YDJB 4YR6A 1QLRA 2VDOH 3INUL 3JWOC 3PWLA 4K9EH 4JG1L 2X4OB 3MFFA 2VIRB 4RFOH 4R0LB 2VITB 3KXFA 1INEL 3D39E 3KPQA 2BC4B 3ARGA 3ARDC 3HS0B 1G9MH 5TQ0H 2F15A 3MZTA 2BNQE 4X0KA 4RZCA 4X5WA 4IS6A 3ULSA 4O9HL 3BSZL 2DWDB 3LN5A 2A6KB 1NFIB 3WUWB 5D7LA 5C2BL 3DV6B 4FQ2L 3CVIH 1FZOB 4P4RA 4IIQA 2E8ZA 4NKIL 4ZNEA 3HNVL 4XPFH 5DJXB 5IMOA 4KGJA 5SWZA 5MEOA 5EZJA 4EEEA 3VE0A 2ZUQC 1FG2A 1A7RH 4MA8L 4WRLA 3UTTA 1YC7A 4QLRA 5EBGA 2BVTA 3WFCL 4R3SA 1N64H 4NJAH 4WFHE 2E9WA 4QTHA 1P7KA 3BXNB 4UIKL 3C6LD 3MO1B 4DN4H 2YRZA 5IVXB 3EO9H 5GGTA 1S5HA 2A74B 5DD1H 4OD1L 3SE3C 2O93L 3UROR 3QRGH 2XV6B 4I48B 4MX7A 5ERWA 3TV3L 4H88L 4L4VE 1IGML 4LLAA 1SEQL 3LV3A 4X4MA 4FXGB 2MWCA 3GJFA 4D9QD 1DBAL 2V2XA 4GXVH 2CKBL 4PJDA 4WWKD 5DK0A 5FK9A 2FECI 3QNYA 3SDAD 2CRZA 3MGOA 5IWLC 3ULVE 4BQCA 5DFWH 5GJSH 1E27A 4TNWF 2HT4C 2P48B 3LZFH 4UMGA 4QRPB 5IMLB 1MCOL 5E8DL 3C8KA 1F3DH 1QP1A 2AV1B 4Y89A 1G7QA 3GGWA 4FS0A 4NQCD 4CN4A 1SYSB 1D9KA 5IV2A 1P2CB 5HHVL 1XT5A 3VXUA 2KKQA 2GT9B 5I17B 1K3IA 1KG0A 5ACLA 1NL0L 1I1FA 3V6OA 1LE5B 3VRJB 1G7PB 1OAKH 2GK2A 3I2CH 2YHGA 3MLRH 2ARJA 4FFWD 1KTKE 4QXUL 5DC0A 2BNQD 4QRSB 4XNUH 2CD0A 1A6UH 3MV8A 4RIRB 3CZFA 4K94C 5IB1A 4YHNB 2NY2C 5AAMA 4WFGE 1GXEA 5GS0L 4GW1A 4RMQA 1KTLB 4NQEB 3LQAC 4P57A 6FABH 5GQBA 1KPUB 4NSKA 3SGJA 3WO4C 3QQ4B 2GTZB 3ETBF 2FX8H 3OPZL 5EUOE 4LVNB 3T1WA 3KJ6H 3VD7A 1I1AA 1T1YB 3CGTA 4J7RA 2XWJB 3RTQD 3DARA 4Q6IA 2JIXD 1BX2B 3H9SA 3QDAA 4NNXA 5JHDE 2NY3D 4XP5H 3K2MC 1RFDH 4Q9RL 4JKMA 3ALWA 5IK3B 2I9TB 4PJBE 4PRIE 3UJTH 1G0XA 1U58B 2FWOA 3ULVH 1ZKAA 5CJOL 4ZFGL 1E28A 5JOPE 4N0UE 1DVFB 4FQHB 4NQDA 3O4LE 1I7UB 3R0MA 3WS6A 2V2WB 1QFWI 4XTRD 1R3KB 4HG4K 3OAYH 4XX1G 4KK8C 1WZMA 2BNRE 4BH8A 4G8IB 5J1AB 4IRJC 5IVNA 5MP6L 3QCVH 4YX2L 2XOTA 4NRYB 1ZA6A 2ED9A 4QOKA 1PKOA 5SX5K 3I84A 1WV7T 2R1YB 5EPMA 1MFCL 5DEGB 4KTEL 4JVPA 3EYOB 2C1OA 3IXTB 5CINL 5F96H 1G7JB 5HDQH 2OTUB 3PL6D 4X9HA 5EIIB 1NMAL 4TNVK 3WKML 4JZOB 5FUCC 1YY9C 1PJ9A 1INEH 1EEZA 1KJVA 2OZ4A 5BXFA 4L4TB 4QRTA 2GSIB 4R2GB 4ZOEA 3EFFA 3PJSB 1WT5A 3CFJB 4ZXBC 1JNLL 3IDYB 1XIWB 3KYOB 5ESQA 4D3CL 4RGNB 4O9HH 1INQB 2EDJA 3BSZH 4MNHB 5ESAA 1YEKL 4KKBC 4MAYA 5C2BH 5KW9L 3O2DL 1L4IA 3QYCA 4H1LG 4A2MA 2A0LD 5SV3A 1H3WM 2CDEA 2GSGB 3HNVH 3MRFB 1S9YA 3D25B 1A14L 3FOLB 1NDMA 4MA8H 3WFCH 1RVFH 2UUDK 1RIUL 4MA7L 5HHOD 4RQQA 4P2RA 3RBGA 4XVSL 3MV01 4BSVB 4C57C 4A6YL 4WNQB 2GJJA 3RVVC 1GC1C 1OTSD 3T77A 1DANT 1UZ8A 4LLYB 3JSSA 4OD1H 1YEIL 2WZPD 1A1MA 2VABA 3ARDB 4G9DB 3TV3H 4H88H 5DJZB 5L2KE 1IGMH 2VLJA 1SEQH 1EIBA 1VPOH 1T03L 3VFWA 1DBAH 4BUGA 2CKBH 3KLDA 3SN6N 5KS9A 4W6XB 1U6AH 1ZVYA 4NHCL 5T1KD 5I1LB 3NN8A 3MGTA 5C0IB 4PTUB 4P9HH 5ID0A 2R1XA 1MCOH 3T2NL 5E8DH 5IF0A 3CCHA 4QRRB 1X5HA 2JJVA 3W5MA 2ADIA 1YPZB 4KI5F 1A9BB 5CMAA 3QCUH 5HHVH 3VGHA 5KS9F 2EZ0D 2VOTA 5EA0L 2GCYA 3BISA 1RZJC 5LWYH 4JFXB 1C12B 1K2DA 2ZUQB 3O45A 5DVKA 1NL0H 3TBVB 2AJZA 5E5UB 2YC1B 5JUEL 1YN7B 4JFDD 1HXYA 2X1PA 4ISVA 1EPFA 2AJ3B 2M1KA 1C08B 3RVWC 3G9VA 2GEEA 4X4ZA 3PWNB 4JY6A 3WFBH 2X10A 3GSUA 3MBXL 3NCBB 5EB9A 4OI9A 5JA8B 1T21A 5GSVA 4W6WB 3TO4A 5FYJU 1PYWA 1WSST 2FHBA 1NCUA 1AD9B 4LCCC 1B88A 5GGQL 3OPZH 3TIEB 3NCEB 1WIUA 1PQZB 4KUCD 5GS0D 1HHGA 5K9JL 3GMPB 5F1NA 3QUMA 3UTSE 1G6VK 5EU6D 5FM5O 2DQEL 3IXAB 3OR7A 4JFEB 4N90D 1PX4A 1ERNA 4G8EA 5IMKB 3BWAA 4Q9RH 4YO0B 5F3HA 5I74C 1RURL 2NYYD 4QRQB 4YDVA 1TDQA 4ESKA 5CJXA 5B8CC 3CFCL 4LEOA 5DUBB 5IG7A 3ZDYF 5CP3H 3H42L 4UAOC 4OGXH 1FAKT 4X6FA 5DRXA 1H9VA 4ZFGH 3BE1H 4GAYB 5DHYA 2VXTL 2E6JA 2QLVB 5FYJL 5L2KD 4OSUH 1AFVH 5D7JC 4PRHE 4NKOA 4R8WL 3TH3T 1JL8A 1LMKA 1ADQH 3FT2A 1OAQL 3QA3A 5HYQA 2NY2B 5MP6H 4QOKD 4WI9A 4YX2H 3FQXA 3MV9B 3T65A 2XY2A 2EECA 2A6JA 1H8NA 3LS5H 3WO4B 1QNZL 4KTEH 2ZG1A 2FJFA 5CINH 2HMID 1KF9B 4P0DA 2EO9A 1C5CH 1UH2A 2EDHA 3B6SB 3W9DA 1NMAH 1R3LA 1FBIL 1IGCH 3ZMRA 5IFHL 3NABH 4NC1E 5FO8B 1LGVA 2WBKA 5E1AA 8FABB 4OZFB 4I0KA 2CDFB 2Q6WB 1OAYH 1JWMA 3K7UA 2MCPH 2RFXB 4JO3L 5HGDB 2FEDD 5B4MD 4U3CA 4D3CH 4I2XA 3P4NB 4ZYKB 5KW9H 3ARWA 3TNMA 3P9LA 4XBGA 2WIIB 2Z92A 3T0WA 4EN3A 2HFEA 5T1LD 2BFVH 4IRJB 5FO7B 3EUUA 3BD5A 4OFDA 1DBJL 2XWBB 2E7LC 4DGVH 4D8PA 1HQRA 4RX4A 1RIUH 4MA7H 4BH7B 3CNKA 3OL2A 4XVSH 3IU3A 4AIZA 1RJLB 2IPKB 2JJUA 2HWZL 2F54D 1LP9F 4HAGA 3WJJA 1YEIH 3V6ZB 2VLJD 5L6YL 5EC2B 5GRXG 4NZUH 4FQQB 3EW3B 1DSFL 1T03H 3BPOC 5I8CB 4HBQA 1F02I 4ZXBB 4DGYH 2DJSA 2VTFA 4LRIC 3VFRA 5T1MB 2FO1A 2R2BB 4WIQA 4YUEL 1JZ2A 1U8QA 4U2YA 4IM8A 4JPIB 5FYJE 4GW4B 3T2NH 1ES0A 1AQDA 5HGHB 2AK4B 3FB5A 2Y07L 4ORGA 4HIXL 5EA0H 5TGBB 5C0CE 1H5BA 2AERT 1MWAB 2H3NB 3AS2A 4OTXL 5I1HH 5E0QA 5C0AA 2YZ8A 4FHBD 2R0ZL 5C07D 2GYSA 5JUEH 2V5TA 3OQ3B 1XF5B 2UZIL 3EYFB 1JK8A 2BVYA 4Y4KC 1E4JA 1FNEA 4BYHA 1ZT7A 3MBXH 1OTTD 3QEQB 5BV7L 4BQ9A 3B9KC 1I7TB 2VYRE 3G5XB 4YLQT 2HFTA 4LPXA 5D70L 2YD3A 5GGQH 5EN2A 4OZHF 2ZKHL 5K9JH 2O61A 3QNZA 3HE6D 4KY1H 3T0EA 3P0VL 3SHSA 2H32H 3VA6A 3WFDL 3JWNC 2WV3A 2EDOA 2B20A 4JJ5B 2DS4A 1JFQL 2MNUA 3RKDC 1SVCP 3RNQA 3QFDB 1QR1A 3U4AA 1NBZB 4Z0XA 3CFDA 4NRZB 2VLME 1HDMB 1EBAA 3K4DA 4WV1C 2JB5H 3O2VL 3M07A 2AGJL 5FYJH 3DECA 2HKFL 4LHUD 4R8WH 1MCNA 3CLFL 3BEVB 3FO2B 4UU9B 1AR1D 5EZLB 1OAQH 3MREA 1OP3H 4QEGA 2HLFC 3L1OL 1BFOA 3NIDE 5KG9A 4ETYA 3Q48A 1UZ6E 5TJWK 3C9NB 3WSQL 3HAEG 2D7OA 5E9DE 4LCCB 4ZUSB 1CLZL 2B4CC 3KPNB 4RWYL 1Q9LB 1CGSL 1NJ9B 1ZXQA 1HN1A 1NFDB 4PJ9C 1MLBB 2FJHA 1FBIH 3B5GA 2OMNA 4JQXC 5D1ZD 5I74B 4NN7C 1AXSA 5B8CB 2EDDA 4GKSA 4JO3H 1D5BA 1MFEH 1ZA3A 1UQSB 4UAOB 1B3JA 3QIUD 4MD5A 3SDCC 3VXRA 4ZPTA 3MLXL 1HE7A 4DQOH 5J6GB 3OKLA 1TJGL 1E4XI 4OLYL 1T1XB 5D7JB 4YPJA 4APQD 5IHUL 1LDPL 2XTJD 4Z76B 2DB8A 5C0GB 3SCMA 3U4EB 4J3WA 5HI4C 3ZTJH 3MRIA 4GS7C 4WU5B 2GIYA 4RCAA 3GJEB 4XP4H 3REVB 2BY0A 1QD0A 4GRMA 2Z9TA 3DRQA 4LSQL 2Y5TA 2FD6L 4HC1A 2AVGA 3MJ8B 3U2SB 5GHWL 3STLA 5D1XB 1JRHL 4PJFF 4WW2A 4WHTA 2F53D 5L6YH 1ZHNB 1MCDA 4TTDC 1DSFH 1IC4L 3DXAB 3HN3A 3BO8A 2A83A 1UC6A 1QG3A 4X6BB 2QKIB 1I8LC 3OTTA 2J8UF 2VXUH 3HTLX 4YUEH 3IJHA 1AO7B 2NX5B 3KG5A 2Y07H 3BQUD 3PP4H 4HIXH 2H6PA 3C6SA 5CSZB 4Y1AE 4U1HA 4P5MB 1NEZA 3TH2T 3HI5L 2BXZA 1GH7A 1T2QH 3EYUH 2XQYK 2WMPA 2ARWA 5K9QI 2OK0H 2R0ZH 2A73A 2C26A 3T0XA 3O8XD 2Y1VA 2X4NB 5B39A 3ULUL 2UZIH 4OCYL 4JFFB 4OQTL 4O2CA 2BRRL 4Z7OF 1SJXA 3CJJA 1TJIH 4P9ML 3GHBL 2HJLA 2HLAA 3IDGB 2WBJD 3O6KL 5BV7H 4MLSA 3RZCA 4Y5YC 43CAB 2YMXL 1DL7L 1QFPA 4OIAA 5DC4B 4ZPVA 3BPOB 3Q5OA 3RI5F 1L9NA 2ZKHH 3F58L 2NY7L 4MMZC 3WFEH 4PFEA 2XKSA 3WFDH 5D2NA 5LVEA 3O9WA 4LBEA 4R4FH 1YUHB 4Z95L 1IEBB 4P2QA 1QHPA 1KENH 2V7NA 1JFQH 2DM4A 4ZFFB 1K9TA 3V7MA 4FQLL 1UB6A 3MCG1 5J57B 5DQ9B 3GSWA 3O2VH 2AS5M 3VFNB 1FFNA 1HEZB 2AGJH 1NUDA 3CU7A 5ISZD 2P5ED 1QSZA 3NIGE 3DRTB 3VI4F 3Q0HA 5HI5C 1NCCL 2HKFH 5CEZD 1AKJA 3CLFH 3B2UC 3BGAA 4MA1C 3DI3B 5D96C 4P3WA 3VDAA 3PQYB 3B5HA 4Y4KB 2VKXA 5DSCA 2KQNA 4X80L 4U1KB 4X8JA 3E3QC 1AGDA 5B38A 2FIRT 5EC1B 3B9KB 4HMCA 1JCKA 4F8TA 4H26B 3WSQH 2X4PA 3LKNA 4WI4A 2P24B 3HS0A 3VXSD 1W8OA 1CGSH 4PTTA 1IILE 2XXMB 1N4XH 2GJ6D 5CBAB 4LNVA 3ZDXE 2UWEF 4WI6A 3RJDA 4HIHA 4BFIA 4QKXB 1XF2B 1WBZB 3TA3A 3PWJB 3STZA 4NUJB 5BMFH 1P5UA 1G9NH 2G9HA 3UTZB 1M05A 4WV1B 2OI9C 4GSDL 4TUKH 4Y16A 3MLXH 4OLYH 5IHUH 3ULUE 1QKZL 1JF6A 4FXLA 4RMRA 3HZVA 4X7TB 43C9A 1MCWM 3ZKSD 5CSGA 5EBMB 3O3UN 1QFWM 3MXVL 1AGCB 1S7VB 1D5XA 1KTRL 2X1XR 3RX5A 3SJVA 3BP6B 4J3UA 1F5WA 2AJVL 2EDXA 4FTVD 2EDBA 1PKQA 4LSQH 1EA9C 1K8DB 1T1WB 2FD6H 1F3JA 3F12B 5I1GL 1EEUA 2DQIH 1UG9A 1OVZA 4PJ9B 4G43B 5GHWH 2R4SH 5DO2C 1MFBL 4G80B 4HUWB 3MMEB 1JRHH 1NBVL 5DZNA 4MQ7A 3GIZH 3PWVB 4NN7B 2YA0A 1IC4H 3QCTH 1XGUB 4M1DL 4QRUB 1MAML 3DHJA 1T7ZA 1UA6L 4NT6B 3V0WL 2DD8L 3GRWH 5ACZA 4G9FB 3U36A 4UBDD 3SDCB 1OTUD 4F37K 4F7EA 1SY6L 3NH7H 1WZKA 2HVJA 1CXHA 1J18A 4Z5RB 1Q0YL 1LE5A 1RSFA 5T3ZL 4PJ5E 1MCQA 2OBGA 2VLKA 2BVOA 4M93C 3REWB 3GSVB 3P9MA 5IVZA 4QXTA 4F7CA 4NWUL 1MNUH 1KUMA 4XX1E 3BPCB 4GS7B 1KB5A 2NY6C 1KJ3L 1KPVB 1VGKB 2R0LL 4Z7WA 4WTWA 1OAXL 4NQEA 3LB6C 4E42A 3ULUH 4OCYH 5K9QG 1KPUA 1MJJB 4CMMA 1I9EA 4LGRB 3O6KH 3PWPE 3VH8B 1TTGA 2DLHA 1R5VB 1LP9B 1G6RH 1CE6B 1DL7H 5GGVL 4Z7WF 5JW5A 2XICA 1XF4B 3UP1A 3SGDI 1B0WA 3K2UL 5I1DA 1F4AA 2W0PA 2NY7H 3F58H 4MAUL 4FZ8H 4PBVC 5ALBH 3ARBD 1RZIA 5H2BB 4XP9L 2EDTA 5DJDB 1WWWX 5JNYB 3I02A 4JY4B 1K5NA 5C7XL 4RBPH 3QQ3A 3O81A 4G8GA 5ICZB 1U3JA 4I3RL 3DMMA 3QXDA 3VFMB 2VSDA 3RRQA 4JFQB 3ZYIA 4E41E 2XA8L 5FUZL 5J1AA 4MZ3A 3HNTL 4G3YL 1EXUB 4GUPA 3B3IB 2BCKB 3IS0X 4P2OC 5DXWA 3TO2B 3BT2L 1TQCC 1PSKL 3R8QA 5C6PB 3T4AA 2ENSA 3HPJA 5IB2B 2HFFB 4PGDA 4Y5YB 3VJ6A 1YMHA 5EBLB 1REIA 1K4CB 5J06A 2ARJQ 4V1DE 3WKNA 3TPUB 3AU1B 3QUZC 2NY5L 4GLRH 1MCSA 3FQTA 3LMJH 3VXQA 4OZHB 2GSIA 5JTWA 3VGEA 4EZMA 3DGCR 1OD7A 3PJSA 4FN0A 4LNRB 4ONOA 2Y06L 2XA3A 1XIWA 4LKCB 3ES6B 3QEHB 5F1OB 3RDTB 2D0GA 4JCLA 3BKYH 5T3ZE 3CFKA 4LHUG 4HIIA 5ALCH 1RV6X 4FQXC 3FQNB 1JVKA 4OZGB 1DBMH 1MJ7L 1Z9LA 4GSDH 2NCMA 4KU1A 1QA9A 3DETC 4OZIF 1FZKA 1TZIB 1QKZH 3BD4A 1QBML 4MA1B 5D96B 1DZBA 1CFTB 1KCKA 4WFEE 3MXVH 4H1LH 2G2RB 4N0CD 4L8SC 3V4PL 4F8QA 3QJFA 1Q38A 3HR5A 4XMLL 1QFOA 5FEBA 4V2CB 5F7DA 3UZVB 3U6RB 1UADC 2AJVH 4X5XB 3OKKB 3HI1A 1CGYA 3BYTA 3ARDA 4O2EA 3FRPA 1WFUA 5I1GH 1NGZA 1BZ9B 2YBRB 5KVFL 3MCKA 2CJUL 3W82A 2COQA 1C8PA 1NCBL 4M48L 4HIEA 5ID1B 4QRPD 2I27N 4KK6C 4M1DH 1IM3B 3HB3C 1D5IL 1UA6H 2D9QB 3V0WH 2DD8H 1CU4L 4GAGH 3EJYC 5E08H 4Z7VA 2OI9B 3ROOB 3BRFA 1SY6H 3V79C 3UJIL 4MJIB 3SQBA 3TBVA 1AI1L 5BRZA 5T3ZH 3SE8L 1FVDB 4HDIA 4L4TE 2OL3A 4YAQB 1XCQB 1JF1A 1RHFA 3IDMA 5AUMA 1TZHA 3OR6A 1JGUL 3PGFH 4NWUH 3PWNA 4Z7VF 4PLJC 4XMPL 1RZGB 4IDJH 4JZJA 2R0LH 5J4MA 1KCRH 4NQED 1TCRB 2CKNA 4PRBB 1ZLSL 1OAXH 2OTWA 3MUGB 3X3GL 1DQQA 2GJZA 4OAWB 2VLRB 2FH6A 4KWUA 1AD9A 4HKXB 4JDVA 4WENB 2HT2C 1HI6A 1X5ZA 5GGVH 2YRPA 4MGXA 1KN4H 3WIHA 3DVGB 3DIFB 3K2UH 1T1ZB 5IMKA 3L3JB 2V9RA 4QRQA 1Q8MA 2J8UB 1BLNA 5E95B 4U1IB 3RUGE 4BUHA 3SDXA 2I5YL 1FL3A 1D5ZB 5EOCH 1BFSA 4K94L 5DGQA 4GAYA 4UOW0 5C7XH 1VACA 1DVFD 3KLHD 3UJJH 4YHPA 1KN2L 3EOAB 3KJ4C 4OLVL 7FABL 4I3RH 4KROD 5I8EA 4M93B 4ELMA 2A6IB 1CYGA 1JGDA 5D72L 3QIBC 1CL7H 2XA8H 5FUZH 1K3ZA 5DD5H 4Z7UB 2IANA 2VXSL 3HNTH 1UH3A 2NY6B 4PJHB 1AHWC 2C3GA 2N7AA 5ADOL 2J1KA 4NQUA 1RPQA 4OKVB 4ELMF 2NMSA 4KKLD 3T4YA 1E0OB 1EAJA 3QXTA 4JKPH 2X9YA 3VFSA 3LS4H 3NZHH 4MXVE 1MI5B 5DA4A 1X7QB 4Y0GA 4G7VL 4L4TD 5KZCD 4R2GD 4TVPL 4AJ0A 3GMRA 5AYUL 2V2TB 5KOMC 5ELIA 3CSPA 4DVBA 5ADPL 1IKNA 3S97C 1MPAH 4RGND 2Y06H 5HGDA 4UV7L 4C83B 1KIQB 2QEJA 1ORSA 3D0LB 3RWHB 5LXGL 3U0TB 2R2EA 4K71C 4WEBL 1AXTH 3UTQB 2GAZA 4OFVA 3FFCB 3X14A 1MJ7H 5FO7A 5F7UA 4KJYA 1KJ2B 1A2YA 3DPBA 3B2VL 4P2OB 5E56A 1QPXA 3ZYZA 5C0NC 1TQCB 4P5TB 5D8JL 4BH7A 4N8VA 3B8SA 3CDGA 4WW1A 3CH1A 2VDLL 3P11L 2F8VA 4FRWA 4XMLH 3P4LA 1G7IA 3QUZB 4NKDB 3V6ZA 3ARDD 4JN1L 3KR3H 4LLMB 1AD0B 1RZKL 4R7DB 5DQDL 5BZWB 1ZMYA 5M7QA 1BQLL 2X6MA 4LSUL 2QQLH 3CFEB 5KVFH 2CJUH 5I8CA 3UYPA 1NCBH 4KDVA 3QH3B 4M48H 2X9WA 4NBZB 2R2BA 5LCVL 5HPOA 3G6JE 1P9MC 3UYOD 2UWEB 3ZHKA 4LCWA 4JPIA 4QRRD 1ZT4B 4Y7MA 1D5IH 4OCNC 5HJ3A 3QULB 1RHHB 4RMTA 1CR9L 3WUZA 1U93A 1SQ2N 1WCQA 2AW2A 2BSRB 3JV4B 2H3NA 2V9TA 3UJIH 3RWJA 2IALA 3KPPB 2A38A 3SE8H 1I9IL 3BZEA 3DURB 3EYVB 1UM5H 3DROB 3RU8L 4LKXA 2PTUA 5E70A 4N68A 1IC1A 4L8SB 2AABL 4NGHH 5JO5A 5E2WL 1JUFB 3KPSA 2ICWB 5GGTL 2W9DL 1OAZL 1ZLSH 3ARSA 3X3GH 1I7TA 1IAIL 4MJ2A 4W81A 1ND0A 3QDGE 1HHJB 5HYJB 4PG2C 1T83C 3QG7L 5HVGB 1JHLL 1T4KB 1I9RL 2MQ3A 3GB7B 3SE4A 4FQIL 4X6DB 2HT4D 4FP8L 3RGHA 2DI8A 4JFED 5IBLC 3CU1A 1BM3L 4GG8B 1XFPA 1W2KT 1BVKB 3FT3B 2P8MA 1NEZG 3P77A 1ZWIB 1YA5A 3GDBA 1EJOL 2I5YH 3BIKB 3FCTB 1HDMA 3EOTH 5I76B 5ANMA 5FUCE 5DRZB 3O3DA 1KN2H 4OLVH 2GFBB 5B39G 7FABH 2ADJB 3I6LD 3R4DA 4D9RD 2CRIA 3GMOB 1IAOA 3HG1E 3O11B 2BRQA 5E7BA 2NY2D 2VXSH 4JKWA 4OZ4A 3MV9D 3DYPA 4XGZB 2DKSA 4XCEA 2P7TA 4PY7B 1CBVL 1HKFA 4KHTL 4WI2A 3KXFE 2F58L 3UCRA 1N0XL 3GMLA 1S7WA 4LL9A 2XZAL 4MNQA 3SOBL 1A0QL 4PB0L 5K9KA 1N8ZA 4CL7A 3RX8A 4JFYB 4HAFA 5DGRA 2GUOA 1G7HB 4G7VH 4XPAH 1YJDH 2JJSC 4F2MB 5AYUH 5D7LE 2YPVH 3HAEH 3S3SA 5ADPH 1CDUA 3HRZB 3DOSA 3HR6A 1HHIB 1JPST 4UV7H 3NFPB 3BH9B 5SWZE 1FGNH 4XH2A 1L6XA 4TVPD 4MQSB 3KJ4B 5ESVB 3UTTE 4JE4B 5LXGH 1YMMA 3PNWB 4RDQG 1RZFL 3ALPA 3IFPA 1GOFA 4KK8D 3QIBB 4IRJD 4Z77B 5EO0A 4N0YH 4YFEA 4ZS6C 1X4YA 2EDYA 1G1CA 4O51B 3REVA 3GJEA 4I0PC 5DD3H 4JFHE 5AD0B 5D8JH 2DMBA 4F33B 5SWSB 5FO9B 1MFAH 4MNGA 5DJ0B 1J05A 5ILTH 4X4ME 5J3HC 5INDA 3FO1A 3P11H 4PJDE 4AL8H 1WEJL 3PXJA 1ZGLA 5IFAL 1YY9D 1CVRA 4TULL 5D1XA 1F13A 1OQXA 1Z9OA 4JN1H 1PY9A 1F4XH 4JRYE 3QEUB 1ZHNA 2E9JA 1RZKH 4ZUTA 1MCLA 1MEXL 5DQDH 4PP2B 1FSKC 3DXAA 4ZXBD 4LSUH 1ZK9A 4Y5VC 5DI8B 4PJ7A 1ZSDB 2X89D 3VXUE 4HS3B 4JRWA 1Y6MR 4KKBD 4OFPA 2AK4D 2NX5A 4K8RC 1CICB 4KHXL 4K71B 3NA4A 5DZOA 3HNSL 3IS1X 2K9UA 2KL6A 1CR9H 2PTVA 5IHZA 5CSZA 1MHEA 4AEEA 4PJ7F 3QIWA 4GQ9L 5TDNB 5IOPA 3MV8E 4OCLC 3MRRB 3MCLL 4OZIB 1RUKH 1D5MB 2UYLA 3OAYK 1I9IH 2DAVA 5F7HA 3RU8H 3JBG7 2RJMA 3RVVD 4IOIB 3QEQD 2AABH 4M62H 5MENB 5E2WH 5FXCH 3F5WA 5GGTH 4KPHH 2W9DH 4PLNC 1OAZH 4K7FB 1IAIH 1NFKA 4AMKL 1WAAA 3IKCA 5FA4A 5I18L 1B0GA 3R8BB 3QG7H 2RB8A 3GM8A 3WL9B 1DE4A 1I9RH 2EDLA 3GJFH 4W4OC 2MFNA 1TTUA 3PWUB 1JGLH 1WITA 3BKJH 1BM3H 4DFIA 1WAAF 1R3HB 4NQDE 5I15L 4QO1A 3QUYC 3DBXB 3RWGB 3ZDZF 4ZFFA 1EJOH 3MR9B 3M1BA 3LHPL 1HEZA 3C2AL 1L0YA 4AEFA 4DZ8B 4NZRH 2BMKB 1CCZA 3DO3A 3RVWD 3UYRH 4GAFB 2GKIA 4YNYA 1UKTA 3O3BB 3IDNA 4ODXA 3AVEA 3DVNA 1YEJH 1FNAA 4H20H 4L8DB 1MRCL 3MODL 3I6GA 1CBVH 1J8HB 2YUZA 4ZTOL 4M7KL 4W68A 3TYFB 4U6XB 3SOBH 2P24A 4Z78B 1QSFB 4R4BA 5F7MC 4P99A 5CBAA 1J0IA 1SMAA 1UYWL 5C0JB 4L9LA 1LK2B 1F58L 2X1OA 1WBZA 2AK1L 1NEUA 1U41A 1CQYA 3QWOB 4NUJA 4DK6A 5IP4A 2NY0C 1IQDA 1M7IB 5DHXB 3FOMA 4AIOA 3KNBA 3CH8A 2Y25A 5D7JD 4MDJA 4PRAA 1PG7L 3O4OC 1RZFH 5FF6B 1QLEH 4P2RE 3RVTC 3OHXA 1RZ8B 4MWFB 3T0DA 1WFNA 5EBMA 3UPRB 4XXCC 2YD5A 1UXSA 2DKMA 4YXHL 2J5LC 4WHYG 3SY0B 1T1WA 4KI5E 4XCYB 1WEJH 5DJYB 5KS9E 1I4FB 5IFAH 3ORJA 4RGOL 3VA2C 2ITCA 1NANI 2P43B 3MMEA 5FDYA 3SGEH 5CEYA 3TWCL 4PGBB 5DJCB 1EFXA 1MEXH 2OZ4H 3DXAD 3O3AB 5C08A 5F9OL 4U1LA 5J9PB 3WJLA 1D6EA 2R39A 4PJAA 1RK0B 1T80A 1AO7D 4OUUA 4XBPA 2VE6B 1XR9B 2NX5D 4NQVA 2G60L 3EDEA 2HH0L 2YUVA 3KYAA 1GHFL 5AEAA 2ED8A 1RJYA 4GQ9H 1PG7X 3K8MA 2Z4QB 5ABDE 3BX7C 3MCLH 2XI9A 5FB8A 4PJCA 1VGKA 4I0PB 2W07A 3TZVA 5I9QC 4ZAKC 3FRPG 4JFFD 4J8RB 2J6EL 4OD2A 1MJJA 4NQXA 2DWEA 4R26L 5LKNA 3GIVA 2PW2A 3VH8A 3ZDYE 5IJKC 2DTML 3VGFA 3W81A 4AMKH 5I18H 2H1PL 3GZKA 4AEHL 4ZUWB 5CHNB 4YQXH 1FSKB 2Z31B 3WXWL 2HVKB 4Y5VB 2BOBA 4LLVA 2CO6B 2HN7A 4ZSOA 5H94B 3EDFA 4DKAA 5CIPA 5LGJB 3TIDB 5EU7C 4X6CF 5JNYA 1MCBA 3LDBC 4XP6L 3NFNA 1SJEB 4JM2A 3PIQB 4WJ5B 2APTA 2WUBL 5J6HB 4PRDA 1NUGA 4JFQA 2J7LA 3LHPH 1IKFH 1OARH 2ZCLL 2FR4B 3TEUA 2PTTA 3C2AH 1B0RA 3MV11 5DS8A 4OCRL 5D7IB 2BCKA 2B0SL 3PQYD 4Y4KD 3G04B 5CCKL 4PJIF 1N6UA 2IPUG 3V0AC 2HFFA 4HS6B 1JPTL 3B9KD 5EBLA 1OLZA 2FRGP 5D7KE 2IH3A 4X99A 2G5BA 5KJRL 4HXBL 4ZTOH 5JW4Q 4M7KH 1KNOA 1TJHL 5GXBB 2MHAB 3BEWB 3FQUA 4Y4FA 4GRLC 4KKCC 4WEUD 1NGXA 4KMTH 2IG2L 1Q9WB 3KS0J 4NZTH 3TBSB 5IB3B 1EUTA 1U95A 1YYML 4LKCA 3QUMH 4TUOA 4EOWL 3RDTA 4OF8A 4I2XE 5DJ8A 3RKDD 2FGZA 3QUYB 1FO0A 4WTZG 2AK1H 3CUPA 1A4JB 1K8IA 1DQLL 4DUWA 4GRWB 1SM3H 1RJZB 2AP2A 3G5YA 5E5MB 1FDLL 5DJ6B 1Q9KB 4QY8B 1RUQH 3TBTB 1TZIA 1PG7H 1BD2B 1CGUA 5C09A 4PLOB 2HLFD 2XNAA 4ODWB 1I1YB 3MRNA 1T2JA 5D2LF 3U6RA 4HFWA 2WWMC 4HJGA 3AREC 5C0RH 3E6HA 5C8JA 1XF3B 2FNBA 3LY6A 2MSPA 4PJ9D 2YBRA 4RGOH 3C5ZC 4CKVX 1HKLL 1N0LA 2WW8A 1LD9B 1UVQA 4RMUA 3UAJC 2ICCA 4Y88A 4PRNA 1DBBL 2V5RA 4X98B 5F9OH 1PLGL 2JLLA 4G9FD 4EVNA 3SDCD 2AEIT 2NY0B 4JR9L 2ZUVA 4UILH 2QADC 2G60H 4LSTL 3GI9L 3I3BA 5C0AE 4BSWB 1F11A 3O4OB 1XGTB 1QQDB 1EGJA 3MRHA 1LO0H 4JQVC 4N8VG 2PYEA 5H35B 5HI4D 1KIRA 2AI0L 2H9GA 1A6TB 4HH9B 2ZOLA 1CXKA 4DTGL 4DN3L 4GW5B 3DLQR 4HCRA 1KSRA 1QZ1A 3PDOB 2EYSA 5SWQB 2AJYL 1WVZA 4M6OL 1OGAA 4R26H 2D03L 2EYTB 4HC1L 3Q1SL 3T0EE 4YHZL 2DTMH 3ZKXC 4TTDD 3MGAA 1A6VL 1AGFB 1EV2E 2AEWA 3E6FB 5HYSB 1IQWL 4M7JL 3WXWH 4OF0A 1MRFL 5JLZA 2DJ4A 1M6OB 5CS7A 3G6AA 1LHZA 1ZHKB 1UWGL 3IF1B 3E3QE 1OSZA 1I3UA 2HRLA 4CUCA 1B4RA 5C0BB 4HWUA 4S1RL 2ESVB 4JANA 3MLUL 4IMLA 4O5LL 4XP6H 3TBWB 4DK3A 2Z91B 2WUBH 2YPLA 3BRGC 3DYOA 3VU2A 5HVFB 1L7IL 2PO6C 2NTFB 3SPVA 5I9QB 4ZAKB 4OCRH 3I9GL 4EI6A 5DURB 3FB7B 3CC5B 5CCKH 4OKVA 3SBWC 3SGKC 5FYKD 4WU7A 3L3GA 2FHCA 2CIKB 1MI5A 4YPGB 3V95A 3EGSB 3ZKQD 3MNVB 5KJRH 3FT4B 4HXBH 5IW6B 5HHXL 4J3OC 4JN2B 1I75A 4RFNC 1KIUA 1UFUA 2IG2H 1FNHA 3D3VA 4HGWA 3VXRE 1YYMH 4F9LA 3MA9H 4K9EC 4QCIB 4LLUA 4EOWH 1FJ1A 1FNSL 1KJ2L 1X44A 4NOBA 2WLYA 5HGGS 3D0LA 3LDBB 4LGSB 5JW4M 4NHUB 3DUHA 1G9MC 1FP5A 5TH2A 1FN4B 3RNKA 4JQIH 5FOBB 1CGTA 1FDLH 3FFCA 3GNML 1TNNA 3W0WB 1MCEA 5HI5D 4OJFL 5ICXA 3FB8A 4JRXA 2BSTB 4PJFE 2EDFA 2EDEA 5L7XL 4I0CC 4P5TA 4Q2ZA 1KPRA 3D2UA 4ZQKA 2I26N 4XPBL 4PR5B 1DANU 1JGVL 1A1OB 1NBYB 3TCLA 4L29B 2V7HA 4PJGF 5DEZA 5DTFA 2VWEE 4GRLB 5T1DH 4LLMA 3LPFA 2D7NA 3H7BA 3DUUB 1GPOL 1S7XB 1FYTE 1SMOA 3VFPB 3N0PB 4EUPB 3VWKA 1F42A 1TNMA 2RCSL 1FH5L 1HKLH 5DA0B 1YY8A 1FZJA 4KK5C 3GBNH 1ZT4A 1FFPB 1JWUB 3ESUF 4I3SL 4BK4A 3L3IB 2VAAA 4Z7OE 5L8LB 2DQGL 4HV8B 2Z93B 5HGBB 1CDYA 4Y4HA 1U9KA 1CF8L 1GZQB 1X6LA 4MJID 2CH8A 2QSCL 3GI9H 1BQUA 1JPGB 1AGEB 2Q86B 2NW2A 3TP4A 3M8OH 4NYLA 1JJUA 3DURA 3EYVA 4N1EA 4MDIB 5GRVL 4WFFD 4DTGH 2CK0L 4DN3H 4GKZA 4JM4L 3PABA 2DQJL 3AREB 2VLRD 2AJYH 1KGCE 1PD6A 3WN5A 3VXTA 4H5SA 5HD8C 4M6OH 3ROLB 2D03H 5DO2D 4YHKL 4BKLA 4YIQB 3DV4B 3Q1SH 4HC1H 2FBJL 4PLKC 3GUTA 4YHZH 3C5ZB 4I3GA 5D2NE 2IAMA 1A8JH 2BDNL 4JHAH 2DF3A 4P2QE 1F3DJ 1RD6A 3S35L 3VI4E 4M7JH 1ZEAH 2F74B 5EIVA 2ATKB 2XFXB 3C08L 1MRFH 4YBLC 1T7YA 4NO2B 2BOCA 3HHRB 3P4OB 3AS1A 2QADB 1UWGH 3OF6A 1GGIL 4S1RH 3M45A 1NAMA 2XN9A 4U0QB 4O5LH 4J1UB 1KV3A 4KXZI 2VO5A 4HKBB 2G75A 1FYTD 1S9XA 2VZTA 1GGBL 3V5KA 3RIFK 2NY6D 4MD0B 1L7IH 3VXOA 2D0FA 3L95B 3KPOB 4R96B 3ULVC 4G8FA 1KB5L 3LB6D 5A16A 3A6CL 1JF5A 1OY3B 2J4WL 3I9GH 2F5AL 5GGRB 4UTBL 4PRPB 1FFRA 1P84K 4U7KA 4N8CL 5T5NG 4PJEB 3ZKXB 2FEEL 1CFSA 1IBGH 1G7HA 5HHXH 3SQOL 4MMXC 1FV1B 3BZFA 4LPWA 4NZJA 2HJFA 4PYHA 4F2MA 3QI9A 4MA3B 4JPWL 2D31B 1GGUA 5FHBL 3S35X 3VGAC 3BPNC 2E9IA 3L6FA 2BERA 4DW2H 4CU6A 1TVHA 1FNSH 3BIBX 4JHWL 4BA8A 4CU7A 4X6CB 2O5YL 3BGMA 2W59A 3S96B 3VFTA 3KYKL 3PNWA 4UQ2B 5T3XE 1T89C 1B2WL 5DHVB 3QIBA 3FFCD 1XZ0A 1A64A 1YEDA 3GNMH 4F7MB 2PO6B 2W65B 1A7PL 3LKRB 3RWFA 4P2OD 3SJVE 1I3GH 3NTCH 1G1YA 5L7XH 2WUCH 1PKQE 5F6HJ 2Q7NA 3C5SB 4XPBH 4U0RC 2DQCH 2IBZX 5L8KB 1LILA 1FAIH 1I8IB 3GSXA 1JGVH 4HF5H 3U30C 3QUZD 5DT1L 4NQSB 4HH8A 5JW3H 2XWTB 1JGEA 4KQ4L 1X5XA 4RFNB 2E5EA 5ITBL 1GPOH 1A4KB 1EJ6A 2J88H 2Y9RT 1ZSDA 3GFUA 2Q8AL 5D5MA 5JQHC 1FH5H 1NPUA 4NZDA 1U8IA 3FTGA 5JW4R 1CICA 1HK6A 4I3SH 4UB0L 3MLVH 2JELL 2OX5A 4FQXD 4XC1H 2VLKE 4J3VA 2DQGH 4C56A 1MVUA 3RL1B 1YNKH 3DETD 5D5MF 4RBPK 5TDNA 1CF8H 3OJDB 1UB5A 2QSCH 15C8L 4P9HC 4Z7WE 3QWRA 1QO3B 3MV7E 3BN9C 5T3XH 1P4IL 5KVDL 4TRPH 5HVWA 4AH2A 2CK0H 3IDXL 4JM4H 5DK2B 3VGBA 1RIHL 2UY7A 3BMVA 5D2LB 1T2XA 2DQJH 3MUHL 4CJ0A 4OV6F 1MCWW 5HYJD 4HWZA 3UZEA 5KAQF 4BSJA 5E4IA 3WIIL 4RAVB 1T0MA 5E94A 4XNXL 3RPIB 1IFHL 4YHKH 2FSEA 1YNLL 2P5WB 5JPNA 2BDNH 4KK6D 2BHUA 3HB3D 3S35H 3C8HA 4U1JB 1G7MB 4B7LA 4KI1A 3GSQB 3C08H 2BSSB 3EJYD 4G8GE 2A6DA 2L7UA 1ULVA 3DBXA 3WD5H 5IEKB 4MCZA 4ERSL 3WNOA 3MUJA 2OXHA 3O6LL 2CLZA 1GGIH 3Q3GB 2FX9L 4KQ3H 4QHMB 5DEFA 4LLDA 1N3NA 4EDXB 3FRUA 3D39B 1A3LL 1CZ8L 4I9WD 5IB5A 2Q7YA 4LIQE 3VXMA 2OL3L 4PLJD 5MHSD 4I4WB 3VH8G 3L3HB 2OJEA 3UDWC 2BNQB 4LLQA 1XGRB 1Q72L 3EOYG 4MLIA 1BOYA 3LPGA 1KB5H 2Q76B 3QFJE 2CIIA 4DVRH 5LG1A 1VSCA 2APBA 4N8CH 4NRXA 2HT2D 3QUXA 5K9OB 4LRNL 5IROA 4MJ5A 1S9VA 4OFYD 4NWTL 2I25N 4Z78A 4L3CA 4FOMA 4DAGH 2QR0B 3J8F7 5LJYH 2DQFA 4P46A 3GHEL 2R29H 4HD9A 1R5IB 4PJXA 5SX4I 2MTPA 2JCCA 3MV7D 1ZGLP 3L5XL 3WIHL 4ODHL 4YBLB 4JPWH 4IHOA 5FHBH 1MSPA 3NZ8B 3PHQA 1NSNH 1KLFA 1Q94A 4S1DC 2NW3A 1TETH 4JHZA 3KYKH 2XPGB 1JZ3A 4L4VB 1F90L 3QIBD 4WDIB 3RGVC 1UJ3B 3U48A 1IAMA 4FG6C 3KPRA 4MD4A 5H37G 5IEHB 4KTDH 4K3DH 4HLZG 2PXYA 5SWSD 5ICYA 1J0YA 3VRIB 3LEVL 1HH6A 4XWOC 3ZE0E 3LN4B 1H0DB 1U3YA 4LIQH 1XGPB 3JWDL 5IMMB 1IL1B 5T5FH 5DT1H 3HC4L 1EHNA 3M17A 4KQ4H 1F00I 1GSMA 4LSVL 5CGYC 3O3AA 3BAEL 4LCUA 3AXLA 4L3EA 3VGAB 3BPNB 3GSOB 4WCYL 2Y7QB 4Z7VE 1MAJA 5DJAB 3NIDF 5IQ9A 5BS0A 3JTTA 3I3DA 3HC3L 1UZ6F 3DX7B 1DN2A 1A6WL 3E8UL 1FVEA 3W9EA 4AM0B 3MLTA 5BRZE 2IEPA 3G5ZA 1Y18A 5DVLA 4O00A 1LNUA 5E2TH 5DK3A 3MLWL 5CZXC 5EUOB 1QHOA 1SEBB 1GVIA 2VN7A 2Z4QA 15C8H 4I18C 5C0ND 5JHDB 1RUAL 2W60A 3LRSB 4NC1C 1UWEL 1TENA 4TN9A 4Y2DC 1EK3A 1P4IH 4L8CB 5KVDH 1CLOL 3OSKA 4U0RB 1N6QH 4PJBB 4PRIB 3IDXH 5MEND 3HZKB 4R90L 4DCQB 3U30B 3ZO0A 4RFEB 5D1QC 5I1KH 5C70A 2APVA 2YD1A 5DMKB 3KLAA 3NA9L 4N0UB 5GIRA 2B1AH 2V17H 3O4LB 3WIIH 4NQTA 1LO2L 2Z31A 1F2XK 4HX1B 2BNRB 4X9BA 3WFHB 3WBDA 1YNLH 4UV4L 4U1SA 3SDXE 4PGZA 5LGHL 3QBTB 1CTNA 1DBKH 3CSBA 5JXAH 3FZUC 3S3JA 1PAMA 4D0CB 5D7SH 3EBAA 4ENEC 4ELME 1V5JA 2ICWI 2CKBB 4HIJB 4ERSH 1TVDA 1EX0A 3H0TB 2XTLA 3O6LH 3P4MA 2IANE 4M61B 5IW1A 3V0VB 3ZYOA 1MIMH 1VKXB 1A3LH 1CZ8H 3BDXA 1EMTH 2OL3H 4N0FA 3RL2B 3AMKA 4H25B 4H0HB 1Q72H 2F5BL 1J8HD 1I7RB 2YRLA 3WE6B 5FDWA 3P3YA 1U8KB 3IFNL 3KWWB 4LRNH 1FFOB 1QSFD 3ZT5A 4NO3A 3TGXA 4FXKB 1NGQL 1XF1A 2X4TB 3S37H 1MLCB 3GHEH 3TBYA 5IBLD 5KSAA 3R1GL 5L0QC 5IB3A 5IB4B 4FMKA 4S1QL 3L5XH 3WIHH 1GRWA 4ODHH 3KYMB 4M4PA 5A2FA 5DMJB 2WP3O 4JGUA 3MOBL 1RJZA 5TPWL 1CDJA 4QY8A 4JFZL 3RWEB 3KYNA 2GI7A 5L2KB 4HUUA 5SV4A 5D9SB 1JI1A 2CQVA 4EI5A 1EAPA 3KHOA 4UNTA 3VI3E 5A2LH 2C7UB 3ARYA 3V7AG 2WNGA 2FEEI 1TZGL 3LEVH 3BUTA 3X13A 1QUNA 3JWDH 4UQ3B 5D6CB 1TFHA 2GTWB 2CUIA 4LCWE 3NIGF 5JXEA 5BW7C 4LSVH 4MHHI 3BW9B 2WINB 3BAEH 4OGYL 1BQHB 5HBBA 1ONQB 3MLYL 4QHNA 4GG6F 5HHNA 4YEEA 4F7TB 3HC3H 5TF1L 1A6WH 3E8UH 4HUMB 2R9HC 4OF3A 1U92B 3ARXA 1XGTA 2C3WA 3CLEH 1G0DA 4I13B 3TT3H 4GBXC 3RGVB 4XNMB 3MLWH 4YWGL 25C8L 1MFNA 4WHDA 5IIEA 2QQNH 4ZS6D 2FLBT 1ED3B 3ARFC 1TQBC 1IEHA 4B5EA 3KPSE 2DI9A 4XPHH 3UTSB 4I0PD 3LRGA 4B7IA 3NBNA 1RUAH 3HZYA 3TESA 4X4YB 4KVCL 4UUJA 5J3HD 1CLOH 2X70B 5F7YC 3U7YL 1YN6B 4M6ML 2Z8VC 4R90H 1VESA 2NY1C 2CRYA 4YGVB 2YD6A 5FUOL 3V5HB 3B9VA 2GK0A 4ETQB 4RMSA 3T2PA 3NA9H 5C0DA 2DQTL 2FDBP 1FL6B 4PRHB 1LO2H 1Z5LB 5DUMH 5I8OL 3VXPB 1M6OA 1LEIB 4KZEL 4UV4H 5BV7C 5LGHH 2HYMA 3PHOB 4K8RD 1N5AA 5ANME 1K4DA 1JNHB 1EHXA 2HJKB 1RUML 4U6HB 3T08A 3VD9A 3KVQA 5TDPA 3OX8A 4ELKA 4YDIH 4PY8I 1WBYA 3AS3A 1A3RH 1U3HC 4YE4H 4MJ6A 4AENB 1AJ7H 3QDJA 4I18B 4U6YB 4OLXL 2PYFB 4JFPA 2NTFA 3UPCA 2O5XH 1RK1A 2DICA 2NLJB 4Y2DB 1FZMB 3QXAA 5C2UB 3O2WH 2QJDA 3AMLA 3TVMC 1LEGB 1OB1A 3IJSA 2VXQH 1R5WB 4MNQE 4XWGH 4LPUA 3MNZB 4HBCL 5D1QB 1A7OL 2F5BH 3MRMB 5IJKA 2CIKA 3MBEC 2HTLC 1AP2B 2IF7A 3T8XB 2BVQA 3KPLA 3MNVA 3NPSC 3MRDA 3LSOB 3IFNH 4X7DC 3IVKA 4HJ0C 5EZIL 5DVNA 3TH4T 5EO9A 3IDIA 2Z35A 3ZL4H 5FYLD 1NGQH 2KUTA 1A6PA 1HYRC 3JVGA 4M9OA 4MCYB 4ZFOL 3U7WL 4U3HA 4QCIA 1IGIL 3EO1A 3RBSA 2R69L 2J2ZA 3QUYD 1U8PB 1YMME 4OCSL 4Q7DA 3GKWL 3R0NA 1NLDL 2SEBB 2Y72A 1KLGB 1EO8L 1QRNA 3MOBH 2ZPKH 5CSBA 3IJYA 5TPWH 2H32B 2HG5A 3AY4A 1TVBA 4JFZH 1S7UB 1BD2D 1JNNL 2DTSA 4LCYA 1I85C 5I1AA 1UXWB 1T20B 3FQWA 3IETB 1FORL 4MNGE 5F89A 2CLVA 1QACA 4ODUB 1G9NC 1DLFL 3QAZB 3HLAB 1QSEA 4HS8L 1RJCA 1TZGH 4JKLA 3G9AB 4PREA 2Z0BA 3WNKA 1HXMB 1WIPA 4BFBD 1EVUA 4PJ7E 4TNWK 4H0GA 1BIIB 1W72A 1S9WA 4J3SA 5C0CB 3VFPA 5L0QB 4EUPA 3QG6B 2ZUYA 5ECJE 4LAQL 1HHHB 3GJFK 3QPXL 4OGYH 1NKOA 2BP3A 1IGJB 5J1TC 3OXSB 4MHHG 2NY0D 3MLYH 4NDMB 2VISA 5HGBA 1YNTA 2IADB 5TF1H 1ZVSB 3QIUB 3L5JA 2CMRL 3KPMB 2CLRB 4L5FL 2G5RA 4BZ1L 5EWIL 3RVTD 1MHHB 1XGQA 4YWGH 5J12C 5FM5M 25C8H 3O6FA 5C0FB 35C8L 1BREA 1KIPB 3V8OA 1BVLA 4K3HA 3IAPA 4KVCH 5BO1L 3MNWA 1MOEA 1WAAE 3U7YH 4BK5A 4M02A 1VFBA 1E4KA 4M6MH 3ZDZE 3ROLA 3UBXI 5K59E 3DV4A 5FUOH 3BKCL 2DI7A 5BVJA 2UVFA 2DQTH 3B9DA 4P59L 3ULUC 5I8OH 5E8NB 2O5ZL 4KZEH 3KLSA 1BPVA 3RVUC 5CWSA 4BM7A 4X9IA 5GGUB 4PV8B 5IFJA 3ILQC 4LOUC 4MB3A 5C0BD 3EZJB 4FFYL 5ENWB 1AQKH 4FFZL 1S78C 5GZNC 2ESVD 4JLRB 2IC2A 1RUMH 5FM4A 3L7EB 4U7SA 1NGYB 5E9DB 3N50A 2WAHA 1MUJB 3ARFB 2OJZH 2A1WH 1TQBB 2X09A 4MD0A 4FQCH 4DJMA 2ZCKL 1M7DA 1MHCB 2X4UB 1OSPH 2D7TL 4ZAKD 1HIML 4V2BA 3EO0B 4S0TD 4W70A 5DURD 4ORZC 4TPRL 4U1NB 5ACMA 3DX8B 1BIHA 2NY1B 4HBCH 3QRFM 3SKNA 1A7OH 1BZ7B 1JYVA 3L3KB 3LEXA 5KVEL 4CNIB 1DEEA 5BQ7A 2VQ1B 1DQJA 1HOCB 1FV1A 2EIZA 2IMNA 3JV5A 2C1PA 5GGVY 2GW5A 4G6FB 2A77L 5BV7B 4Y19A 2ADFH 2ICEB 4HFUH 2EH8H 3U7WH 3LEYL 4IRSC 1IGIH 3V4VH 2R69H 5FYKU 4OCSH 1IAKA 4E0RB 3N85L 5MEPB 1FE8L 2X7LB 3GKWH 1NLDH 2K3TA 2W1NA 4I77H 3T09A 1U3HB 1DCLA 3W0WD 2RBLA 3WEXB 4F7MA 3BZ4B 4JO2L 2FO4B 4HULB 1JNNH 5DYOA 5FGRA 3TVMB 3OJVC 4YHIB 1UM6L 1ZT1B 3SGKA 2IFFL 4QXGL 1JZ8A 1DN0A 4G5ZL 3CFBB 1IM9B 2AV7B 3MBEB 5IHLB 2VDOL 4Y5XC 3DI2B 3NPSB 1U3ZA 1ORQB 4K9EL 4PBWD 3CDYA 3U46B 4GRLD 1T7VA 3CXHJ 3IU4L 1BOGA 5C08E 4KKCD 4Y1AB 1MCJA 3RIAF 5F9JB 1G9ML 2W0KA 4PJAE 3HE7C 4A2LA 5DRWA 3H9HB 4LAQH 3U0PB 3C87A 1M71A 1S7TB 3S36H 3QPXH 2DMCA 4PP1C 1MCFA 1MJUH 3CVIL 4LFHG 3DTXB 4PJCE 1DUYB 2CMRH 1BF2A 3BVNA 2N4IA 3RY5A 3X12A 4BZ1H 5EWIH 1I7ZA 1KCUL 1CD1B 4MQTB 2EYRB 1FNFA 3C6LA 3EO9L 2EC9T 2WWMD 1OW0A 3ARED 4TUJB 5BO1H 5LGKA 2D7PA 3X11B 4WI3A 1J87A 3H8NA 4POYA 4RAVA 4RNRA 3C5ZD 5K33A 3FB6A 4NC0B 2ZSWA 1QLFB 4ZSOE 3BKCH 4WWKA 1VFUA 1PZUB 3UAJD 3EOBB 4NPYB 1LWRA 3SDAA 3OJMB 4AT6B 4P59H 4EBQL 4URTB 5HPMB 5JDSB 3HC0A 3I6KB 5MERA 4PJIE 3MRLB 1PW3A 2EDQA 2QADD 3U1SL 2YSSB 5DUPH 4NQCA 3OAUH 1BBDH 4FFYH 5I2IA 1Y0LB 1S7QB 2VZVA 4RSVA 1XCTB 2C4FT 1NGWB 2F19H 3RA7H 5J12B 1A21A 5ITFA 1N2RB 2X4RB 1OAKL 1EGJL 3IFLH 1P4BL 1MQ8A 4JAMB 1EFQA 4I4WA 3SO3B 2ZG3A 1J12A 2BNQA 2ZCKH 2D7TH 3MRJA 1NAKH 5AZEL 5CJ5A 3IDJB 4PRPD 4ZUUB 4F7PB 1S7RB 4TPRH 2YUXA 4QGTA 1OF2B 4DEPC 3E0GA 1FVCA 1ZTXH 4U1MB 1FG9C 3RWIB 5GJTL 2FX8L 2R23B 5IJVB 5KVEH 2OSLA 3KPTA 1WGOA 3TCXA 5F3BA 3DUSB 5DD0L 2GHWB 1JHTA 3RTQA 2JIXA 4WVRA 1P69B 2HFGL 3MRQA 1RFDL 4Z8FL 4F80A 2A77H 2Y4SA 3UJTL 1G6RB 1KEMH 3LEYH 1EVTC 5DD6A 1P7QB 2YA2A 3HMWL 5CIPH 3S4SA 3N85H 4QYOB 5F93C 3OXRA 5C09E 1R3JB 1UJ3A 4LF3B 2PO6D 1HSBB 2B39A 1AH1A 4JO2H 4KDTC 1N59A 5FCUL 2XZCH 5FECA 5HHME 3KDMB 4M1GH 5EU4B 1UM6H 1BJ1J 5F9AC 4CRPA 2IFFH 4Q58C 4QXGH 1JPSL 4G5ZH 2H26B 4EDWL 3MRKA 4OCMC 5F96L 5HDQL 4HKZA 3PL6A 3N1MC 2DIBA 1FNGB 2D9CA 2VLLB 1V3MA 3HI6L 4LCIL 1U8JB 3CPLA 3IU4H 4YHML 4HLZH 3U4BL 4ZFZB 4PJ5B 4NNYB 3VD4A 1JPFB 3UTPD 1IGTB 4R7NB 3ZT6A 5E8OA 3A6BH 5IHBA 4IRSB 5L88H 1NUFA 3ZSSA 3GMNA 1SYVB 3O41A 4BQBA 3F7VA 3N1PC 1FO0H 2PYEE 5IT2L 3D85D 3GMMA 5CEXB 1OD9A 5EUKB 5C1MB 3TJEL 2DLEA 3PWPB 5EUOA 1D3CA 3MA7A 3WCYA 1LO3H 3TNNB 2XXCB 4X7FC 5JHDA 1RVFL 3LRSA 1KCUH 4X5LA 4ALAH 2P8PA 5HHOA 2IQAA 4J23A 4PJBA 5FIEA 1OGAE 1I3RB 1DQDH 1WC7B 4NCC1 4Y5XB 2VJXA 4EIGB 5TQ2L 4GXUM 4ZODA 4POUB 3WIFB 2ZUWA 4XCNA 2I9LA 1MF2L 1VPOL 3S6CA 4E41B 4H1LB 3HE7B 1S5IH 4CVXA 2P5WD 1U6AL 3OKDA 4KK5D 1BEYH 1JWSA 5T1KA 1SVZA 3QJHA 4ZDHA 5E4EC 4EBQH 4P9HL 1J5OH 3SKMB 1BMGA 2FBOJ 3U1SH 4EXKA 2YPLE 4I5BA 3ZT7A 2ZSVB 5L2JA 4PJDF 5A43C 3QCUL 3CX5K 4LSSL 5GS2H 5LWYL 3NACL 1C5DB 3GM0A 1GOGA 3D39D 4V1DB 3OKEB 2FZ3A 2JE8A 4ZOBA 3GO1H 4Z7NF 3U9PH 1EGJH 1U8MB 1F3RB 1P4BH 4JFDA 4J3XA 4DZBB 1HILB 3WFBL 3OG6B 5AZEH 1FPTL 5I0DA 5F9WC 4HCRH 3GSRA 5HYSG 5HD8D 3FONB 3L3DB 1TITA 1U8KA 4PJ8C 1MJ8H 3KWWA 3C5JA 4PLKD 5J13C 5FKAA 5SX5H 5GJTH 4FXKA 3RY6C 2DQHL 2EEAA 3D3VE 1Q9OB 5DD0H 4L9DA 3KHQA 4UNVA 2HFGH 4WFHD 5EU6A 4UT7L 5EU3A 3MRCB 3BH8B 3NCYS 4Z8FH 2AJXH 2XKNB 3D69A 2EXYC 4P4KC 2BK8A 2LVCA 2DLGA 1AIFB 5TF0A 3HMWH 4OGXL 1NMCC 4JRXE 1CT8A 1YJDC 4NN6B 3BE1L 3L9RB 4L4VD 1NAML 4PJGE 4OSUL 1Y6KR 5L2KA 4E5XB 1AFVL 3DGGB 4KROB 1ADQL 5D9SA 5E03A 2PW1B 3ULVD 2O26U 1LEKA 3VW3H 2DYPB 5FCUH 2FJGA 4AZ8A 2ERJC 1F6AB 3LQZA 5JPMA 3N1GC 4NN5C 5CP7B 5ETUB 2D4DA 3LS5L 2ZNWA 3Q5TA 5F9DC 1JPSH 4J4PC 4EDWH 5HGAA 3T2OA 2UUDH 4OBSA 3JV6A 2J3SA 1C5CL 4PIRF 4KVNH 1IGCL 3EIFA 5D6DA 3HI6H 4LCIH 4OQ1A 4XNQB 4YHMH 5INCB 5C6WH 2E9BA 3NABL 1IMHC 3U4BH 1WIOA 5KZCB 1JN6B 4LHQB 3MJ6A 1V8HA 3OKMA 1S8DB 1OAYL 2MCPL 2X9XA 2LU7A 4WFGD 4HZLB 1X5LA 1FLTX 3FN0L 2R0KL 2VZ1A 5GRZA 1RZKC 4L8BA 3WLBA 5BZDA 1BBJB 3K4AA 5IT2H 3ARGC 3BUYB 4D0BB 3TJEH 2P42B 2ITDB 4S2SA 4UDTA 2BFVL 2YEZA 4ZUVB 2NY4C 2A9NH 5T1LA 3D18A 1ZLUK 4HUXA 5JHDD 1LVEA 5E99L 2EO1A 4DGVL 3ILPA 3PV6A 4X4YA 3O2DA 4P5KA 4PRID 4KV5F 4FFVC 5TE4H 3Q6FB 1OM3L 3RUGB 2NR6C 4EUPG 4IIQC 2NQCA 4XAWL 5TQ2H 1JTTA 3V5HA 1ROWA 5JOPD 2IMMA 3RI5K 2F54A 1R24B 3O4LD 4DFHA 3SKOA 4YBHA 4NZUL 1FL6A 1MF2H 1WQVT 2BNRD 5TDOB 3EYQC 1IZJA 5C0EB 5DJ2A 4XZUA 4A6YA 4DGYL 1T5WB 4TQEH 1GAFL 2AJUL 1FL5A 1UGNA 3CVHA 1A5FL 2XN9E 2HJKA 4LVOC 1I8KA 2P46B 1YC8A 1T3FA 3L7FA 4QHUA 3QPQC 4PGEA 4LSSH 5GRWA 3VXNB 3NACH 3C09C 4U6YA 3BHBA 5KSUA 2FCBA 4NKMB 4Q9QH 5I1HL 5CGMA 4M3JA 3BN9D 4CADA 4LMQI 5C07A 3G6DL 3W39A 1EZVY 4LHJB 1D9KC 1NCAH 5E8PA 4WO4C 1FPTH 3LKQB 1CG9B 4FQJH 1NC2B 3L5WB 4L1HA 2X4SB 1ZOXA 1L7TL 2AKRA 1HQ4B 3V6OC 1XGYL 5F1IA 5JOFB 1P1ZA 2DQHH 1JZ6A 4KY1L 3QQNA 3HE6A 3CSYA 5E4EB 4UT7H 4OB5L 4XXDB 2IH1A 1FIEA 2AEQH 3BESR 3SGJC 4QHLB 2IGFL 1QFUL 3HUJA 4LASL 4M4RA 4DKFL 3QO1A 1I1AC 1W0VA 3LKPB 2JB5L 4Q6IC 1IEAB 2FH8A 1NAMH 5HHQA 4OV5B 4LHUA 2K7QA 5KTEL 4CU8A 3CDFA 2X41A 2VC2H 5F9WB 3G6JB 3W2DL 5I8KL 5GRVK 2BY2A 1U8LA 1WFTA 4PJ8B 1HXMA 5J13B 3WS6C 1U8NA 5CZKA 5D5ME 1RIVL 3QG6A 1S7SA 5LBSL 3MRGA 2DIJA 5D1ZA 4FZEH 4P4KB 3AAZA 2N1KA 2WK2A 3K1KC 3OXSA 4C56E 3PGDB 5CBEB 3AROA 1QYGL 1MFEL 4NO5B 4S1DD 1C5BH 1NMCB 3N1FC 5E8EB 4XPGL 3QIUA 3FN0H 3MROB 2R0KH 4F9PA 1TXKA 3PDDA 2AEPL 32C2B 4DQOL 3RGVD 5B3NA 3QDGB 4FG6D 3HAEB 4APQA 3JTSB 5C0FA 3UTSD 1WT5C 2I60L 2R2HB 3QZWA 5F6HI 1DUZB 1VHPA 3RVXC 1ZHBB 2ERJB 5E99H 2AXFA 3RZWA 4NN5B 1G7LB 4XP4L 4XWOD 5J89A 5I30H 4WI5A 3VFOA 4ACPA 2ADGA 4MAYC 4CVUA 3HZMA 1VA9A 4QTIL 1OM3H 2W0FB 1MVFA 4XAWH 3A67H 1O7VA 5JIIA 5DVMA 1W0YT 5CGYD 4G42B 4PRHD 3VG0H 1V05A 2F53A 3DX9A 3RQ3A 3F7RA 3VMOA 2EE3A 2JK5B 3HG1B 3G5VA 3F6LA 4GMSL 1CN4A 1GAFH 4S0SD 4YR6B 2AJUH 2VXUL 4KMLB 1A5FH 3DNKA 3PWLB 3MFFB 3QXUA 3QHTC 1MCRA 3KXFB 3MJ7B 3KPQB 3QEGL 3ARGB 2IBBA 3PP4L 1NGYA 5E9DA 5CZXD 5C92A 3BQUA 4KI5C 3VXME 2CDGA 1A7QL 4X0KB 5A1AA 2NY4B 4RZCB 4X5WB 3I85A 5TE6L 1T2QL 3EYUL 4R9HA 4JZNA 2XT1B 4WEMB 1OWRM 4QF1A 4Y2DD 3LN5B 2OK0L 3G6DH 3O3EB 2OR9L 5D7LB 1P4LA 3O8XA 5E00A 4P4RB 4IIQB 1TJIL 5D1QD 3RWCA 1LO5A 3MYJA 5IMOB 5SWZB 3L3KA 5MEOB 1F2QA 1W0WA 2WBJA 1FG2B 4PJXE 1L7TH 1ZE3C 2JCCE 1T0NA </