4MD0B

Immune receptor
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
189
structure length
189
Chain Sequence
DTRPRFLEQVKHECHFFNGTERVRFLDRYFYHQEEYVRFDSDVGEYRAVTELGRPDAEYWNSQKDLLEQKRAAVDTYCRHNYGVGESFTVQRRVYPEVTVYPAKTQPLQHHNLLVCSVNGFYPGSIEVRWFRNGQEEKTGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSLTSPLTVEWRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A molecular basis for the association of the HLA-DRB1 locus, citrullination, and rheumatoid arthritis.
pubmed doi rcsb
molecule keywords HLA class II histocompatibility antigen, DR alpha chain
molecule tags Immune system
source organism Homo sapiens
total genus 42
structure length 189
sequence length 189
ec nomenclature
pdb deposition date 2013-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00969 MHC_II_beta Class II histocompatibility antigen, beta domain
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4md0B02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 4md0B01
3TM6A 5DWUH 4NM8H 5KG9A 2C1OB 4JKWA 5T33L 1WQVT 3ARGB 3UDWA 5BV7L 4QHMA 4APQA 1JPTH 1MIMH 4UOW0 2UZIL 5JMRA 3S3SA 4PJ8C 3L9RA 4DVBA 1BF2A 4WI6A 1H5BB 3BP6A 3BDXA 4X8XA 4YHZL 5IQ9A 3OKDA 4NKIL 2L7JA 3L3DA 1I1RA 5L6YH 1CGVA 5IB4A 4E0RA 1AGFA 1AKJD 3GEWB 2Y5TB 2BSSB 1N6QL 5FYLD 3SDDC 4ZYKB 4OF7A 4P2CG 1J0ZA 4OI8A 5L7XH 3GBNH 5IHZA 3HUJF 1S9YA 3A0OA 3H9YA 1L0QA 3JVGA 3PDOA 4QHLB 4OD2B 1DFBH 1RIVL 1CDHA 3LQAH 3C2AL 3TYGH 4CVXB 3I6KA 3O6MH 5I15H 4NUJB 4WEBL 4HZLB 3H6JA 2VSDA 5E94B 2NZIA 3ULUD 1A1MA 2DJSA 2GK0B 5GHWL 2E3VA 1KFAL 4L3EB 4CVZB 1VFAB 5E8OA 3VWKA 5JXAH 1XF2A 3HI1A 4OLVH 2IALB 1CLOH 1KNOA 3G5VB 1PX4A 1KBGH 2LVEA 4U7SA 3U4BL 4P59H 2DQIL 5GRVL 5HYIA 3HC4H 4QCIB 3REWB 4XMPL 3VGEA 3BZFB 5D7SL 2PF6A 3V8OA 3OGCB 5IGXL 3WS3A 3GSXA 4H88H 3VXSA 4O00A 1TJIH 4OQTH 4F8QA 4KVNL 1N5AB 2C3VB 1P7KB 2VUYA 4N1CA 2Q7YB 3VRJB 2P8PA 1FIGH 3QEQD 2I07A 1YEEL 2EC9U 1KG0A 2HFFA 3BSZL 3GMQB 4WU5B 2F8XC 4G42B 2ITCA 4FXKB 5FO9B 3MRMB 43C9A 3BQUC 4JFZL 4YHIB 1G7IB 3QEUB 4LEXL 1KLGB 3ZO0A 2UUDK 3TH3T 5IFJA 1FIEA 5F88A 3C8KB 2CR3A 4OFDA 1PQZA 1A6ZB 4UT6L 4HIIB 5IJVB 5IM7B 1CGSL 2UV3A 3DRQB 5D6DA 1DQQA 2IAMB 2WWMD 3L5JA 4K7PX 4TNVF 3HNSL 3QDHA 2FL5B 5GGTH 5FF6B 1MOEA 4Z7OE 4TYUA 4ZSOE 3OKMA 1ZA3A 3KPQB 1K3ZA 5LQBH 1P2CB 4KQ4H 5DRWA 5D93B 3MRRA 2AW2A 4X4XB 3CMOL 5E6ZA 1BBDH 2E9JA 1N2RB 4BFEA 4AT6A 3LD8C 1KB5B 4DN4L 1DANU 3G9AB 3D39B 3BMVA 4XP1L 4PUBL 4YFLI 3RTQB 3GMRB 3WEXA 4I1NB 3ILPB 3HZMA 1K5NB 2CRMA 4Q0XH 5E00A 3WS6A 1J5OL 4NKOB 1ACZA 2UUDH 4XNUH 2AJSH 3IAQA 3IETB 5HHMD 4OLYH 4UDUA 3WYRA 4YO0A 5C2UB 3U7WH 2EYSB 2VC2L 4G6AC 4K8RL 4D0CB 1OGAD 4JFPB 4WU7A 1ZT1A 4Q9RL 2DLEA 4ODSL 2EXWC 1CCZA 4NRZB 3WNKA 3RU8H 3F7RA 3L3OA 4HUNB 1BECA 3MJ7B 4Y5VB 5DEGB 1NMCB 3KPLA 5SWSB 3SKNA 4NZRL 4HGWB 5EN2B 4EXPX 1IAII 3VFWA 3Q6GH 3MGAA 5E8PA 3O3DB 3GJFA 1KELL 2VSCA 3MRBA 3GRWL 4FQXC 1TVDA 3GI8L 1IGJB 1EHAA 1H3UA 2GW5A 4MWFB 3VRLE 3U46A 3CX5J 2V9TA 3ARQA 3QUXA 1VFBB 3K0WA 2G60L 1S7SA 4QRTA 1LMKA 3QR2A 4EI5A 1U8OA 3OG6B 4XCFL 2E7MA 3W5MA 5KSAA 3RQ3A 1KTDB 4V1DD 4NZTL 3TN0A 3QIBD 3QAZB 2Q6WB 2VLRA 2EH8L 3QRFM 5DD0H 1KCLA 4XVJH 1YNTB 4BKLA 3LS4L 5JDSA 3CGTA 3C6LB 4XNMA 1I8KA 4NO5B 5IESL 4PJ9A 3D87B 3P0YL 1HWGB 2WINB 3OKLA 4NM4H 3RKPA 5CIPA 2W65A 1B0RB 3D69B 1MCNA 3D3VB 3MRNB 5JXED 5L0QC 3FO1B 2A9NL 5IG7A 4HK3N 2FSEA 2NTSP 2BVTA 1OAKH 5CJ5A 5J13C 3FONB 4YDJB 3HNTL 2IBBA 4J7RA 1R3JA 5FGSA 1UB6B 2C4FU 3ZMRA 3ARWA 5M7QA 2QR0A 2PO6D 3AM8C 5HVWA 1JPST 3T1FB 3V6FA 1D5MB 5BS0A 2HTLC 4EQ3A 5F1IB 3BD4A 4MAYB 1BIHA 1WWAX 4LSUL 1IBGH 4Z7WA 3FQWA 3HLAA 2CKBH 5T3ZH 2WMPA 4OLUH 4N0FA 5KJRH 4PJGF 5T5FL 5C2BL 4LL9A 1I9JL 4XNXL 3JTTB 2P1YA 4KJQD 3SKMA 3LS5L 5IOPB 1X4YA 1BOGA 3L3IA 1JV5B 5A2IH 5B3JE 3M1BB 1NCDL 5MENE 3OXSB 4XMKL 5CJQH 3ZDXE 1AHWB 2WBJD 1A7QH 1ZHNB 4AH2A 3QNXA 3I02A 3G5XB 2E9BA 2K7PA 5DJ2A 2VZ3A 2X09A 1G7JB 4NN5B 4ZNCD 1UJ3C 5B38B 2Y4SA 4OUUB 3MRGA 1YPZF 3ARDA 4JLRA 3TWCL 2R15A 3QEHA 3SE4C 1QSFD 1L9NA 3DLQR 2P44B 3HMXA 5EU6B 3SGKA 3BRGC 3HG1B 2HFGL 1BVLB 3ALPA 4RMTA 2XZCL 2YC1A 2IFFL 2NY6B 1IMHC 4ZFOB 3SCMB 2IH1B 3MRKA 2IPKB 5FB8A 4JZJA 3I75B 5I1EH 3EJYC 2COQA 4HWEH 1NFDF 1KF9B 1RQ5A 1S3KH 2YA0A 2J2ZA 3IFLL 3LIZL 1LGVA 5K9KA 1QBAA 4YC2B 2GITB 1E27B 3W81A 2XKNA 4HIEB 1A8JH 4PTUA 4PV9B 1ZHBA 3HS0A 3SOBL 2NMSA 5GGUA 3WJJA 1E6JL 2FDBP 4KGJA 4C59B 4O9HL 4MA8H 1R5VA 2NNAB 2A74A 2RBLA 2HRPH 3E2HB 2DDQH 4PLJC 4U0RB 3DRTB 4KKAC 5GIRB 1U2HA 4JDVA 2ADIB 1TVBB 1MRCH 2G5BA 1S78D 3WFEH 1TNNA 4HIXL 3GHBH 4XPFL 1KEMH 5IMKB 4LP4A 5DRXB 4YDIL 3UTTD 2AJZB 3LKOA 4Y4HA 1MCSA 4XRCA 1OARH 3IJYA 3SE9H 3I50H 2AEQH 1CE1L 4LU5H 3EBAA 2A1WH 2R2BA 4LHJB 3TVMB 4CN6A 4F15C 5DC4B 1QRND 1ETZB 5DK2B 5MENA 5T1DH 1N3NB 2FJHB 3HZYA 1MQKL 2VQ1A 1MLCB 1YEDA 3ULUE 3MGTA 3MQIA 3LDBB 4DZ8B 1BAFL 1LK2A 3K2UH 5DRNA 5IW3A 4ZUTA 4G43A 1DDHB 4U1HB 4PP2B 3U2SA 4Y5YB 2DM2A 4RQQA 2WIIA 1J0JA 1A1OA 1S9WA 4OQ1A 3NIGE 2IG2H 2HJFB 1D5XA 3QUMH 2X05A 3GNML 3IGAB 1A7OL 2D03L 2GFBA 2YKLH 4HJ0D 5ESQA 1KSRA 1HHIA 2J6EA 1I3RA 5FGRA 4DOHB 4OZ4B 1OSPL 3RWJB 2R2EB 4HUWA 1CDJA 5ACMA 4OT1H 1XT5A 3QEQE 4R2GB 1P4LA 4N0RA 4OKVA 3FO0H 4QHKJ 5IV2B 3GZKA 2XTJC 3U7YH 1J12A 4XTRD 5F96H 2OR8A 4KMQA 5B39A 3CPLB 1KCSL 3OKKA 3D2UA 4D8PB 4JZNB 5TF1H 2EC8A 3FB5A 5TH2B 3FB8A 5CEZL 4QT5B 1WJ3A 2WLZA 2J5LB 5E08L 1IM9A 5I66A 5I30L 1QEWB 4YFEA 3ZDYF 4MQ7B 2DOCA 4IOFD 3CLEL 2NY1B 3QG6A 4UINL 5C0FB 4XPBL 3MRIA 5DD6B 1RIHL 4MQTB 1KPVB 4Z95L 2X70A 4PJEA 1I85C 1HHKB 2VDPL 3IVKB 4QHNB 1JRHI 3X3FH 5FOBB 1MHHA 4WW1B 1T21A 2DYPD 2XQBL 3KLAB 3MTRA 4GO6B 4JHWH 2ATPB 3RP1A 3TVMD 4GAJH 3X11B 5BO1H 3C5ZA 4LIQE 3EUUA 3HRPA 3CVHB 1UT9A 4M9OA 5DXWA 5T3ZD 3RL1B 1NBYA 1WIUA 2PCPA 4N0UB 3CFIC 5HDBE 5DTFA 1Q94B 4BH8B 5HHME 4XGZB 2BOBA 3QA3A 5C8JB 4JDZA 1YEGL 1JPSH 2CSPA 4ONFL 3QNYB 1OGAE 2CDFB 2IAMC 1UEMA 4CW1A 4U6HA 1WT5A 4Z77B 2X4OA 4GRLB 4NGHH 4NCDA 4Q9QH 1ZT4A 2CIIA 1XCQA 1CR9H 5J1AB 2DQUL 1JYWA 4ZQKB 3I9GL 1FFRA 1A7NL 3DETD 1NGQL 4IMKC 5L2KD 4LLWB 3NBNA 1D5ZB 5MP6H 5CP7B 2H3NA 1M7XA 3BFOA 5DVLA 2DMCA 2X4NB 3LPWA 4Y19B 1CI5A 4HF5L 1BZ9A 7FABL 2VRAA 1MCWW 5D7JD 5BMFH 1P4BL 1ZS8A 4OCYL 2Q8BL 3ARFB 4KK9D 2OZ4L 3WIHL 3P4OA 3WV0A 1BM3H 1Q0XH 1T1XA 1F6AA 2ZOLB 3GO1H 4QRPA 5JPMA 4N8PA 4IRJB 3RPIB 8FABA 2HT2C 1WAAF 2BVEA 5ADOH 1TXKA 4V1DE 1WFUA 3DWTA 4XZUA 1X5LA 4XX1G 1LE9A 4TQEL 1A5FH 3LQZA 3OZ9L 3G6JA 4OAWA 2X9WA 3C09C 3TYFB 4E41B 4P2QD 1KIRB 1LO2L 3O6FD 4S1QL 2XPGB 3O9WB 2XN9D 1FL3A 2D31A 4ZS6D 5AYQA 3M17B 2OSLA 2ESVB 4G6JL 4S11A 3FZUD 1FQ9C 5ECJE 4FA8A 3LN5B 1R3IL 5IJKA 3VFSB 1HEZB 1OTUD 4AQOA 4XBEL 2Z31D 5FEBA 2QV2A 3P2TA 3DBXA 4BZ2L 1KC5L 2KQMA 4M6NH 1AXTL 2ICWB 5EWIL 3PDDA 3EJZD 4WY7H 4HH8A 3QAZC 3DIFA 3P9MA 5KSBE 2P8LB 4JQVA 1X5YA 4ONOA 4HW6A 5IMOB 4NZUL 1A9BA 5C07A 5IEHA 4FTVD 2EXYD 3FB6B 4YHNA 3UTZB 4M43L 3LRSB 4I5BA 2NXYC 2VNCA 4HKXB 5IB3B 3W5NA 4MD4B 2J8UA 2AQ3A 4LSRL 5JO5B 3MODL 5BQ7A 5DHVA 1K4DB 3RWEB 5IMLB 4N0YL 3PV6B 4RMWA 4JM2D 4M1GL 2OP4H 2P5EE 4N5ED 3VXOA 4JGUA 5HTSA 3QNZA 1UYWH 3TGXA 5J6HB 1NCCH 2WBWB 1QSFE 2LABA 1DBAH 1RUPL 2A77L 3CFDB 5IVOA 2XWBA 5IFAH 2A38A 3VWJD 2EIBA 3N1GC 4KV5F 3HMWL 1CYGA 3EHBD 2H45A 3WFDH 2VDMH 3K80A 1C5CL 2EYRA 1A6WL 1GGUA 2EDBA 3FFCB 4PBVC 4OM0L 1AHWC 3RZCC 2DKUA 3S88L 3L95A 1G0XA 4L8DB 3ULSB 2EDRA 4J1UB 1JGVL 4NN5C 4F2MB 4PG2C 1D9KB 4NQEA 5A16B 4LPUA 5GJTL 1RD6A 4QTHA 4XB7A 4BSVB 3RUGA 1D3CA 3PNWA 1DBJL 4L9LA 4AMKL 2NQCA 1PZ5A 4QRQB 1GGIH 3BUTA 3BI9X 4L1HA 3UTTE 5I1HH 2NY6C 4GMTL 3NCBB 3QH3A 4OFVA 4YUEL 5C7XL 3SCMC 1EJOH 3ZYJA 3FHQA 3A67H 1QRNE 3PXJA 1DQML 1RZKL 3AREB 5ICYB 1U8JA 1WLHA 2E6JA 2OTPA 4ZFGH 3BISA 2Y7QB 1WBXB 2OCFD 1JFQH 3A6CH 3ARXA 2ZWLT 4X6FB 4X6EA 3PL6A 4GW1A 1DLFH 4ZODA 2GTZA 3E2HC 4U0RC 4JRXB 5HI3C 4QHUB 3PGCA 5D2LE 3TCXA 1HYSD 1SEQH 2DICA 2VLMD 2P5EA 1MLBA 4X5XA 3OSKA 2X1QA 5DDHB 1C5BL 3MBED 3K81A 5FUZL 3UTSB 1WTGT 3V6OA 4EIGB 1C5DB 5ICZB 5D1ZA 2VLJD 3RWIA 3MV7D 3HMXL 1MIEH 2EDKA 5IKCB 1OW0C 1XR9A 5DJZA 2QQLH 4MB4A 3FT2B 1UM6H 1YJDC 1GIGL 4I0PB 2C3HA 2GJ6A 4FQQA 4KHXH 1A6UH 5F3HA 3S9DB 5CWSA 5IF0A 1TJGL 3B6SB 4PGBB 3TJHC 3HNVL 4LF3A 3UTPD 4LSPH 3W39B 1UCBH 3LDBC 3A6BH 3EW3B 3PE9A 3GSOA 3DUSA 2OL3A 4MQXD 4NQVB 3DTXB 4Y5YC 2AK4B 3ZTJG 1IE5A 2WIMA 3LEVH 4WWKB 3IJSB 5C70A 2F19L 4TULH 1FZKA 2NY4D 2NYYD 3I3BA 4F7TB 3K8KA 2NY2B 4GFTB 5E6IB 4MXWL 3QQNA 4NKDA 3EYUH 4QRSB 4OLZL 5IVZA 4E5XA 1JNLL 3QPXH 3SDCB 1DN2A 1QFWH 3MJ9H 5E8EA 1CXLA 4AEHH 4G9FB 4R2GC 2BNQE 1CT8A 5TDPA 3T0EB 3AC0A 4Q97A 1DJSA 1IM3A 1EO7A 1MFAL 1MHCB 1A1NA 2Y9RT 1FNHA 1YN6B 1ZV5A 3NACH 4WUKH 3O2DH 2OXHA 3JWOH 4Z6AT 5T3ZE 2DIJA 4JY5L 4JPKL 4LCWB 2NY7H 3F65A 3CH8A 2NR6D 3KYKH 1A6AA 1XMWA 4X7SH 3O3UN 3MA9L 2J5LC 3TESA 3W0WB 1FRGL 2QQQA 4YFLF 5EPMB 5EU3B 5KS9F 3DVFA 4QGYA 1A6TB 2PKDA 2NY1C 4P9HH 2Q20A 5K9QI 3RDTA 4TN9A 3MLUL 1UH4A 4TVPH 2XXMB 5DYOA 3WIIH 5LWYH 4M8VA 3QIUD 3JTSB 4P4KA 5GSVB 4OM1L 4OGAC 3TA3C 5L2KE 3WFCH 1R3KA 3O4LB 4A2LA 4P5MB 1KB9J 3VFRB 2DWDB 3HFML 4TUOB 4JFEE 4PJ7A 2LFGA 3PWPD 5F1KC 3HC3H 4S1DC 2DKSA 3PIQA 1TQBB 4NCC1 5HVGB 5F9WC 2C3GA 3GUTA 3E3QC 4HUXA 3T2NL 3V5DA 3VW3H 2VAAA 1F4HA 1I3GH 4KKLD 3RWGA 2VR9A 1JNHB 1AP2B 5KOMC 3TJEH 3CFCL 3TZVA 1F5WA 1LO3L 9CGTA 5HI5C 1YEIH 5FM5O 3U0PB 4TSAL 3LKRB 1EFXD 3BKCH 4Y1AA 2PTTB 4JKKA 4L1DA 3CDCA 1P69B 2EDDA 2B1HH 2EDLA 3L3JA 4ZUWA 1GC1C 2NY3B 4P2QE 1OLLA 3DV6B 4O2CA 3IAGC 3T77B 2XN9E 4U2YA 3Q48A 3CXHK 3B9KA 4BJLA 1FFNB 3EFFB 3PWUA 1NUFA 2W9EH 2HKFH 3SDDD 5IROA 4AEFA 4YJZL 4PJBF 1LEKA 1PY9A 3PXHA 4WI8A 2HFEA 2D7QA 4A6YB 1F58L 1Q1JH 2VDQH 2YRPA 3ARFC 4F7EB 1I7TA 3BIAX 4NDMA 1F97A 2IWGA 3CFBB 2WQRA 3LKQB 3MNZA 1UM4H 3R1GL 4W4NA 3ZLQC 3C5JB 2P5WD 4ZUVB 4IRJC 2W59A 3ULUL 3QXDB 3MJ6A 3RHWK 1T22A 1R24A 1XGUA 3MYZA 4H26A 2Y25A 3BZ4A 3GIVB 3L7EB 1P7QB 4WWID 5D8JH 4DUXA 4P2OD 3P4NA 4FTVE 4Z7NE 4OUOA 5LXGH 4YFDB 2OJZL 4FQLL 1SM3H 5EC1A 1X5XA 2QEJA 5D71L 5CFHA 3L3KB 2DQJH 4OCSH 3VFPA 2IANA 4JFEA 3EYOB 3OKYA 4WGVB 4GAYB 2BFVH 3M8OH 4PRID 1V7NL 1NANH 1UXSA 1T2JA 2FJGA 4XWGH 1MWAA 4LLDB 3IDXH 5HY9A 4JCMA 3QWRD 4U05A 1FVEB 1P4IH 4LSSL 1F3JA 1NAMA 3QI9A 3ET9F 3V4VH 2CIKA 4HCRL 4NHCH 4PRAA 3VE0B 1SY6A 4POYA 5INDB 3LMJL 3B4NA 1IVLA 4OCLC 2PR4H 1LWRA 4AK1A 3QUZC 4ONGH 1H8NA 2QLVB 3F58H 5ACZB 4WNQB 3NIFF 1Q9KA 3ILQC 3I3DA 5HJ3A 1FGNL 3K3QA 1CFNA 3C87A 1DLHA 4WRLA 1FO0L 4P2RB 1DVFC 1FLRH 4XP6H 3WN5A 4RIRA 4PJDF 3NFPB 1J05B 3FRPG 2DQDH 2R56H 3OJMB 3SJVD 1G7LA 2CXGA 2O5YH 5GPRA 4GS7C 1VACA 2ID5A 3VXUD 2BNUB 2V2WB 2W60B 4LIQL 1MCWM 2RCSL 1HH6B 4DKFL 3BGAA 2GEEA 2HLAB 1CFQB 1QZ1A 4I18B 3QIWC 3S34L 1DCLA 3UYRL 1D5IH 4M02A 4HIHB 1QR1B 3AY4C 3NZ8B 1FNAA 2JJTA 5D6CB 4Z76B 1D9KC 1QYGH 5ISZD 1NC4D 3BDYL 3MV9E 4GG6A 1FNEA 3VRIA 1Q9OA 1T20B 5HPMA 4J6RL 1CGYA 2BMKB 4LDOB 4YLQT 2O5XL 1AO7B 3MV11 2CJUL 3OXRA 3INUL 4NWUL 3RGVA 4TVPD 4CUCA 3WHE1 2VLJE 5CSZA 3MV7E 1VDGA 5EO0B 1SYSA 4U6VH 1E0OB 2D7NA 1XZ0A 3QFJD 4XPGH 4ZTPL 4NQCD 5H2BB 3GHEL 4JFOB 1S7RA 4IOSD 4FQHA 1FORL 4IRSA 3H9SA 3AREC 5IEKB 4MYWB 2PYEB 2VZUA 4K71B 3HAEA 1NBZA 1S7TB 1OB1B 3PQYD 4PREA 4LQ1A 4DUVA 4NM8L 3UTPE 1M7DA 1UQSB 4KKCC 5D5ME 4HUUB 4GXVH 4BQ9A 5GS1A 2Z35A 2P45B 4PJAF 1U8LA 4PRHE 1JPTL 3LV3A 4JFDD 4KROB 1MJJA 4Z8FH 4OZGB 1HQRA 3L5IA 2VXUL 1BJMA 3BN3B 4HKZA 1DBKL 3LEYH 4JZOA 4UAOB 1H3PH 1QTYT 1CQKA 3BHBA 3O2VH 4M6OL 5L6YL 2HMID 1MNUH 5C0RL 2XACC 5EZLA 1NFIA 5I76B 5EA0L 4UOJA 4OD1H 3TH2T 2CDGB 1QLFA 1KYOK 5T1LA 3ZSSA 3GBNL 1I8IB 5L7XL 1OAUH 5DJAA 1BVKB 1FV1A 1TVHB 2CLVB 3VXMD 2XG4A 1DFBL 3MO1B 4KDTA 5KSUA 4QRUA 4OCWH 3LQAL 3TYGL 3GSUB 1BWMA 2VZOA 3O6ML 5I15L 3U36A 5IW1A 2FGWH 5H37G 1AIFA 3CMGA 4ZFZA 1NBVH 3FRUB 4M93B 5FM8A 2JJSA 3MV9A 2E6QA 5H37H 3WXWH 4AEIH 5GRXG 1Q9WB 4RDQF 1J8HB 2ZKHL 4OZFG 4Z78B 1UM5H 1ITCA 2YD6A 2R4SH 4OLVL 4WWKC 4Y8DC 1CLOL 5TQ0H 1YYMH 1KBGL 1TDQA 4X6CE 1OPGH 3BO8B 1F6FB 3MLWL 4OZFH 4G8GB 4W6YB 2DM7A 4JFXB 4P59L 3AB0C 4KK5C 3O41B 1YUHB 4NYLB 1OAQH 1U8QA 3SDCC 4KUCD 1IC4H 1TJIL 4OQTL 5AWNH 3TV3H 1RHHB 4WO4A 1KIQB 3T0EC 1NCWL 1SHMA 3U7AA 1FIGL 1FFOA 1RZFH 5DMKA 5EUOB 2EDJA 1I7RA 1DUZB 3PWPE 4IBLT 4LRIA 4LARH 4K7FB 2UWEF 1ZLUH 3BZDA 1X4ZA 2IEPA 3GSNB 2PETA 4HHAA 3SE8H 3TFKC 1CLCA 2OR7A 3S37X 2CQVA 1YNLH 5DJ8A 4JPVH 4JFHD 1NEZA 3S4SG 3MUY1 2VWEE 2GJZB 4LOUC 3ZTNL 3LHPL 4PRHA 2JCCB 5HHOA 2EO9A 3EO1A 4C83A 4P46A 2NX5A 5JQ6H 2OL3L 3ETBF 4FOMA 1H8SA 4UUJA 5C0AD 4ELME 3QUYD 4JRYB 2AXJA 1J1PL 4I3RH 4PLJD 4KKAD 3QDAA 4QHMB 1NMBL 5I18H 2QL1A 1JWSA 1YMMD 3WUWB 3SY0B 4KHTH 5F9OL 4NPYA 4R4NC 2VO5A 4KQ4L 4D3CH 4JVPA 2Q3ZA 3AXLB 5FCUH 1FYTD 4AL8L 1KCVH 4C56D 4LLMA 1VKXA 1T89C 3MRCA 3V5HB 3DX6B 1G7MA 4MHHI 3CH1B 5IHZB 3Q5OA 1G7HB 2UYLB 3FO9A 4XHJC 4UV7L 4XNUL 3SPVA 2P5WE 4L29B 3BEVB 1HQ4B 2DWEB 1F2QA 3SDAB 1IGML 4N1HB 4WUUA 3U7WL 4KMTH 3QISA 3CAFA 3TBTB 5E6YA 4X6CA 2G2RA 2AV1A 4PJXE 4PRDA 2OTWB 2IGFH 4OZGF 4XBPB 3RU8L 2NY3C 4FABH 5LAXA 1TITA 2YUXA 4IMLA 2ILLA 4JO1H 4OZFB 4MJ6A 1HH9B 2F53A 1UZ8A 5CJXA 3KPRD 4C57C 3RGHA 1KCKA 15C8L 2FJFA 2WW8A 3TBSA 1G84A 5F9JA 4R0LB 3UTQB 1HHHB 4DAGH 3MV8B 3BVNA 4PRIE 1L7TH 4PIRF 1G9NH 3I3EA 1V05A 4I77H 2ICES 1OP9A 2XTJD 1U3JA 4CNIB 5HYJA 5IVXB 2BJMH 3HC0A 4LGPB 1KJ3L 3DNKA 4Q9BA 3BW9A 4ELMA 3AMLA 3MOAL 3ZYOA 3HZKB 4XVJL 5BRZA 1IRAY 4OIBA 4U1JA 1LEIA 5EG6C 1WCBB 3D85A 4PJ8A 5DJYB 3IU3A 1OM3H 4F7CB 4XHQA 2X1WL 4IIQA 4PYHA 4RAUB 4RISH 1WBYB 3NABH 3MCKB 4JGMA 3EYQC 4NM4L 2E7HA 3CFJB 1EEYA 5HHVH 1X5KA 4LHUG 4I48B 5F7EL 4J3VA 4RNRA 3R06B 3RI5F 1OAKL 3S36X 2DI7A 4LLUB 4ZXBB 5T1KB 3GSVA 2GSGA 3S35X 4U3CA 3BOVA 2HTKC 4QXUL 5I1LB 3SJVE 4Y4FC 2Z4QA 1H3XA 3NGBB 3ARRA 4RWHA 4EJ1C 3VXUE 1RUAH 5CBEB 4QXGH 3BEWA 2H9GA 1QBMH 3TBWA 1IBGL 3Q6FB 1Y18A 4HC1H 4R96A 4BQ8A 2VDNH 3GSWA 1TTFA 3V7AG 4Q6YA 4Y4KA 2Q86B 2JCCF 4MNQE 1IAIM 3BH8B 4L4TB 4M7LT 1Y6KR 3IXAB 4Y5XC 5TE6L 1YY9D 4ZD3H 2FBOJ 3BP7A 1DUYA 1IGFH 1Q72H 3H42H 4P5TB 4B7IA 5T1MB 1PW3A 3QUKA 3MCLH 3VH8A 3ZE2E 2O61B 4PY8I 4DZBA 1MUJA 2P48B 1J1OH 4HFUH 3QDJA 5TGBA 5EO1A 4ONHB 2E7LC 4O2EB 3UEZA 1WZMA 1HDMB 2VLKD 1PSKH 4PRNB 2VDLH 3JWDL 1I1FB 4NWTL 4P9MH 1WICA 3LAFA 1YJDH 3G5YA 1MRFH 3MBXL 3O6KH 1ZKAA 3BQUA 3LKSB 3KWWB 1F3RB 3T65B 1F6LL 1XGTB 1JTOA 3QFJE 4NQCE 3X13A 5I1EL 3H3BC 2GY5A 4HWEL 1O0VA 3QWQB 3MA7B 4R7DA 7CGTA 2LE9A 1NAML 5C0IB 1VPOH 1UZ6E 4HXBH 2VLRB 1KJVA 3VXQB 4JAMB 4XAKD 1ZVSA 3NCEB 1FN4B 3PQYE 3SEPA 3NZHH 3E8UH 1FSKC 1NGPH 4LLQB 2X4TA 1AY1L 3KYOB 2ZSWA 4YEFA 3L1OL 1F42A 2I9TB 2DDQL 5DD1H 1U8HA 4JFDE 5CIPB 1QA9A 5BOPA 4LQFH 1MRCL 4JPIA 5D7IA 3WFEL 4WHDA 2JIXA 3GHBL 3GMOB 4M00A 3HCVB 2OX5A 1U36A 2LU4A 3QCUL 4X0KA 4NT6B 4A2MA 4OCRH 1OARL 2I60L 3QRGH 3TT1L 3SE9L 5TDNA 5E2VH 1C8PA 2AEQL 4MNQA 3HUJE 3T0WA 4OV5A 5GRYA 4JREB 3UO1L 3CU1A 4K71C 3DROB 1T83C 5J89A 1AH1A 4NFBA 4U31A 4WTZG 1IILE 5HI4D 3AS3A 3IDGA 5D1QB 3E6HA 1U2CA 3MX0A 4NC2B 4NQDA 2B8OT 2NXYD 3QDGA 3RIFF 1EEUA 4G7VH 4KROC 4U1IB 2VAJA 1NKOA 5BZDB 4JRWA 4H20H 5A3IC 5D7LB 4FQXA 2IG2L 4U1SB 5IQ7H 4EDXA 2OTUA 3QUML 4BFGA 1CD1A 3EO0A 4KRMB 4ETQA 1BD2D 1FAIH 2D7MA 1RIUH 5HGBB 1FYHB 5DVKA 1FL6A 2AJXH 1T1YA 5HHNB 3HE6D 1R0AH 3DX9B 4DKEL 4L8SB 4GW4A 3S96B 4YNYA 1O5DT 5GZNC 4OT1L 3O3AA 4MD5A 5GGVL 3SDYL 4DW2H 2ICWJ 3FO0L 2DQGL 5DJCB 4D0BB 1E4XH 4M93C 1RUQH 3K8MA 3U7YL 1G9MC 4HEPG 2IJ0C 3RZCD 1JF1A 4K7PL 4XCCH 1U8MA 5F96L 3FB7B 2P7TA 2O93L 1XR8A 4JFHE 1GC1H 2XKNB 2EECA 5TF1L 5L88H 3EDJA 4L8CA 4U1NA 2FX7L 3TIDA 3LSOA 5DK0B 3X14A 1E28A 5C0AE 3KXFD 5ENWA 5I73C 4C4KO 3ECBB 4MX7B 1JTTA 5DUML 4RZCA 3VG9C 3MRLA 1YMME 3L5WA 4K94C 4NO0D 2JJVA 5EBWB 4N90D 2H32B 3CJJA 3PWNB 3ARTA 1VHPA 4LHUD 1SYVA 4I9WD 3LKOB 2QHLA 3DMMA 4C56E 3TNNA 3X3FL 4DK3A 3NIDF 4P99A 1G6RH 4ENEC 4JHWL 1S5IL 3K7UA 1XIWC 1CE6B 3QQ4A 2R23A 2BNRB 2F15A 1HWHB 5IWLA 3WDJA 1ZTXH 5E9DB 1JPSL 1IC7H 2ED8A 5CD5C 4MA1C 4MJIB 1QFHA 1PY4A 2D7TL 3UDWC 4ZTOL 1RJCA 4MCYA 4NGHL 4APQC 4Q9QL 1B0GB 2C3XA 1CR9L 1PFCA 4R7NA 2GUOB 2MCG1 4WI7A 4J4PD 2H1PL 2LTQC 4KTEH 4G6FD 3KPRE 1A7PL 5J3HC 2D0GA 4X7EC 4L4VD 4PS4H 1MCPL 3VFUA 3QPQC 1BLNB 4N8VG 2ZUUA 3SGDI 4Z7WF 3JVGC 4GKZA 5HGDA 5BMFL 4NRXB 1QVOA 3D25A 3NN8A 1BM3L 1Q0XL 5C1MB 2R0KL 4G9DB 2ZG1A 2JLLA 2XTJE 4Y16A 3QZWG 1A22B 5DD3H 5SWZD 5JORA 5MHSE 3V4PL 2BDNL 4FZEL 4H0GA 5SWQB 4CVUA 1A5FL 4H8WH 1CD9B 1EVTC 4U1MB 4IHOB 3T1WA 4FQIL 3SE3A 3S36H 5GS0C 4ZO8A 3H9HB 3S35H 2EIEA 1UH2A 3FB8B 4PY7A 1YC8A 3LOWA 4M1DH 3H3KA 2APVA 1XGQA 5D7KE 5E70A 1IM9B 3DURA 2GI7A 2ERJB 5DI8B 1ND0A 4U4BA 5EBMA 4UV4H 3QO1B 4R0LC 3I2CL 4CDGC 4P0DA 1XF3B 3DVIA 2CKNA 3O8XA 1QO3A 3RY6A 4PJCB 1HSBB 4M61B 5HYSG 5JMOC 1EMTH 1E6OH 3B2UC 3FQNB 3G04B 1AR1D 1WITA 5F1NB 4ZDHB 5I6XB 1J0KA 5DFTA 3S5LG 3T4YB 2YN3A 1ZAGA 1W0YT 3BPOB 1KLUB 2C1OA 4QGTA 4PJGE 3ARGA 1I1CA 2NW2A 5F89B 5CD3B 1NBYB 2FWOB 4Y88A 2C5DC 1VGKB 2OQJB 3VFNB 2KZ1B 2LU3A 1CFSB 1HE7A 2DQHL 1H5BA 3LKNB 3TT3L 1FL5B 2ZNXA 1DN0B 3V0WH 2Y5TA 2BSSA 12E8L 5EZOH 4ZYKA 5JIKA 4U7KA 3FMGL 5FYJH 5ID1B 3ARVA 4QHLA 1YPZE 4I3GA 4OGAD 1BP3B 3TA3D 2QSCH 1EUTA 2VLKE 4GQ9H 4P5KA 4CVXA 1UYWL 1NCCL 4NUJA 3PWJB 4HZLA 3O3BB 5E94A 3E0GA 5IFAL 2HT4C 4P48A 1OHQA 2VL4A 4NFDA 5HHPB 4DJMA 3UBXB 4POZC 3SQOL 3D9AH 3BT2L 4N8VB 2GK0A 3WS6C 4L3EA 3WFDL 1EPFA 1IAIH 2VDML 5F1SA 4CVZA 1VFAA 3TO4D 4AM0B 1T1XB 4UB0H 2IALA 3G5VA 5B21A 1FC2D 1NFDE 1R5IB 1RI8A 5JW3H 4S2SB 5CUSL 4YXKH 4QCIA 3REWA 1ZHLB 3BZFA 3OGCA 5E1AB 3G6JB 3ZT5A 4U49A 1N5AA 4JHZA 2C3VA 1P7KA 2Q7YA 2FBJL 3VRJA 1MREH 5JHDD 1AJ7H 3Q1SL 1I85A 1CGWA 4HWBH 4NN7B 5E1HB 1IT9H 1CVRA 3GMQA 4WU5A 4G42A 1BPVA 4FXKA 3KJ6H 5FO9A 3MRMA 4YHIA 1G7IA 1HKLH 4LVEA 3QEUA 1KLGA 4OF6A 1KENL 1NL0H 1TZIB 4I3SL 2CO7B 3QUXC 1DEDA 4YDKL 3IDMB 1GYAA 2XY1A 2JELH 4PJIB 4EI5C 3C8KA 4P23B 1FLTX 2ATKB 2E8YA 2IFGA 4XP4L 5KSAC 3PABA 1T1ZB 5DK3A 1XF5B 1EBAA 4HBQA 1A6ZA 3BP5B 4HIIA 4QO1A 5IJVA 5IM7A 3VFOB 3DRQA 4LCCB 1CF8H 4HUVB 1TJHL 3S5LB 1ERNA 4CJ0A 5BV7H 1JHKL 5E95B 2UZIH 2FL5A 1A9BB 2ZCHL 3QDMB 3NCYS 3TNMB 4BFIB 5FF6A 1JFQL 1YA5A 3HI5H 3KPQA 5GRVK 1DLFL 1P2CA 4YHZH 4NKIH 5ETUB 1ORSA 4X4XA 3WHE0 1N2RA 4IMKA 1JK8B 5CMAB 1KB5A 1N6QH 2DJUA 1GL4B 3D39A 3AU1B 1NUNB 5I2IB 4PJEF 1KUMA 3RTQA 3GMRA 4XI5C 5J1SC 1BD2E 5ERWB 1JYVA 3ILPA 1RIVH 1K5NA 4NKOA 5FHAL 4FZ8L 4JFFD 3IETA 2CLRB 2D0FA 2QQLL 2YPLD 4KRPD 4WEBH 1UM6L 4HPOH 2EYSA 4JREC 4XVSH 4FMFA 4D0CA 4JFPA 4J3XA 2ZUQB 4EUPG 4UQ3B 2HVKB 1GGBL 4NRZA 1KFAH 2DQEH 4QHKI 2DMKA 1D7FA 3MJ7A 4Y5VA 5DEGA 1T7ZA 1M7IB 4LSPL 4JKPL 1UCBL 5SWSA 1JIBA 3QUZD 4HGWA 3A6BL 4JANB 3TIEA 3FHAA 2DQIH 5EN2A 3ILQD 3FOMB 4XMPH 1I9EA 1AE6H 2B4CC 3O3DA 5D7SH 5IGXH 1UWXK 2EE2A 1IGJA 3MLRH 1DVFD 1I4FB 3BYYA 4KK6C 4MJ2A 3ARDC 5C0BD 1QSVA 1CXEA 1VFBA 4PJ5B 3ZDYE 3EYUL 5EU6E 4KAQL 1YEEH 2YMXH 3SGKC 1W72L 1QFWL 3BSZH 4L8SC 1W2KT 2IQAB 4ZO9A 3GB7B 3MRDB 4N90E 4JFZH 3O4OC 1KTDA 3MROB 3IDUA 4AEHL 2Q6WA 2VERN 3QIWD 4I9WE 2Q7NA 1LO5B 5I17B 2APTA 5C08D 2OJEB 4OGZA 3KYMB 1YNTA 1IKFH 3WSQH 4JZJC 5TFSL 5DJXB 3C6LA 2WM0A 2QSVA 4N0CC 2VABB 1S5HB 3NACL 1DQDH 1O7VA 4K23H 4NNYB 3FN9A 3V95A 3QULB 2WINA 4BQBA 1CICB 1B0RA 3D69A 3G6JF 3D3VA 1ES0B 3C60B 3MRNA 3KYKL 4PJFB 3FO1A 3N1PC 5KVDH 4X7SL 3WJJC 1UWXH 5CEYB 3FONA 3KR3L 4YDJA 1A7RH 4F9PC 1UB6A 3CMOH 3PGCB 3VGAC 2PUQT 4XH2B 5T3XH 4C55A 1Q8MA 1ULVA 1J9CT 4OZHB 3T1FA 1D5MA 4DN4H 5EC2B 5F1IA 4MAYA 1QSED 4JEGB 1RPQA 4DVRL 5FYJD 3WIIL 4XP1H 5LWYL 4XCNB 4Y2DB 1T1WB 3IFOB 4Y4HC 2NXZC 1GOGA 2IBZX 1H3TA 2OS7A 5EU5B 4FRWA 5F7MC 5CP3H 1J5OH 4KZEH 4L4VE 3JTTA 1GZQB 3DUUB 1XR9B 4ZPVB 1YY8B 5IOPA 2VLLB 1JV5A 1A6VL 2VXSL 3M1BA 1NEUA 3BXNB 3OXSA 3VW3L 2KPNA 1NCUA 2EDTA 2VC2H 3HN3A 2ARJB 4K8RH 4N9GB 1AHWA 3MC0A 2WP3T 5IB1A 1ZHNA 3P30L 4ODSH 3C08L 3G5XA 3TJEL 5D1XB 5FGBC 4I2XB 1G7JA 3IF1B 4KKCD 4EUPB 5B38A 4OUUA 1WAAE 4GSDL 5SWZE 4NZRH 3UC0H 4KI5D 2J8UF 2IMNA 2B1HL 1AI1L 1T66D 4MDJB 5EU6A 3HG1A 2V9QA 3GRWH 1BVLA 2EYTB 4B53A 2NTFB 2Y23A 1NCNA 3CXHJ 1X5ZA 4DOHE 2W9EL 4ZFOA 2G60H 3SCMA 2IH1A 5I0DA 2IPKA 4M9PA 3I75A 4XCFH 2NPLX 2DLFL 1Q1JL 4PRPB 1MI5B 4EVNB 5EFIB 2EH8H 2GITA 1UM4L 1E27A 3D18B 2R0WH 4HIEA 4PV9A 3LS4H 3D0VB 1O7SA 4S0TD 1C12B 2BY1A 3VI3F 5I0ZA 5IESH 4BSWB 3V5KB 4QOKB 1FDLL 3DRTA 4F7PB 5GIRA 4YHLH 4UMGA 1JRHH 1QOKA 2ADIA 1TVBA 1YMHA 4XCEB 5GJSH 4X6DB 5IMKA 5LXGL 2HN7A 1H0DB 5DRXA 3RUGF 3V52L 1D5BB 1I7UB 2ERJC 1ZOXA 3PGDB 1K4CB 1EHNA 1OW0A 2DQJL 4KPHH 2KH2B 2PW2B 3KPSD 3TVMA 2BVOB 3GM0A 3T0VA 2BFVL 1ETZA 5DK2A 1N3NA 2FJHA 1UG9A 5C2BH 1G7QB 4XWGL 3SKUD 4XNXH 3SHSA 2XA3A 1MLCA 3LS5H 3E3QE 2F54B 2VUOA 4J23A 3C5ZC 1NCDH 1D6VL 1S9VB 4KV5E 2GK2A 3RPKA 4DZ8A 1P4IL 3AS2A 3RWGB 1SJVA 3WFZA 2XOTA 4YGVB 5HGAB 4NQSB 1CGXA 1DDHA 4PP2A 4Y5YA 3KPNB 4U6YB 3V4VL 3ZE0F 4NHCL 1Z2KA 3BN9C 1U92B 4F37K 4BZYA 2APXA 2PR4L 2HJFA 4OI9A 4GBXD 1A14H 1RK1B 4DGVH 1WT5C 3F58L 1BQLL 3IGAA 3JXAA 3BP4B 1JHLH 2AEWA 3OR7B 2Z93B 5T5NF 3TWCH 1BGXL 3WFHB 1OAYH 4OZ4A 3RWJA 5HVFB 2R2EA 4R4ND 1FG2B 2HFGH 5I19H 1S7WB 2EZ0C 3BD3A 5JHDE 2XZCH 4Y19E 1P84J 2R56L 5IV2A 1LEKB 5CKGA 4CBPA 2VN7A 4XHJD 3ZHDA 5JOPE 3IFLH 4LNRB 3CPLA 4D8PA 4JZNA 3RIAK 5D2NE 4R90H 1KJ2H 3V6ZB 5HDLA 1QFWI 4QWWC 1D5IL 5TH2A 3KAAA 3SOBH 4QT5A 1E6JH 2BY3A 1VADB 1XFPA 3PJSB 4O9HH 2YXFA 1QEWA 5D9SB 4MQ7A 1NC2B 1VSCA 1TQCB 5DO2D 3VXRD 5C0FA 1PKQE 2M2DA 3KS0H 5DD6A 2C3WA 2HJLB 2MQ0A 5DJDB 1U8PB 3DVNB 4QEGA 1KPVA 2V9RA 3CFEB 4YDIH 1HHKA 3MRFB 3LVEA 3IVKA 4UOW1 4QHNA 2F74B 5FOBA 1LQSR 2XT1B 5IJKC 4WW1A 4YWGL 5T3XD 3KLAA 2ZUTA 2VL5B 2ATPA 3VFPB 1CE1H 3X11A 2CUHA 4CU6A 3DHJA 3CVHA 4B0MM 3RL1A 4N0UA 5JZ7D 1YDPB 3ARBB 4H25B 4JFFE 5EU7C 1Q94A 1MQKH 2DQFB 4XPGL 4MSWB 3MMEB 4XGZA 1G9MH 2YPLE 4XP9H 4F9LC 3OPZL 5C8JA 5KVEL 3QNYA 1EAJA 2CDFA 4TNWF 2ZZUT 3FL7A 4JQVC 4K8RD 3PWLA 4GRLA 4Z77A 4JQXC 3JV0A 4K3EL 1F3JB 5J1AA 3B8SA 3FJTA 2CIKB 2XG5A 2X10A 5DURB 4QF1B 4ZQKA 1IC5H 4GRWB 4RWYH 5IBUG 2VDKL 2HKHL 3EYQD 1XGRB 4LLWA 4ZOEA 1D5ZA 5CP7A 4KK8D 1A7OH 4K94H 4Y19A 2X4NA 5CGMA 2XYCA 1DLHB 5LKNA 4BH7B 1F8TH 1OSPH 1H3PL 5SX5K 3VFVB 2VXVH 3V0VB 3WO3B 3O2VL 5C0BE 1J7VR 3ARFA 2HTKD 1MNUL 4UNVA 4PJ7F 4Y4FD 5C0CB 3ZKND 2XNAB 3JV4B 2ZOLA 3OR6B 4OD1L 1B2WL 4I13B 5SX4I 4IRJA 3RPIA 5HD8C 2ZUQC 5K9JH 3RVVD 5CHNB 1X6NA 5C08E 5CZVH 5E5MB 3DXAB 1WWCA 3WXVH 1FJ1B 2FGWL 3TYFA 4E41A 5CGYC 1KIRA 3NCMA 5HVHC 2XPGA 1FNLA 1NBVL 1R3LA 4Z7UB 5JUEH 3O9WA 1M05B 5CEZH 3OF6A 3EOAB 3WXWL 4RAVB 4AEIL 5E08H 1J87A 3M17A 5FYKL 2Q1EA 1OTTD 2ESVA 1OQOA 3CSGA 5TQ0L 3LN5A 3CLEH 4UINH 3EKCA 2FD6H 4XPBH 3VFSA 1RIHH 1IAKB 2HYMA 5KS9E 2WWKT 5SX5H 5DMYA 1KB5L 4OBSA 1OAQL 2VDPH 1EZVY 3KDMB 5FA4B 3SO3B 2ICWA 1QSEE 5J9PB 5FAAA 5FYJE 1VFOA 4RGNB 2A6IB 5C0JB 1RZFL 1SBSH 4MZ3A 4PLOB 4CMMA 5IMOA 5AZ2L 1L4IA 4LARL 1YEGH 2UVFA 5I16B 3F7YB 3FB6A 5CJOL 1SMAA 3UTZA 3LRSA 1YNLL 5J8OA 4HKXA 3MV01 4YZFF 5IB3A 2BRQA 3C60C 4MD4A 5JO5A 3C8HA 4OZIB 2LU7A 1K4DA 5JQ6L 3I85A 3W2DL 2W0FB 4FQPA 3RWEA 5IMLA 1RU9H 3BE1H 1A7NH 3H0TB 4I3RL 3NFNA 2I25N 4UDTB 1CFVL 2QSQA 3ARZA 5J6HA 4NNXB 1S7VB 2JB6B 1U93B 5I18L 5IBUB 3UTSE 1RZJC 2ADJB 3CFDA 3V6OC 1QFPA 7FABH 3DI2B 1MF2H 4KHTL 4QRRB 1QG3A 4QTIL 4E42B 4RX4A 1PGRB 3MJGX 3RNQB 1P4BH 4KUZL 4OCYH 5FGCB 1KCVL 2OZ4H 4PJBE 3FFCA 2EDQA 1B6UA 4L8DA 3BUYB 4J1UA 3S3JA 5D1XC 3AY4A 2VXQH 4F2MA 5IW1B 1NCAL 1AQDB 5A16A 2ED9A 4S1QH 4ZFZB 1EHLH 5C09D 2AK4E 4BSVA 2IGFL 1WEJH 1BZ7B 1CLYH 5JA9A 1HHJB 1W0VB 4FABL 3U30C 4QRQA 3ORJA 5A3ID 4JKLA 3MOBL 4JO1L 4RBPK 4GKOA 1EV2E 4KGLA 5GGRY 5LGHH 2EH7L 1GOFA 4BZ2H 1JN6B 4OB5H 3WIFA 1DP0A 1MJUH 5F21B 5KAQG 3KPSE 1KIUA 5EWIH 4Q6IB 4Z9KB 3DJ9A 4O2FB 3T0EE 4DAGL 4TUKH 3OX8B 5I71B 4YGAB 3GBLA 1L7TL 2RR3A 1JZ5A 4M7ZB 2W38A 3AREA 1RY7B 5ICYA 1FNFA 4I77L 2V5RA 4NZUH 4Z7UF 2Y7QA 4KI1A 1WBXA 5J12C 4KFZC 4X6FA 3MACL 5DJ0B 4LCWE 5EO9B 4JRXA 4FQ1H 4QHUA 4TOYH 1DL7L 4LSRH 5DDHA 3MODH 3Q0HA 4GG6F 3SBWA 3EO1B 1C5DA 5ICZA 4KVCH 4N0YH 1CXFA 4RISL 3GJFH 3NABL 4M1GH 3NIFE 5FCSH 3RDTC 4HEME 2B20A 5FK9B 3L5HA 4Z0BL 3FT2A 4EI6B 1RUPH 1OTSD 5J4MA 4I0PA 4P4KC 3CSYB 4ZFOL 4KJWC 4PJDE 1BFSA 4LCUB 2G5RA 1R5WB 3HE7D 4F33B 3B6SA 4PGBA 4X7CC 4ENED 3OAZK 5DD5L 4NUGH 1A6WH 3W39A 1N5YL 4OM0H 2VKXA 2AJ3B 2C7UB 3DTXA 1EHXA 1JGVH 3DGCR 3G6AB 1Z5LB 5IR1B 4WWKA 5CD5D 3G08B 3IJHB 2JB5H 1IGFL 1Q72L 2BVYA 3H42L 4EOWH 4YE4H 4F7TA 5CEZD 3VD4A 4APQD 1U95B 3D48R 5E6IA 1I1YB 1QPXA 1AGBA 4OKDA 4QRSA 1X3DA 3VXRE 3SDCA 4FFVC 1FE8L 4HFUL 2BSED 5EZIL 1EEQA 1I7ZB 3B9KC 4G9FA 4GMTH 5C9KA 5J3HD 3T0EA 1KEGL 1J8KA 2VDLL 5IROC 4OF5A 5T3XE 2DQTL 1YJDL 5ESVB 2FGZA 1MHCA 1MRFL 1YEHL 1Y0LA 4O58L 1YN6A 4WDIB 4XCYB 3KYNB 1B0WA 4LCWA 3KGRA 2BVPB 4JB9H 3T09A 1MCLA 3MNVB 4CMHB 3W0WA 1XGYL 1VPOL 5EPMA 5EU3A 2B4CH 3JZ7A 5F93C 1EJ6A 1Z0NA 1QBLH 3VWKD 1A6TA 5GGSB 1MCKA 3NZHL 5DFVC 1KN4H 3C5SB 5C0GB 1NGPL 1OP5K 5FUZH 2J88L 3JTSA 5GSVA 5KSVB 3GGWB 4PJAE 3O4LA 2ITDA 4P5MA 3HMXH 3VFRA 3VXSD 2DWDA 2PXYB 1HILB 4TUOA 3RVUD 1JGDB 1OAZL 1INQA 1EK3A 3N0PB 4ZAKB 4U7MA 3RKDC 1GIGH 3LEXB 3O0RL 1MY7A 2B5IB 4FQJH 3MZTA 2Q8AH 3BWAB 3VGHA 3B2VL 1TJGH 2ZUWA 3EFDL 3U0PA 4DKDC 5TE4H 3MLTB 3LKRA 4R96B 2PTTA 1RZ8B 2A0LD 1ZSDB 5E5UB 4KJPC 1BOYA 1H3VA 3LPFA 3EZJB 2V5YA 3AAZB 3DV6A 4LRNL 3T77A 2F19H 3B8YA 4ZSOB 4XNZB 4LEOB 3CUPB 4AIZA 4LSQH 1FFNA 3EFFA 1IAMA 1KTKE 4MXWH 2X4SB 3K4DA 5IMMB 5F9DC 1OAXH 3UYOD 1RUKH 2ZG2A 1U3HB 3MJ9A 3ZDZF 2Z8VC 4A6YA 3D5OF 3WN5C 1FAIL 1RIUL 3CFBA 3LKQA 4UU9B 2AJXL 3C5JA 2GSIB 4DGYH 1LHZA 4ZUVA 1MFAH 2EDXA 3S37L 3X12B 2HT4D 3QXDA 4RFNB 4RMVA 4POZD 3DV4B 4GRMB 2YD7A 2IPUK 5E8NB 1X44A 4MS8C 4JPKH 3GIVA 3L7EA 1P7QA 4DW2L 1B3JA 4UILL 2UWEE 1HZHL 4XCCL 2KBGA 5E4IA 4YAQB 2JJTC 1FRGH 4ODTH 5CLWA 1GC1L 2MQCA 1N4XH 3QSKB 3L3KA 3EYOA 3MLUH 5KANI 1GHFL 2DM4A 1GZPB 4GAYA 1JWMB 4KC3B 3BPNB 5MERB 3TEUA 3BGFC 2HA1A 1IQDB 4LLDA 3ARPA 5D7IB 3E6FB 4ZPTB 4K3HA 2IPUG 1LE5B 2X2YA 3ABZA 3QUXD 1FVEA 3BKML 4TSBH 3F6LA 5FDWB 4HIJA 4EI5D 3HR5B 5B3NA 3QXWA 5KSAD 5B39G 3CFCH 4UTAH 5INDA 3VE0A 1F90L 2J12B 3TN0D 2CUIA 4IRSC 5E2JA 3IS1X 1QR4A 5ACZA 4WNQA 4PJHB 4UQ2B 1IGIL 2L7UA 2FATH 1ZTXL 2GAZB 4PJ9D 1ODAA 4P2RA 1IC7L 2Z0BA 4YR6B 5BXFB 5GS1C 5C09E 3DX8B 4OZGE 2Y6SC 1J05A 3NFPA 4Q74A 3LN9A 3TPKA 4FFWC 2BK8A 4WW2B 4M7LL 2V2WA 2W60A 4KTEL 2MMXA 1HH6A 5L8JB 4D9RE 5MEPA 1JZ8A 2IBZY 2HLAA 1CFQA 1ZMYA 1MCIA 4I18A 3ZKSD 4DUWA 1PAMA 4PS4L 5BS0D 5KW9H 1S7UB 4L3CB 4HIHA 1UC6A 2I26N 5F3BB 1QR1A 3NZ8A 3F5WB 5D6CA 2EKSB 4NNPL 4Z76A 3CDFA 3ZZ1A 1HN1A 3DOSA 4YHPB 3KNBB 4HS6B 5DD3L 2JJSC 1T20A 2BMKA 4OLXL 5DT1H 1AO7A 2EDEA 1BEYL 5D71H 5KZCD 4ISVB 3S36L 5DC9B 5IK3B 4U1NB 2NY0B 3S35L 4KK6D 3ARDD 4M1DL 1XGPB 3QCTH 4LPVA 5EO0A 4UV4L 1RK0B 1A9EB 1KULA 5H2BA 1ZHKA 4JFOA 3FOLB 4WO4C 4G5ZH 2F5AH 2N1KA 1OOAA 3IFPB 5IEKA 4LSSH 2PYEA 1EMTL 1E6OL 1G0DA 43CAB 4EN3B 1OB1A 1T83A 3DMMB 5DUPH 3O45A 4H0IA 4HCRH 5IHBA 1UQSA 3BKJL 5ABDE 1ZE3C 4HUUA 3AVEA 3LKPB 3KLDA 1F11B 4PLKC 1N0XH 4D9QD 2JCCE 4OZGA 4PP1C 1FGNH 1OQXA 2VE6B 4P46C 5FO7B 2YD1A 1FO0H 5INCB 1RV6X 4WTWA 4YX2L 2IH3B 4K2UH 4JO4L 5JW4M 4ODUB 3V0WL 1AKJB 5I76A 3VI4F 4JE4B 5D7IF 3NH7H 5EZOL 5JW4R 4ORGB 1H9VA 2CDGA 5FYJL 3FRPA 1I8IA 1TVHA 2CLVA 4Y4HD 4DKFH 2NXZD 1HSAB 1RAMA 3GSUA 3KYAA 5FHBL 2FR4B 4YBLC 3GSQB 5I74B 3S34H 2OYPA 1ZT7A 1LDSA 4X9IA 3LN4B 1FNGB 3FRUA 2MCPH 5MEND 4PD4K 5HGDB 1SJHB 4J3TA 3D9AL 1TLKA 4PJHF 2R2HB 1Q9WA 1J8HA 2XKUA 4UB0L 5JW3L 5IHUL 3BO8A 3LRGA 3IXTB 4G8GA 4JJ5B 4YXKL 4JFXA 4J6RH 2AERT 5CKAA 3O41A 1YUHA 4NYLA 5DHVH 1KXVC 1KPUB 3IRPX 1X9QA 1KT2B 1TMCB 4ZOBA 2ZUVA 4C54A 3INUH 4NWUH 4U6TA 1RHHA 2AJVL 5CJXC 1EO8H 4FQ2H 1KIQA 1MREL 4G6ML 3RVXC 1AJ7L 4LGRB 5EUOA 3QEQB 3DURB 1DUZA 3QHZH 4HQQL 5KVGL 2JF1A 2WBKA 1NGZB 4K7FA 4ZTPH 3KJ6L 3GSNA 3VGDA 1WWWX 1X5AA 1TIUA 4G8IB 1FORH 2P42B 5B4MD 2GJZA 5F6IB 2JCCA 5IB2B 3CFKB 4LASL 1OF2B 4JRYA 1EVUA 1CF8L 5JQHC 1T03L 3D2UD 2IPTL 2NW2B 4URTB 2ZJSL 4P3DB 1I1AD 2X5PA 1Q0YH 5A1AA 2VXUH 3CU7A 3WUWA 3SY0A 1DBKH 1SJEB 3HI5L 4YDVB 4IIQC 1GH7A 3AXLA 4M6OH 1BREA 5C0RH 5EA0H 1KACB 32C2B 3V5HA 3DX6A 2W9DH 3WMSA 3CH1A 4JR9H 1G7HA 2B5IC 2UYLA 3WLBB 4HJGB 1VENA 4P5KB 3WDIA 4L29A 3BEVA 1HQ4A 2DWEA 5HHMB 4UT7H 3SDAA 1B4JL 3C5ZD 4HPOL 4TVSa 4XVSL 5C0NC 4X4ZA 1OGAB 3TBTA 1C7TA 4NHUB 1ZEAL 2OTWA 2EKJA 1RZ7L 3VA2C 4Y4KC 4BM7A 2DMBA 1NAKL 2DQEL 4XBPA 2ICWI 1BBJB 3N9GL 2ZKHH 3BN9D 2CK0L 1WCQA 1ADQA 3RX5A 3L6FB 3GMPB 1MVFA 4OZFA 1HH9A 3MLWH 1EDQA 4IOIB 1N64H 2E6PA 3RVTC 1AE6L 1FNSL 2D7PA 1RZJH 3WKMH 4OCMC 1VEOA 5ADPL 1U3HC 4NZJA 4RCAA 2X89A 3MLRL 4R0LA 3WNMA 3UTQA 1K2DB 1HHHA 3BH9B 2EZ0D 3MV8A 4X4YB 3RVWC 1NCWH 4JY4B 5CGTA 2IC2A 5CZXD 3SKOB 3UAJC 2YMXL 3NOIA 3U9PH 4F80A 4CNIA 5IVXA 1EH9A 1CWVA 4V1DB 5GS3A 1U41A 3CSBA 3QIBB 4DGIH 3H7LA 4QRPD 4Z5RB 3HZKA 1IKFL 3WSQL 3NIDE 2XRAL 3EJJX 3UMTA 3ZTNH 3LHPH 1WCBA 4Z18A 4FFYL 3PABB 5DJYA 2CR6A 2OL3H 4F7CA 3S4SA 1C08B 2VLRE 2HLFC 1DQDL 4RAUA 4K23L 1KLFA 1WBYA 5MEOB 1J1PH 2FEEL 3MCKA 4S1SH 2KQNA 3CFJA 5DHYA 1NMBH 4J8RB 4I48A 1CXIA 5KVDL 5I1CH 3B5TA 1GCFA 3R06A 4BUHA 1E4WH 5F9OH 1A7RL 4LLUA 4ZXBA 3BPLC 2ICEB 1ORSB 4HJJH 5T1KA 3EYSL 2DLTA 1LO4L 2R69L 1QPPA 5I1LA 5LGKA 4YQXH 4AL8H 5T3XL 1L6ZA 2PO6B 3TBVB 5CBEA 5MI0B 4XXDB 2CUMA 3Q6FA 4JQIL 4WCYL 5KSBB 4KZEL 2Q86A 5BS0E 4UV7H 4P57B 3BH8A 4L4TA 4LPYA 4LMQI 3MGOB 3IXAA 1IGMH 4Z7WE 3WKNA 1DBMH 1L7IL 1UA6H 4P5TA 5T1MA 3RWCB 4M7JL 2WBJB 2NZ9C 1UEYA 3CNKA 5C07D 2O61A 2Q87A 3OV6A 4ONHA 2F58H 5H35B 3UC0L 4O2EA 3TIEB 3KJ4C 1HDMA 3DYPA 4PRNA 15C8H 4OFIA 2NW3B 1I1FA 1QSFB 4NRYB 2DS4A 3NA9L 1F4AA 4Y89A 1H8OA 5JW4Q 3LKSA 2QADC 3OJVC 4POUB 3KWWA 5DZOA 2MPAH 3T65A 1MCBA 1XGTA 3NFSH 1CDCA 5L2JB 1LILA 1RULL 4YH6A 3VFGH 4MVBC 1MFDL 3MA7A 3VMPA 5C0IA 2P49B 1KJ3H 4I0CC 4UIMB 2J8OA 3DECA 3VXQA 4JAMA 3MOAH 4GKNB 2R0WL 1FN4A 2R0LL 4LLQA 3JBG7 3KYOA 3VXNB 1W8NA 1Z9MA 2I9TA 4D9QE 4YHLL 1JRHL 4NQED 1WUNT 5HGHB 2NY0C 1MCRA 1WBZB 1UVQB 4NO0A 4JN2B 5GJSL 3CX5K 5F7EH 3GMOA 3HCVA 4HV8B 5DF0A 3PF2A 1JNJA 3UTTB 2BXYA 4LHUA 2MSPA 2EDFA 4ORZC 4NT6A 1FVDB 3AFLA 1UKQA 4QXUH 1U8IA 1URLA 1JYXA 4KPHL 2WNGA 3MLYH 4HMEA 5DQ9B 4OLEA 1QRNB 1OWWA 3DROA 3DMMC 4ZOAA 1CDGA 5D1QA 5TE6H 5HYFA 5F7LB 3P9LB 5IB1B 4U1IA 4BK5A 4MA3B 3KPMB 4Z7VB 5BZDA 5IWLC 2V2XB 1GAFH 3PL6D 3SGDH 2W1NA 4U1SA 1KTLB 5D7LA 3ZKMC 8CGTA 1A14L 4DGVL 2H8PB 1UKSA 2P5ED 3J7HA 5HGBA 4NBXB 1JHLL 5HHNA 3JWDH 4IS6A 1OAYL 4NWTH 3DX9A 3IDYC 5D1ZD 4L8SA 3MBXH 4HLZG 3S96A 4LDEB 3R8BB 5I19L 1AQKH 5F7UA 5JPNB 1JGEB 1K6QL 1MWAH 4HLZH 3JV6B 5I74C 4R4FH 5HGGS 4LVNB 3IDNA 5DJCA 3MFFB 4D0BA 1JI2A 4K3DL 1BFTA 1I3UA 2GJ6D 4YHOL 2GCYB 3FB7A 1NAMH 1IL1B 1SY6H 2FLBT 2J8HA 4R90L 1KJ2L 5CSGA 3ES6B 4Y16C 5DK0A 1CN4A 5BZWB 1AY1H 3ECBA 4MX7A 5D4QA 1AD9B 1CBVH 4CU7A 3L1OH 4F9PA 1PZUB 5AYUL 3SE3C 1G9EA 1A2YB 4HK0B 1YMHB 5EBWA 5I8CB 3QG7H 2H32A 1MH5B 2P46B 2HN7B 3PWNA 3QCUH 3ESUF 4JFQB 2FEEI 3R8QA 2FIRT 1T3FB 3CCHB 2I60H 3TT1H 2BX5A 3PG2A 4LCYB 2DYPB 3O8XC 3OAYH 4PJEE 3RY6C 3NMEA 2VQUA 1NKRA 2CKBB 3V8CA 3UO1H 1CE6A 5CJ8A 4UTBH 4K07A 5F6IC 1LEGB 2BNRA 1CDIA 3MOQA 3WJLA 1G9ML 4XP9L 4FG6C 4KDVA 5FGBA 5E9DA 4WGWB 4J3OC 4MJIA 4HDIB 2WWMC 3ARGC 5GZOC 1FGVL 1B0GA 5A43C 4L3AA 3TBYA 3U9UB 1T0NB 4NN6B 2GUOA 1H5BC 3IKCB 4RFOH 1IC5L 2P4AB 3W11C 4RWYL 1ED3B 3R4DA 2VJXA 2PN5A 4OTXH 4UBDD 3V4UL 3OJ2C 3UJTH 1IEAB 5L2KB 3RDTD 4HD9A 2R39A 4K94L 5DJ6B 5I9QB 1HXYB 3TC9A 1BLNA 2H2PD 2BRRH 4DKEH 1F8TL 4XVTH 4P4KD 1QFWM 2VXVL 5D7JB 2EO1A 4KJWD 2DN7A 4NRXA 5DC0A 3MRQB 1I8LA 5F7HA 1IC1A 5J11B 4X83A 5F44A 3SDYH 5GGVH 4G9DA 1MCFA 4GW5B 4XAWL 2DQGH 4CJ1A 4R4BB 1IAOB 3FTGB 5JNYB 1INEL 4PTTA 5K9JL 3HAEH 4K7PH 5A2KH 2KZWA 5IT2L 4QRPE 4Z7VF 5SWQA 3TZVD 5CZVL 4U1MA 1ZLVH 3WXVL 4IHOA 5JW5A 5IBLD 2BSRB 4P2QB 3H9HA 3O6FB 2FX7H 1KGCD 5JUEL 2V7HB 4Y1AD 2XN9B 4WHTB 1P7HL 3EAKA 3WCYA 4UT9L 4OD3H 3G6JE 5DUMH 5DI8A 4FFVD 5FUOL 3QO1A 4GT7A 3O2WH 1T5WB 2FD6L 3JV5A 5EIVA 3F12B 1J1XH 1XF3A 2F8VA 3R0MA 3B9KD 1M1SA 4PJCA 2Z31B 3U79A 1HSBA 4M61A 5K93A 2BNQD 3FQNA 3G04A 3F7VB 3PHSA 3QEGL 4WEUD 5F1NA 4ZDHA 4LPWA 3T4YA 3ISWA 1G6RA 3S98A 4D0DB 1KLUA 1S5IH 2P24B 4FFZH 2I24N 5F89A 5CD3A 1NCTA 1SBSL 2DD8L 5EU7E 2FWOA 1E4KA 1VGKA 2OQJA 4MNHB 4OSUH 3VFNA 3C9NB 4M3JA 1CFSA 4NOFA 3LKNA 4XC3H 1FL5A 4FTVB 3HR6A 1XAUA 4R97B 1S9XB 2D7TH 1DN0A 4WJ5B 4ZTOH 3PWLB 3QDME 5C07E 4XNQB 5GS0L 4EDWH 5DFVD 3OKEB 2APWA 1HIMH 5ID1A 1FP5A 1EGJA 2H1PH 1RU9L 4JM2B 5D93C 3BE1L 5FKAB 1B90A 3QUMB 2J8UE 1A7PH 1VB9A 5F6HJ 1VERA 2IAND 3PWJA 4JFED 1ZA6B 2YA1A 1JUFB 1MCPH 3O3BA 2B0SH 5AAWA 1MF2L 4LSTH 2X4PB 3RTQC 3RKDD 3VWJB 5HHPA 3UBXA 2CO6B 4QLRA 3O11B 4N8VA 3NVQA 4OIIL 1K3IA 4AM0A 2MNUA 3FFDB 4FXLA 4ZFFB 2R0KH 3QBTB 1R5IA 1UKTA 4S2SA 5E2WH 1YQ2A 2R1YB 4NKQB 1ZHLA 2M1KA 3V4PH 4NP4L 3QI9D 5DGRA 4KJPD 2BDNH 4FZEH 2VXQL 1ZGLP 5ESAB 4JHAL 5E1AA 4Y5VC 5IUSA 1NMCC 4FQIH 3MRPB 5C0DB 3VI3E 1EHLL 1R3LB 5ALCL 5JHLL 4TPRL 1MFBH 3SGEI 1WEJL 4R6UA 1CLYL 3N85L 3DGGA 4Y8AA 4NQEE 1GVIA 3ROLB 2QQNL 4N1EA 3I2CH 1KJMB 2DBLH 3RUGE 1TZIA 3GMMA 4WIQA 5LGHL 3IDMA 4PJIA 2E27H 4OB5L 4P23A 2ATKA 1MJUL 1T1ZA 1XF5A 4J3WA 3BP5A 4F9LA 5D96B 3CDGB 3VFOA 2PTVA 4TUKL 4LCCA 5M95B 1YEJH 4HUVA 3S5LA 4QY8A 5H94B 4JQXA 4CMMB 2YD2A 3C6LC 3QDMA 3TNMA 2DQHH 4BFIA 3QHFH 3TT3H 5DR5H 4G6KH 5ETUA 4JO2H 1A4KB 4FQ1L 4TOYL 1T6WA 2VZSA 2Y72A 1JK8A 2YWYA 3ZE0E 5CMAA 1RHFA 12E8H 4MNGB 4Q7DA 3MBEB 4PRBB 2VZVA 1JZ7A 3FMGH 3AU1A 5KN5B 5I2IA 4KVCL 1F3DJ 3L7FB 5ERWA 2VLJB 3WO4B 3MV7B 3NFNB 5A2FA 3IT8D 1R3HB 4O51B 2CLRA 3RGVD 3V6OE 4MAYC 3FN0H 4MJ5B 4ODVH 2DQCL 3UXFA 1QFUL 2APBA 1X4XA 2FB4L 4RGMB 3SQOH 3BT2H 4UQ3A 2HVKA 3F8UB 2FHCA 4GXUM 3M07A 4M4PA 4NKMB 2V7NB 4KRNA 4NUGL 1M7IA 1UACL 2GJ6E 3GIZL 5D5MB 3MLSL 3IKKA 5CUSH 3H9SD 4JANA 2AQ2A 4ODWB 2WUCL 4XPTH 3FOMA 1NGYB 4WFGE 4HGMA 1EA9C 5LG1A 4G8FB 1QSZA 1I4FA 2JB5L 5FUCC 2NY4B 4EOWL 4YE4L 2FBJH 1MEXH 3T04D 1OWRM 2Y6SD 4HJ0C 4PJ5A 1MCJA 3KPOB 3Q1SH 4HWBA 5J6GB 1QLEL 4LVOB 2D9CA 4HS8H 2MHAB 2ZCLL 2IQAA 4HH9B 3GB7A 3MRDA 1JWUB 1SEBB 3MROA 4LP5A 1UXWB 1KENH 3Q5YA 3PWVB 4I3SH 5EIIB 1LO5A 5I17A 2OJEA 3NTCH 4HFWB 4LVNC 4YDKH 3KYMA 4H1LG 3L5XH 5DJXA 5T1LD 3WIFB 4XP4H 4XTRC 1MI5E 2VABA 4H1LH 5DUBB 1S5HA 1I9RL 4JFYB 1FVCB 4NNYA 4YC2C 3QULA 1RZIB 1TJHH 5DA0B 1CICA 5FYKU 1ES0A 3C60A 4PJFA 1JHKH 3H7BB 4JB9L 5DMJB 3VH8G 2ZCHH 3MLXH 3MV9D 5CEYA 2B4CL 3RY4A 3O3EB 1QBLL 4XH2A 3T8XB 3CZJA 4OZHA 1KN4L 5EC2A 1QFOA 1FAKT 1EAPB 3DVGB 3QIUB 4XCNA 4Y2DA 1T1WA 3IFOA 4HKBB 5EU5A 5FHAH 1GZQA 3DUUA 4FZ8H 3PWPB 1YY8A 4ZPVA 2V5MA 4YIQB 1OVZA 4B50A 2VLLA 5DSCA 4WO4D 4Z0XB 3TVMC 5ANMB 1W0WB 3BXNA 5HYEA 4LSVH 4FP8H 2ARJA 4N9GA 4FQJL 4PJ7E 1N6UA 3RBSA 2Q8AL 1GGBH 5D1XA 4I2XA 4X80H 3C8DA 3IF1A 1PEWA 4EUPA 4JKPH 4U1GB 4GBXA 5TE4L 3T3PF 3VD9A 1EFXB 4PLKD 2DKMA 5GRJL 2AP2A 2Y06L 4F3FA 1U8KB 4PRHD 4PP1D 4MDJA 5HHOD 1KCUL 1NDGB 4P46D 1LP9B 2NX5D 3WBDA 3VA6A 5AG8A 3EOTH 3FQXA 1KGCE 2EYTA 4Y1AE 1P5UA 3ESVF 2NTFA 1HK6A 2VTFA 4D2NA 3OKNB 4LSQL 4N8CL 3RAJH 4PGCB 3U6RB 5I9QC 1AGBB 5ICXB 4HMDA 3SDDB 4KAQH 1OAXL 3IAPA 1W72H 4GMSL 1RUKL 5K33A 1RJYB 1F4YH 1IGTB 1AGEB 1HKFA 4PRPA 2RIKA 1X7QB 3LCYA 1MI5A 4X6BB 5J11C 4KK9C 4EVNA 5EFIA 1U0QA 2J3SA 4GH7B 4ZNEA 3D18A 4OF3A 4DGYL 2P5WB 3OL2A 5TFSH 1N6VA 2C26A 3D0VA 4JG1H 1C12A 1Y0LB 5DLML 4BSWA 3T4AB 3V5KA 4PJXB 4QOKA 3SO5A 5LJYH 4F7PA 3ME0A 4WUUD 1BMGA 3O6FC 4P2OB 3EDEA 4XCEA 1JF6A 4PLNC 1BQHG 4P49A 4X6DA 1H0DA 1VGEL 4KMLB 2BVQB 5C6PB 1FZMB 1D5BA 1I7UA 1VFMA 4ODTL 3CK0L 3KR3H 4YZFE 1AGCB 3AGVA 3PGDA 3FZUC 5BJTB 2HFTA 4M1CC 1Y6MR 1K4CA 1N4XL 4R3SB 2AAVA 2F53D 1IARB 2PW2A 4M48H 2FYYB 1IEBB 2BVOA 3FAXA 4DVRH 2Z31C 5DHXB 3RVXD 2J6EL 4PRIB 2HH0L 1TENA 2ITDB 1G7QA 5CP3A 2IANE 4Q2ZA 2ARWA 1INQB 1A6VH 2F54A 2VXSH 4KY1L 2VB5A 1S9VA 3MCG1 3EOBB 4Z7QF 2Y07L 4RGOH 4TSBL 4YGVA 5HGAA 4NQSA 5E99L 3P30H 4IRZH 3KPNA 3C08H 4U6YA 3ULVF 4UTAL 5EDXA 1U92A 2UZXB 5HYJD 4W4OC 5GGVY 3CZFB 2EXYC 3BAEL 4R97C 3LRHA 3FQTB 1RK1A 4GSDH 3FT4B 3MRHB 3P77B 4GRLC 5FV1L 4MCZB 5BRZD 3BP4A 4K7PY 4TUJB 2AEPL 3OR7A 2Z93A 3D85D 4PJ8D 1AI1H 5SX4H 5AUMB 3WFHA 3B9VA 5GGQH 2FATL 2UVEA 1FG2A 2H6PB 1KB9K 2HP4A 4N5EC 1S7WA 4QYOA 1IJ9A 4AIZB 4X9GA 3LD8B 3SJVB 4DFIA 2AK1L 3VXUB 3WUZA 1NJ9B 4MQSB 4MXVF 2DLFH 3EHBC 3PP4L 3MLPA 1J88A 3CC5B 4LNRA 2C1PB 5EOCJ 5KW9L 3V6ZA 3EYVB 5C0ND 3K46A 4U1LA 5I1KH 1MFCL 4GXUN 2V2TB 1VADA 3PJSA 4Y4KD 1LP9F 5IW6B 5D9SA 1NC2A 1FDLH 4YHKL 3MJ8B 5ISZB 1NC4B 4Z7UE 1Q38A 4R9HA 3O9WC 2HJLA 4PPTA 5DJDA 1U8PA 3VGBA 3DVNA 3V9FA 3WL9B 4XC1L 3CFEA 4TNVK 3V52H 4M6AA 2ZOKB 1MHEB 3MRFA 5DT1L 1BQHB 2F74A 3BJLA 1MJ7H 4PR5B 1F2XK 5EBGA 4GG6E 3QDJD 1FZJA 5DVNA 2VL5A 4XP5H 1M4KA 3FQUB 3RWHB 3RVWD 3T3MF 3QCTL 3BZEB 5TQ2L 3TO2B 1YDPA 3ARBA 2B39A 4H25A 4X9HA 2DQFA 3GMNB 1XCTB 4S1RL 4MSWA 3QFJB 3MMEA 5A2LH 1WZLA 4NQCB 5B8CB 5D96C 3BQUD 1V3MA 4G5ZL 2F5AL 5EOTB 1IGCH 1D6VH 3OQ3B 5E2TH 2AXGB 4PGEB 4HIJB 5DUPL 3PQYB 4QF1A 2BERA 2HLFD 3H9SE 3O81A 4MD0B 1HYSC 2BHUA 1XGRA 3GBMH 3OB0K 1BQLH 1N0XL 4YHYB 5ITBH 4JFDB 5L0QB 4EQ2A 2VDOH 1GRWA 2L0DA 1BGXH 4BH7A 5J13B 3VFVA 3V0VA 3WO4C 3WDHA 1NFKA 1ORQB 1JZ4A 4K2UL 3BWUC 4V2BA 3D0LB 5C0CA 2XNAA 3JV4A 3OR6A 3NH7L 2JIXD 1C1EL 2R29H 3EZ8A 3VXMB 3HUJB 4RGMC 3BRDA 5CHNA 3IDIB 5MEPB 4PB9L 2OK0H 4M62H 3VFMB 5E5MA 1PG7X 3DXAA 4MNQD 1FJ1A 4YXLL 1GXEA 4X4MA 4OFYA 3HZVB 1RJZA 4Z7UA 2X4QB 4G6AD 1CXHA 2MCPL 1M05A 4MQXC 2NZ9D 3EOAA 4RAVA 3SDXB 2EXWD 3VG0H 2R9HC 2XKSA 1F4XH 2X4UB 3OB0H 1UJ3B 2M26A 2GTWB 4NQDD 2NY4C 2NYYC 1DEEB 3QDGD 4JO3H 5JDJA 1IAKA 4CU8A 1YN7B 4KTDH 1MHPH 3KDMA 4FQXD 5FA4A 1NGXB 1A0QH 4YWGH 4KU1A 2FEDC 5J9PA 1CFTB 4HAGA 1EO8L 2QADD 3QWOB 4FQ2L 5DMGC 4HWZB 2A6IA 5C0JA 2KDGA 2XZQL 3QHZL 2DJ4A 1AD0B 1NPUA 4MVBD 4BQCA 5FKPB 1GOHA 1ZHKB 3OPZH 3TCLB 4GQPH 4RRPG 5KVEH 5I16A 3F7YA 5JOFB 5CSBA 3U82B 2X1XR 2AGJH 4K3EH 2HWZL 4G80B 1JPFB 3ULVC 4OZIA 3O45B 2W0FA 5CEXB 3QCVH 1QRKA 5C0AB 2JE8A 3QUYB 5LGJB 4W81A 1IZJA 3H0TA 2VDKH 2HKHH 1T2XA 4UDTA 2ADFL 4K9EC 4NNXA 1S7VA 2HAZA 2JB6A 1U93A 5HHOE 2NX5E 3SBWC 1Q0YL 3OKOB 2ADJA 1YMMB 2R2CA 4QRRA 2ZUSA 4E42A 1FBIH 4ZO7A 3RNQA 4AQ1B 1J11A 5K9OB 1AGDB 3NCFB 1FYTB 1A7BA 4C56B 1KN2H 1CL7I 2HVJB 3JSSA 1B2WH 2HTLD 4F15B 2W9DL 3ZDZE 4LLVB 4I0PC 1N59B 4JR9L 3BUYA 3RWFB 2BSTB 4JG0H 2VWEC 4HKJB 4AENB 5IB5B 4UT7L 1ZLUK 1AQDA 4U1GC 1ZT7B 3GK8L 2VZTA 5C86A 2BOCB 2DIAA 1U8NB 5C3TA 1BZ7A 5FYKH 3UPRB 1HHJA 1W0VA 4WUUE 3RWDB 1G6VK 5E5RB 5ALBH 3ZKMD 1IKNA 2DTSA 5B22A 3KPRB 4FS0A 2NY2C 5E6IC 1N64L 1AFVL 1KB5H 5I75B 1RZJL 2XZAH 3WKML 4IDJH 1JN6A 4F7MB 2C9AA 2AKRA 2F53E 3KPTA 1NGWA 4Q6IA 4O2FA 3UX9B 4ESKA 4NQXB 3OX8A 1XF4B 1JGUH 2OXGA 1KXQE 1NLDH 2WAHA 1YC7A 1DR9A 3EJYD 5AZ2H 2XTJB 2FRGP 3U9PL 3MUGB 3SDXF 5DJ0A 2ADGB 2GHWB 1A3LH 2PYFB 5CJOH 2J1KA 5EO9A 4DGIL 1P1ZA 3AROA 3U0TB 4P2OC 2F8OA 1QNZH 4BUGA 2YK1L 3UBXI 4Y16D 5HYJE 5EOQH 3W2DH 1Z9LA 5BRZE 4S1SL 4KUCF 3GJEB 5I1JH 3NPZB 3T0BA 5GRUH 4BZ1L 1KPRA 1CFVH 2ZPKH 5FK9A 4EI6A 3NAAH 5I1CL 5LBSL 4M7KL 1E4WL 3CSYA 4QTIH 5DS8B 1QKZH 1T04B 4HJJL 1OP3K 5I1GL 4P4RB 4KUZH 4LCUA 1NSNH 4YQXL 1R5WA 2OZ4A 3WIHA 4F33A 1TQBC 3O8XD 5F7YC 5I1AB 1BFOB 3PHOA 1WZ1L 3RHWF 2AJ3A 4PJGB 2C7UA 1OD9A 1WGOA 3IDJB 2Z91B 1ZGLM 4FG6D 2DM3A 4DCQB 3P73B 3G6AA 1Z5LA 1NCAH 5CJBA 5IR1A 1V7MH 3G08A 3IJHA 1DBML 1UA6L 3ARGD 3ALXA 5GZOD 4WI5A 1NCBL 4GUPA 3MUHL 1U95A 1I1YA 4O5LH 4RMRA 1WTLA 3DUHA 4J3UA 3W11D 3MOBH 5FYJU 1I7ZA 1JTPA 4LNVA 2F58L 1YPZB 3P9WB 3LZFH 2VLKB 3UTOA 2EH7H 1OP3H 1ZLWK 3QDJE 2XWJB 5ESVA 4WDIA 2OM5A 1RMFL 4XCYA 2VDRH 2NCMA 2CDEB 2MPAL 3KYNA 3CIQA 3NFSL 1FZOB 3T2QA 5KANG 1S8DB 2YUZA 2BVPA 1UWGH 2R1XB 3MNVA 3VFGL 1NFDB 1YECH 3G9VA 3JWOC 3MACH 4L3ED 5B38G 5MHSD 2UY7A 5BW7C 1B6DA 5GGSA 1DL7H 2A9MH 2ENSA 2B2XL 3EYFB 3C09B 1V5JA 3C5SA 5C0GA 1HHGA 5DMIH 2ZUXA 5TPWL 4ODHL 3S4SB 3ELAT 4W68A 5KSVA 3GGWA 5D7KD 3PGFH 2PXYA 1HILA 4P9HC 4HXAH 1JGDA 4OGYL 1KCRL 3VD7A 5DHYB 2A6DB 4Z0BH 1I8MB 1ZLWH 2XWTB 4ZAKA 3CX2A 2PW1B 1PG7H 1NQBA 5IIEA 3LEXA 5EUOF 2D7OA 5BVJB 2EIZB 3BWAA 3VI4E 5D7IE 5B8CC 1L0XA 3MLYL 5CS7A 3DYOA 5DD5H 2BHZA 1HI6A 1XEDA 1N5YH 3MRJB 3MLTA 2VISB 1RZ8A 4XNYL 1M6OA 1ZSDA 1K8DB 3LH2L 4OIAA 4ZUUB 3U1SH 5C71A 3AAZA 2VMFA 1ZLSL 2I5YL 4ZSOA 2IAMD 4PJHE 4LEOA 3CUPA 4YHYC 2NXYB 1GGYA 1HCVA 3D6GA 3DSNA 2X4RB 5FA3B 4HAFA 2X4SA 4PBWD 5FYKD 2C4XA 5IMMA 1MY5A 5E8DH 4NQDE 1GAFL 3HRZB 1U3HA 1FE8H 4HK3J 3QDGE 5EZIH 2P43B 5KTEH 4XXCA 2HMIC 1BD2B 1U42A 4LLYB 1YEKL 1XF1A 3DX7B 3MNWB 4UU9A 5CILH 4F58H 1KEGH 5KOVC 2GSIA 1JPGB 1TNMA 4CADB 1WK0A 3D39D 3HE6B 5TDOB 3X12A 2DQTH 5F1OB 3RTQD 1YEHH 3F7QA 3MXWL 4O58H 3DV4A 4GRMA 4LDLB 3LB6C 1AQKL 4PV8B 4I18C 5E8NA 1MWAL 2EEBA 4R4FL 2VR4A 3ALWA 1N8ZB 3VCLB 5FO8B 2E9IA 3QB7C 4PFEA 1IQWH 2HT2D 3HTLX 3RZCB 3BIKB 5HHQB 4YAQA 2X9YA 1U91B 1XGYH 1Z9SA 3PDGA 3BPCB 5I1DB 1SY6L 4HS3B 5A2JH 5KVFL 2YRLA 4OJFH 3PHQB 5SWSD 1F13A 5GISH 1GZPA 3KXFB 1JWMA 2EC9T 2J88H 5EUKB 3BGMB 4M5YH 1MCCA 1CBVL 1OCWL 5MERA 3IRZA 3DO7B 1HCFX 1IQDA 1OAZH 4HPYL 5DEZA 4M4RA 1LDPL 3E6FA 4NO0B 4ZPTA 3HKFA 3QG7L 2P8MB 3HI6L 1LE5A 1JMZA 4NSKB 1J0IA 1LVEA 2QHRH 1ACYL 4PGJA 4LHUB 3O0RH 5FDWA 4ODBD 3VFTB 3HR5A 1U8IB 2XV6B 3B2VH 3EFDH 5IVXF 4U6XB 3UJJH 5I8KH 2VITB 3GMLB 1J86A 4UTBL 4PJHA 1U3YA 3VGGA 4UQ2A 3C6LD 2GT9B 5E2UL 3SKJH 4NQUA 2OMBA 4XWOC 1NH6A 2GAZA 3QUYC 4LRNH 2HG5A 4YR6A 5BXFA 3DX8A 1DANT 3QJFB 4JJHA 3D3VD 3QYCA 2RGSA 2YUWA 3H9ZA 2G9HB 2CRZA 4RFOL 4WW2A 1R6VA 4UAOC 3MREB 3P0VH 4BA8A 4G6FB 4OTXL 3QXVA 3UJTL 4W70A 2V6HA 2YEZB 1J18A 1VEMA 5FYLE 4L4VB 4OGXH 1S7UA 4MAYD 1JVKA 5CAYB 4IS6B 3CVHH 4L3CA 2BRRL 3S37H 4XVTL 2A6JB 4AEEA 5F3BA 1S9KC 1KIPB 2R1WB 3F5WA 2EKSA 4MMZC 5BOZG 1EXUB 2YWZA 4YHPA 4UILH 3IDNB 3KNBA 3ZKQD 4HS6A 4NOBA 4F57H 1HZHH 5SWZB 3EO9L 3P4MB 5C6TL 4HX1A 1BX2A 5FECB 4YK4B 5GSRB 4C4KT 3RZWA 4ISVA 4MZ2A 5J7CC 3REVB 4O02H 5IK3A 4D94A 4M6MH 1V8HA 1OSZA 1GHFH 3UROR 1XGPA 5I75C 3AS0A 2FX8L 1V3LA 4OD3L 5EU6D