4MD4B

Immune receptor
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
189
structure length
189
Chain Sequence
DTRPRFLEQVKHECHFFNGTERVRFLDRYFYHQEEYVRFDSDVGEYRAVTELGRPDAEYWNSQKDLLEQKRAAVDTYCRHNYGVGESFTVQRRVYPEVTVYPAKTQPLQHHNLLVCSVNGFYPGSIEVRWFRNGQEEKTGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSLTSPLTVEWRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A molecular basis for the association of the HLA-DRB1 locus, citrullination, and rheumatoid arthritis.
pubmed doi rcsb
molecule keywords HLA class II histocompatibility antigen, DR alpha chain
molecule tags Immune system
source organism Homo sapiens
total genus 48
structure length 189
sequence length 189
ec nomenclature
pdb deposition date 2013-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00969 MHC_II_beta Class II histocompatibility antigen, beta domain
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4md4B02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 4md4B01
1R5IB 3MV8B 1IC5H 5I15H 1DDHB 5KS9E 2FO4B 4JFPA 4ODUA 1EBPA 3ILQD 3V4VH 3LQZA 3T09A 5KVDL 4JPIA 5F6IB 3IDJB 3LN5A 1AI1H 3SJVB 4QNPE 1ZT1A 3CFBA 5DZNA 3C5SB 2ZWLT 2DQCL 5EOCJ 3CFKA 2XT1B 5DQJB 4DKDC 3VG9C 3O2DA 2B0SH 3JV5A 2EZ0C 4L4TA 3JWDC 1QBBA 5C6TL 4X9BA 4DN3L 5DHYA 3JWDL 2A9ML 4L4TD 1NBZB 4I18B 5CWSB 5FO8A 1FGVL 1MVUA 4KJQD 4OCYL 4WTZG 4PJAA 2AXHA 2VL5A 3AM8C 2WSKA 4JAMA 1QYGL 5C0AB 1RIUL 3NCBB 2D0HA 1UG9A 3WXVL 5TH2A 1OP5H 3RL2A 3SOBL 3VD3A 1WISA 3RVXC 1NCAL 2WLZA 4QTIL 1EEYB 5C6TH 1NCBH 1AP2A 3M07A 2DICA 2LABA 3JWDH 2A9MH 4O51B 3VXRA 3VGGA 5EZIL 4Y4KB 4BQ8A 3TIDA 4M61B 5JOEA 4PREB 4ALAL 1CDIA 4D9QD 3VXRD 5DJXB 5JORB 5ESAA 1H9VA 4MLIA 5ABDE 4X83A 1RIUH 2HJFB 1J0JA 1EFQA 2Q6WB 1IC4L 4OD2B 1FVCA 4H26B 3IKKA 1R24A 4I3SL 3DXAA 2JIXA 3G5YA 5F9OH 3SOBH 3C60C 3WNLA 4D9RE 1A64A 1NCAH 1DN0A 2J6EL 4G8GE 4NYLA 2AEQL 1WWCA 3IXAB 2O5YL 4QTIH 1UXSB 2HMIC 2MQ3A 3DXAD 2JIXD 5BZWB 1T4KB 4KKCC 3UPAA 5KTEL 4WENB 3EO9H 2DS4A 3FRUB 3NIFF 4XBGA 1IAII 3MCKA 4WDIA 3V4UL 5CCKL 4E9LA 5EZIH 1JZ2A 4YR6A 2VLJB 1AQDB 1BGXL 4DUWA 4ALAH 1KXQE 3BQUC 2CKBL 1N8ZA 3GZKA 4U1GC 2QKIA 2A6JA 3RWCB 3BEWA 3SDAB 1HHHA 3BE1L 3R8QA 4P5TA 1QFWM 2OZ4L 5CJQL 3SDYL 2GEEA 3IFLL 2NY4B 1IC4H 4HD9A 3GSNB 3OR6A 1J8KA 3PWPB 3SY0B 3B5HA 1GOGA 5FECA 2CRZA 4I3SH 2EDEA 1KYOK 4P5TD 3ARVA 3MLVL 1WK0A 4AMKL 3R1GL 5FHAL 5K9KB 2J6EH 1J1PL 2I07A 2AEQH 3RNQA 4D0CA 2W0FB 3RDTB 4ELMA 2UVEA 2BNQB 1LP9E 5INCB 3TEUA 2V5MA 4JPKL 1RZIB 2RHEA 3V4UH 5CCKH 1ZHKA 4Q97A 1RZGA 5F7FA 4X4YB 4I0PA 3HAEG 1PSKL 4LSUL 1ZTXL 1BGXH 1E6JL 3HE7C 5IMOB 4X6BA 4HT1L 2NQCA 4I0PD 3BE1H 2NNAA 1HZHH 1NFKA 1R3LB 2OZ4H 3SDYH 1HKLL 1FLTX 5ID1A 3HA0A 3VFWB 3SKMB 1FCGA 4HEPG 3PV6A 4AEFA 4WEMB 4POYA 3MLVH 1G9NH 4WU7A 4JFDB 4AMKH 3R1GH 5FHAH 1KB9K 5IKCA 1NLBL 4GS7C 4ZFZB 3QWRD 4JJ5A 3LVEA 3DURA 5IB3A 3T0VA 3LIZL 2VISB 4APQC 4JPKH 5DK2B 2A77L 4LCCB 4KKBD 3TYFB 5HHME 1AXTL 1D5XB 3UTTE 1R3KB 2BSED 1IL1A 2GIYA 4LSUH 1KLGA 1ZTXH 4LNRA 2VLME 3IT8D 4WI7A 2ADIA 4HT1H 1SJHB 1T03L 5C0EA 3TO2A 4HUNB 7CGTA 4RSVA 5IIEB 1NC4A 1X5LA 1EFXA 1YQVL 3H3PL 5LXGL 2NTSP 4FQHB 3REWB 4QF1A 1FZKB 2X44D 1HQ4B 4IOFD 5J1AB 3OXSB 4Y1AB 1NC4D 3ILPB 1EHXA 1EFXD 2OR8A 4PY7A 1NLBH 4Y19A 1NPUA 5D6DA 2XZQH 1TVHA 2OJEA 1AXIB 4FQIL 5IJVB 5IT2L 4D9LL 5JTWA 4Y19D 3ARBC 2AAVA 1AXTH 3T2OA 3PHQB 1B88A 5D70H 3GJFB 3HRZB 4JZOA 4XP5H 2OR7A 5DVOA 3C5JA 1OLLA 2G9HB 1MCCA 3X12B 1WCBB 1G7QB 4GAFB 5C09B 5C0BE 1HWHB 1VEOA 1YEGL 3H3PH 5EC1B 5LXGH 2AXJA 3NTCL 3LB6D 3P4MA 5FYLD 1T0NB 2I5YL 4K7FB 3FB8B 5BO1L 1D9KC 5ITFA 3K8LA 2GCYB 1KG0B 4FQIH 1FNEB 4IEFB 4D9LH 4PRNB 2D31B 5F9WC 1T6VN 3MLTB 1CTNA 5EBWB 4HUWA 4ORZC 3WBDA 4OZGB 2MSPA 4H8WC 3OX8B 1MAKA 3F58L 1J05B 1I3GL 2BMKA 2KPNA 3EYQC 1IAOB 2OJZH 2C26A 2GJ6B 4H8WL 4DCQB 2XNAB 3RWIB 4CADA 3LKOB 4EI6A 3DX6B 4Z78B 1YEGH 4Q74A 2OCFD 3ZDZF 3QEUA 2YD1A 4L4TE 1PD6A 1RUQL 5JR1L 1BREA 4NNPL 1R5VB 1EUUA 1MLCB 3C2AL 1RIVL 4OLZL 5DHVA 1F5WA 5DC4B 4BSVB 1YDPA 1C5DA 3ARGC 3AS2A 3NZHL 3OZ9L 4N0FB 1DBKL 5DFWH 3WJLC 4PRIB 4OZ4B 1KBGL 4O00A 1OTSD 2PW2A 4OZIB 3PUCA 4X7SL 4NRYB 3PL6C 4Z7WF 4Q9BA 2BDNH 1H3UA 2V2WB 4JY6B 4OFYA 3UTSB 3F58H 1YEDB 4C58B 2EO1A 2KDGA 3LRGA 3FB5B 1A0QL 3LKPB 3I3EA 4QHMA 4BSJA 4NNYB 1YN6A 4OFYD 4RGND 3F7PC 3DO7A 5EZJA 5D2LF 3DMMB 3GMQB 1RUQH 4HKZB 4NNPH 2P8MA 3U1SH 32C2A 3C2AH 1JGUH 2A38A 2FWOA 4F9LC 3JZ7A 3AREB 5DS8B 2FSEA 4D9QE 4NZJA 3VXRE 1RK0A 3QWQB 4PJFB 1DBKH 2A73A 1KBGH 1RJLB 2K1MA 4U0RC 5EIVA 1LILA 1PYWA 1IRAY 4PGZA 3SKJL 4EDWH 4ODBD 4RAUB 2HT4C 1S7VB 1ES0B 3RKPA 2YOCA 3MROB 4XWGL 4UV4L 3TJHD 1E4KA 1ORSA 2E8YA 2IQAB 2FZ3B 2V2TA 3NA9L 4UIMA 1QSFA 3VXTB 1IM3A 2RB8A 2IADA 1OLZA 3UYOD 3KLHD 4JFFD 5ACZB 4Z76B 3D85A 3RUGB 1QSFD 1U8JB 4DQOL 1VSCA 4QHLA 1AD0B 3T8XA 4G9DA 4R2GC 2FNBA 4FG6C 5D96B 3C8KB 1JV5B 1M6OA 4Z7VF 4GXVH 4MNQE 3QG6B 4EVNA 1NUFA 5L9DH 3SKJH 1F11B 4WUUA 5DJDA 4F7PB 4XWGH 4UV4H 4J23A 5T1KD 3NA9H 4M1GH 5D7JA 3Q3GB 3JWOC 4JCMA 3V79C 4WUUD 1U8PA 3PABB 2VSCA 4X6CB 3RL1A 3RVUC 1QBLH 5B39B 1B0WA 4WWKA 1WIUA 2DIJA 2NZIA 1VGKA 1ZGLB 5E24E 3NPSC 3IGAB 5B38B 1FL5B 1HWGB 4DQOH 4ELME 1YA5A 1V05A 1KTDA 1G7PB 5TF1H 3NAAH 4WWKD 1P7QB 2ERJB 4YDJB 1E27A 12E8L 5HBBA 2EIDA 5ESVB 4Y4FC 1KT2A 1I1AC 5CJBA 1LO0L 3EDFA 1FG2A 2ZUQB 2FIKB 2CGRL 5E6IC 2ZOKA 1S9VB 4LIQL 4M7ZB 5C07A 1CGYA 1K2DA 4AIXA 1NKRA 5GSVB 4IRSB 3IU4L 5FUZL 5A2JH 5E8NA 2APFA 1Z9OA 4HV8A 2D4DA 2DKMA 5C07D 1NUGA 3U9PL 1PW3A 3RTQD 5IW1B 1U91B 4JFYB 3WNMA 1INEH 3GI9L 1BPVA 4TVPH 1E4WL 2X4RB 1DE4A 4KKNA 5I30L 2UVFA 3KWWA 2NY0C 2YUWA 5GJTH 2DKSA 2YRZA 3HZKB 4PJIF 1ZHNA 3X3GH 4LCWA 2RAMA 4U2ZA 3R06A 3ZHDA 1A6UH 2ARJQ 4G8FB 3GEWB 2VN4A 4KDTC 3W39B 4LCWD 2FGZA 3IU4H 5GZND 2X4PB 4AM0B 1EAPB 4HXBL 3C8DA 3NFPB 3EDKA 4Y19E 2PO6B 4LLMB 4QXTA 3WD5L 3MRKA 4Y4HA 1CXFA 1T22A 3QDJA 2CUMA 3JTSA 2NYYC 2EE2A 1AFVL 3O3DB 4HPOL 2D03H 3UC0L 1QR4A 3H6JA 4P3WA 2X4TB 4YLQT 4Y4HD 2C3XA 1KN4L 4KTDL 1BM3L 5TDOA 1B3JA 4K8RH 5BS0E 2VLRA 4NC1C 3OMZA 3W11C 3MV9B 1FFOA 4MJIB 3ZTNL 1ZT7A 5FYLE 5IJKA 4J6RL 1A9BA 3T4YA 1TXKA 3K1KC 2DLHA 2VLRD 5DRNA 1Q1JL 4XPFL 5CBAB 4Y5VC 2P48B 1I1YA 4HXBH 4YHYC 4I9WE 2JF1A 4NUJA 1QA9A 3MV01 3WD5H 4XXDB 4U0QB 2EECA 1S7XA 4LHUB 3LKRA 3SDXE 3BKCL 3WYRA 3GSXB 1AFVH 4HPOH 1CG9A 3UC0H 2V5YA 2XRAH 1BBDL 4HUUB 4ZNEA 4HEME 1DQML 3VCLA 1KN4H 1F4XH 3ZKMD 4KTDH 1BM3H 5DJCB 2HYMA 5FB8B 1OD9A 2GTWB 2JCCB 4E5XB 2RJMA 3KPLB 4HLZG 3ZTNH 1MLBA 5E6ZA 1NGWA 2HJKA 5EIIB 4JZJA 1MHPL 3IF1B 2H9GA 4XNUL 2MHAA 1ZWIA 4NN7B 5HGBB 4XPFH 1U93B 4YBHA 3L3KB 5TFSL 5JHDB 3QO0A 4WV1C 3WLBB 4M6OH 2UWEA 4ODHH 1G7HA 4PBXA 3DVGA 5SV4A 2AQ1A 5L2JA 2HT2D 5B38G 3OQ3B 2AK1L 3BKYL 2FDBP 4MHHI 1N64L 5DGQA 1BBDH 3E3QC 4RGNE 5IG7A 1DBAL 2DJ4A 5KSBF 5DHXB 5J3HD 3S37L 4OCLC 1CDUA 2VZOA 1FG9C 2F19L 4JFHD 5AZEL 1U8HA 2QLVB 3TIEB 5F7NC 3DX9B 3THML 3STZA 3B9KA 4GRMB 3VGFA 1T89C 1MHPH 2OQJB 3QP3A 1U42A 3C87A 1A14H 5D1XB 2XWTA 3EYFA 1CE6B 3B9KD 1R3IH 2P45B 2CXKA 4BZ1H 1CQYA 4DKEL 4RFNC 3CSPA 3KPPB 2OK0L 4LCUB 2ATKA 4HIHA 3BKYH 3QUML 1N64H 1ORQA 3MNVB 4P23A 2FD6L 1T2QL 1DBAH 4F3FB 5C0ND 3QEQA 4A2MA 1KPVA 4PG9A 3VFOA 3OJMB 1FFQA 4LLDB 1QSFE 5AZEH 4P23D 4OD3L 3THMH 1KJVB 2XTJD 4GW4A 3QEQD 5HI5C 1C5CL 4XAKE 3MFFB 1HXYA 1FYTB 2HKFH 1WBYA 4HZLA 1T83C 3DUSA 4EEEA 3GKWL 4P5MB 4WJ5A 5MERB 1TCRA 4UINL 5T1MA 1AGCA 1I75A 2V5SA 5CINH 1JE6A 1F00I 2YC1B 1LEGB 2YK1L 1MREL 2OK0H 2NX5A 3K4ZA 3IDIB 4XCCL 4WUUE 4HJ0D 2W1NA 4NQEA 3A6BL 2W9EL 1RQ5A 1NMAH 5E94A 4S2SA 1JPST 5L2KB 1GGIH 1ITCA 3BUYA 5IMLA 3PWUA 4M7LL 2H32H 4NQED 1D5MB 3RVVD 3ZKND 1C5CH 5FGBC 2KQMA 3AY4A 3BN9D 4MJ5A 4L8CB 3I6LD 3GKWH 3H9SB 4R97B 4E41B 4XP9L 4FZ8L 3NCYP 1KXTB 1U6AL 4HIJB 2CO7B 3MRMB 1MREH 1V3MA 3T3ME 5C3TA 3TO4A 3DARA 4LSDA 4P46B 4XCCH 1IT9L 1HQRB 4LHUG 5MEQB 1C1EL 1DUZB 2FX8L 2W9DL 4L5FH 1S3KH 4YDVA 1SJVA 5DZLA 2APWA 4CU8A 3A6BH 5C07E 5I75C 2W9EH 4AEEA 3DVNA 2Y36L 3TO4D 1DL7L 2APBA 4IOIA 3SE3A 4L9LB 5F7DA 3IFPB 1TCMA 4L8SC 1MEXL 2C1OB 3GBLA 1NFDE 1KC5L 3AM8A 3ZL4L 2IEPA 3LS4L 4XGZA 1NQBA 3BWAA 4M43L 4FZ8H 3CCHB 2R2HB 2YA1A 1AXSB 3W9DB 1CGVA 1U6AH 2R29L 1OGAA 2EDHA 4ONGL 4TNWF 1NCTA 4ODWB 5KANI 1IT9H 4OKVB 3LY6A 1C1EH 1JRHI 2HKHL 2W9DH 3U4BL 1OGAD 2EYTB 3RVXD 1FP5A 1VEPA 3AFLA 2Y36H 3QJFB 1DL7H 3BP4B 4H1LG 1C08B 4NQCD 1CD8A 5CEZL 3FQWA 4HHAB 3EUUA 1BLNB 1MCFA 1MEXH 5EDXA 4RA0C 1FNGB 1OAUL 5E4EB 1CFNA 1KC5H 3I2CL 3QDJE 1G0YR 5F1NB 2Z8VC 4MA3B 3V0VA 3EOBB 3VFVA 1D5ZB 3O8XC 5HHMB 3UTTB 4M43H 2J6EA 3OXRB 1UWGH 5JW3L 3S9DB 5DMGD 3C60A 4ONGH 4X0KB 1QLFB 4OCXL 1YNTB 4J2XA 3VDAA 2VLRE 4PRAB 2EEAA 5IHUH 4FXKB 5CSGA 4YWGL 1T7XA 4NDMB 3F7VA 3MUHL 5F7LB 3QWOA 3U4BH 3C60D 2CKNA 4P3DA 5HYSA 4NQUA 1T1WB 3O11B 3D39B 4QRSB 1FSKC 2CKBA 4FRWA 2ZSWB 3RX7A 5BZDB 1PBYA 4G7YH 2DTSA 2V9TA 5DSCA 3MNZA 4KKCD 3VWJC 4TOYH 2OZ4A 3HPJB 1ZLVK 4GKOA 43CAA 1OAUH 1AD9A 2JKXA 2WBWB 3F7RA 1TZGL 3I2CH 2Z35A 2MKWA 3BQUD 2ICEA 4AENB 5GRZA 4ZNEE 1WC7B 5JW3H 3WFZA 2PCPA 5DQDL 1JCKA 4OCXH 2FGWL 4UOW0 4NSKA 5B8CC 5SWZD 1QFOA 1A7RH 3TH2T 3EFFA 4X5XA 4K71C 5EOTA 4PLNC 4Z7OF 3RWEB 3C6LC 2O5XL 2Y06L 1IQDA 1YC8A 4NZUH 5F7MC 4HPYL 1EGJL 3CFEA 4ELKA 5F3BB 1JF5A 1KYOJ 3UX9B 4XBPA 2GUOB 5KSAC 4DK6A 4PYGA 3RIAK 5K59F 4PJBA 3P9LB 1FPTL 4IJ3C 3STLB 2UWEE 2GSIA 1FL6A 1H8SA 3U83A 3VGDA 2HFFA 3BPNB 2ZJSL 1TZGH 5HGAB 4JFED 3PWVB 3LKNB 2IPKA 4JPIB 3ALXA 2ARWA 3LN5B 1QO3A 4HH9A 1UZ8A 5F8RC 5EG6C 4UV7L 3O9WC 3F12B 4WHCA 5CJXA 3VFPB 3QZWA 2FGWH 3O0RL 3HR5B 1NJ9B 5E5MB 5J6GA 3FB7A 2BSRA 1DBML 5F1IB 1J7VR 4U7MA 2O5XH 3UBXG 1ZANL 4HPYH 2BY2A 2CJUH 1B0RA 1HYSC 1NCDH 1CWVA 5DHYB 4U1JA 1KB9J 2JJSA 1N2RB 1QZ1A 1FPTH 4APQD 4BFGA 4F37F 5HDBE 5DK0B 4OLYH 3QT2A 5FO8B 3WFBL 2WUCL 5D8JH 2B39A 3ARFA 1JGEA 2OMBA 3QNXA 1QFUL 3E2HB 5D2NB 4IHOA 3QDGB 4UV7H 4YBQC 5HVFB 1JZ6A 1OD7A 3GSRB 2DLTA 2XTJE 4FA8A 5H37G 2HT3D 3ARFD 4F58H 1EO5A 3TA3C 3BD3A 3ULSA 1DBMH 3F5WB 3MO1B 2MWCA 4RQQA 3QEHB 4DAGH 3ARBA 1I4FB 1LDPH 3MLUH 4OGZA 3WNPA 4U6YB 5LQBL 3TBWB 3MGOB 4FQQB 3HZYA 2OTUB 3S37X 4XRCA 3CVHL 1S7QA 5KVFL 3TIDB 4G5ZH 3MRCA 1W0YT 2C1PA 2IAMB 4JHAL 4JR9L 1UFUA 4U1KB 1WBZB 3ARBD 4JREC 3WFBH 1LWRA 5FCUL 2X7LB 1F6FB 1ZLSL 2ZKHL 2FX7H 1IAKB 2NX5E 4MD5A 5ESAB 5HHVH 2YMXL 1U8NB 3ARDC 4OCSH 2DQIH 3MOBL 4OZFG 1U8OB 3DX7A 4C56B 4NQEE 5HDOA 3P0YH 3F62A 3MMEA 4K3EL 4IMLB 2HVKA 1R24B 4QOKD 3FO9A 5FV1L 4N9GA 3F7YB 1SM3H 4MDIB 1I85A 5C0CA 5TGBB 1D9KD 3MJ9L 3WKML 3C5ZB 4JLRB 2F8XC 4RGMB 6CGTA 5LQBH 5CEYB 4XZUA 2EDQA 5KVFH 3PWLB 5C0CD 4K7PY 1NAML 5E1HB 1N0LA 3ARSA 4JHAH 4JB9H 4N1CA 5HHPA 2BC4A 4MNQB 3GMLA 3NCEB 5I73B 1IVLA 5T5FL 5IMMA 3HG1A 2BP3A 1UQSA 5AAWA 2R1YA 1K8DB 2AV1A 3W9EA 3B43A 3EYQD 2YMXH 4MCYA 3SCMA 1I8MB 3MOBH 5AD0B 3L3OB 3LAFA 3HG1D 1J9CT 5FECB 2ZCKH 3MRPB 3V7AG 5IK3A 5CMAB 5EBGA 4U3HA 3CUPB 2APVA 3GSQB 4U49A 1GHFL 4HK0A 5DJ6B 3AMKA 3WUWB 1X4YA 2J8OA 3PL6A 3DSFL 5JO5A 1K6QL 4O2CB 3MJ9H 3WKMH 5HYFA 1S5IL 3JV4A 1C16B 3VXSA 1RZGB 2EIEA 3BGMA 2L4OA 4EBQL 4OZHF 3CDGA 3PL6D 3DSNA 3D9AL 1E28A 5SV3A 3EKCA 1BQLH 3FQNA 3CK0L 2ZUXA 1OGAE 5EFIB 3ZYIA 4N0UA 4ZAKA 4EKXA 1FFPB 1F3DH 3VXSD 5F7UA 2IMNA 2PKDA 5DJAB 1CZ8H 2CDEA 1S7WB 1XMWA 4XPHL 4X6FA 1LO5B 4WHYG 5I1AB 2ZNXA 3CMGA 4ZAKD 1A7PL 1P1ZB 1FCCA 3PV6B 4JFXB 1U8IB 5HPOA 1DBJL 2DD8L 4HKJB 1AQKH 3RJQB 4P2QB 4P4KA 4CNIA 1GHFH 4Q9CA 5IWLA 4Y2DA 2EDTA 5J7CC 3BD4A 1K6QH 2DQDL 3A6OA 4JCLA 3TZVC 6FABH 1JNHB 5H94A 3BFOA 4P4KD 4QRUB 2F15A 3U0PB 2MPAL 4EBQH 1INQB 4Y2DD 5ID0B 1H3WM 3OG4B 5GPRA 2HTLC 3CK0H 5F6IC 3IRZA 1H3GA 1MPAH 2WWMC 1I9EA 4PJAF 1B6UA 1T5WA 4EQ2A 2CK2A 4AH2B 4PRBA 3ABZA 1YEHL 3MYJB 3O4LA 3MUGA 2R4RL 4O58L 4NC2B 3S4SA 3FHAA 4XPHH 5DJ2B 4G6MH 2VR9A 2VXSH 2F74A 4R4BB 1JK8A 1U95A 2DD8H 4KTEL 1CF8H 5KSVA 2UV3A 4R2GD 3T0EC 4FG6D 4TULL 5F71A 1XF2A 4YO0B 5JW4N 3VRIA 5A2FA 4KRMB 5HDLA 4HUXB 2DQDH 2QJDA 1DEEA 3HAEH 4I18C 5CP7B 2X89A 1GGYA 1UH4A 3LRSB 1OAYL 4G6FD 1YEFH 1E4XH 1FNHA 3BEVA 4YHPA 2YPLE 1NGPH 2X89D 4YXHL 5BS0B 5GXBB 5FA4A 1DZBA 1KENL 1V7NL 2H26B 3TVMB 1YEHH 3TBVB 4URTB 1HHJA 4O58H 1B2WL 1NEZA 2CQVA 4HS6A 3WHE1 5GJSL 3IVKA 3JV6B 3RGVB 1AR1D 4H0GA 5AWNH 1RJCA 4RCAA 4PR5B 4Y4FA 2VXVL 4PJBE 5IB1A 1ZSDA 4CDGC 1I1AA 2DTMH 4TULH 5ITFB 5IOPA 3QHZL 3SDXB 1MCJA 3FCTA 4Y4KC 5CEXA 4MXWL 4Y4FD 2BNUB 5BJTA 4UT9H 1C5BH 3RNKB 1CDBA 2YWYA 3BH9A 1I1AD 3U2SA 3HB3C 1OAYH 1M7DA 4D3CL 2BMKB 1CN4A 3HZVA 1A6VH 3UZQA 1L9MA 2CIKA 2WINB 3L3JA 4I5BA 3PWJB 3VGEA 4YXHH 5GHWH 3MOAH 4LVOB 1KENH 3EJZC 1G9MH 4RZCB 1JPFB 1TTFA 3OKYA 1TQCB 2D0GA 1B2WH 4KUCF 1JL8A 2GYSA 1HI6B 1M7IA 5DUBB 5IMKB 1TJHL 4JANA 3BSZL 3RX5A 7FABH 4MCZA 3UJTL 4YAQA 1YDPB 2VXVH 3A67H 3H9HB 1RY7B 5HVHC 2ED8A 5J9PB 3MLWL 3T2PA 2I26N 1MIMH 2NY0D 5CSZA 3L3IB 3BJ91 5KBNC 3F65A 3RFZC 5IB5B 3WUWG 2V2XB 4BQCA 4M62L 2BOBB 3MOQA 3GUTB 3PF2A 4D3CH 3M1BA 1ZA3A 1LEKB 1XR8A 1BZ9A 4FQCL 3RY6C 2NY2B 4KU1A 5IESL 5IHLB 1WBXB 5EUOF 4V2BA 3WO3B 3ZE1F 4KVCH 3B8YA 1AGFB 2W60B 1FZMA 5C6PB 1M05A 4EQ3A 3VJ6B 3M8OH 1U8KB 3GSNL 5D2LB 3NGBC 2DQTH 3V4PL 3GMNA 3RDTC 4UTBL 1S9XA 5EU7C 2I27N 4L8BB 3FRPG 3MLWH 3DYPA 4GLRH 1AE6L 4L3EB 2YD3A 3FTGA 3SDCB 3ZZ1A 1IM9B 1ONQB 4P59L 4X7EC 1QD0A 3VFMA 1A6ZA 5ISZD 3ARRA 4HS3A 5EORL 4CVZA 1P4LB 4AIZA 4FQCH 4UIMB 4LLAA 4JGUA 1HEZA 4MAYB 4DTGL 3FQTB 1FAIL 1KB5B 1LK2B 2VWEC 4ZUUB 4GRWF 5DUML 3GJFK 1LO2H 1NDMA 1T1YA 3D85B 3B5TA 3FKUS 3WL9A 1SJEA 2VR5A 3KJ6L 3GSNH 5IM7A 5FGSA 1FO0B 3T8XB 3GSUA 4G9DB 3V4PH 1URLA 3LV3A 5SWSE 1A6PA 3SQBA 5D5MF 1M6OB 2XOTA 4K94L 1Q9KA 4LCCC 3VMOA 4JG0L 2Y4SA 1AE6H 1FJ1B 1UM5L 1R5WB 4Z7VB 4EVNB 1HSAA 2ADGA 3HRPA 3HG1E 5DJDB 1RHHB 1VFOA 2VIRB 1HILA 5TE6L 5D7JB 1LO4L 4DTGH 1FAIH 5DTFB 3LMJH 3RL1B 2DQGL 4AEIL 4KZEH 2G60H 1OQXA 2BCKA 4TUOA 2GTZA 3FQXA 2VDML 3KJ6H 4YBLC 4NHCH 1A2YA 5F44A 4ZUTB 1DQLL 3QBTB 2R2CA 3G5VB 3VI4E 4HWBL 2YBRA 3ALWA 3VXSE 4YZFE 4O2FA 5EZOL 1BJ8A 1T20A 2L0DA 1QFPA 3DTXA 1X5KA 4K94H 1DCLA 1Y0LA 3DVIA 1CXLA 4S1QL 1UM5H 1WITA 1OL0A 4N0UE 5FO7A 2EKSA 2VXTL 3ULVC 1SMOA 5EN2A 4LPTA 3E6HA 5CJ8A 3BVNA 2HLAB 3ZDYE 1CDGA 1LO4H 1H15B 3PWNA 4Q7DA 1QLRB 2DQGH 4M9OA 4GMTH 1TZIA 1XF5A 3QUXB 3H2WA 3K0WA 4HGKC 5C9JB 1NFDB 2VDMH 3VXOB 4UT6L 2D7QA 1CVRA 4LFHG 1V3LA 1NGZB 1DQLH 2MCPL 1CICB 1ZHBA 3FOMB 4HWBH 4E42B 2H32A 5D9SA 3GMMA 5EZOH 3ROLB 4PJXA 3CZFB 2IPTH 4PRPB 4X9GA 3LQMA 5E0QA 1KTLA 5E1AA 4S1QH 1LE5B 2E7LC 1AC0A 2KZ1B 5MEOB 2IC2A 1N59B 3O4LE 1QUNA 4J1UA 1MI5A 4GAJH 4XNYL 1ERNA 2A9NH 4J3SA 5F6HJ 1T83A 5E03A 4PB0L 3GI8L 1CFVL 1MI5D 3W2DH 4XC1H 5IW6B 1LEIA 4FFWC 5IF0A 3AGVA 5JLZA 4UT6H 3QDJB 3GFUA 3V6ZB 3BT2H 1KCSL 2MCPH 2Y72A 3QIUB 5M7QA 1G6RB 4KI5D 1Q9WA 5D93C 4ZOCA 1K85A 1U0QA 3Q1SL 4X98A 2I9LB 4X7FC 4HGWB 3MXVH 1BZ7B 3ARWA 4L1HA 1V7ML 5I6XC 3CSBA 4MX7A 2VLRB 2KQNA 4TVPE 3MLYL 3P4OA 3CAFA 5H2BB 1U58B 4OLVL 5FGBA 1KXVC 4DVBA 3KPTA 3CFJA 1KLFA 3MLXL 1U36A 4XNYH 4NQVB 3T4YB 3RVTD 2OSLB 2ZUVA 4H25A 4WTXA 3V6OC 3D0LB 3DMMC 4PB0H 1H5BB 1G7IB 1PZUB 1CFVH 2J3SA 4XWOC 1KEGH 2H2SC 1XIWB 2G2RA 2ICWB 4FQXB 1X7QA 3E8UH 2EEDA 4QEGA 4R8WL 1YMHA 1KCSH 3L7EB 3EOAA 3KXFB 3RI5K 3TESA 2X70B 2V9QA 1A21A 1W0WB 2I24N 4RDQF 4L4JA 3O4OB 3JVGC 1A1MA 3TT1H 1V7MH 1MCWM 4I2XE 2X4SA 2ESVB 4L8SA 4BKLA 1CL7L 4OLVH 2NXYC 1UXWA 3H0TB 4AJ0A 4TQEH 3MLXH 1BEYL 1Z9LA 1NMCB 3CLEL 1RHFA 3TPUA 4M4RA 1JYVA 1MCIA 1WICA 1SYVB 4IRJC 2CDGB 1TITA 1MHCA 1G1YA 4MXVE 3KHOA 1ITBB 1Y6NR 2AKRB 4GKSB 5FHBL 4GW1B 3MRFB 1CXHA 2Q3ZA 5D96C 4R8WH 1K8IA 1S5HB 1A1NB 3LEYL 2IG2L 3P9MB 1NBVL 1T04B 5GSRB 1U2HA 4LKXB 4ZUWA 1YEIL 3IDGA 1WIOA 3HUJF 5IG7B 4LSTH 4PJGF 1FVEB 3QHFH 3LKSB 4OCNC 2ILLA 4ZOEA 1NBQA 5CEZD 4LK4A 5KSBB 3Q48A 1CL7H 3S3JA 2FHCA 2NY5H 3BIKA 3TNMA 1PQZA 5I1HL 3H9YA 1I7RB 3STZB 4NKOA 1XGUA 4N0CD 2R1WB 3CLEH 5C3LD 1TMCB 4NO5A 5I1DA 1QVOA 4FXGB 4R7NA 4V1DA 4LLWB 4Z77B 3T08A 3V8CA 1FRGL 2XZCH 4PY8J 4HBQA 5DMIL 3S34H 1FIGL 2ERJC 2JJTC 4NC1E 4V1DD 1T0PB 5F9DC 2DYPB 3LEYH 2GI7A 2IG2H 4XB8A 3O6FA 4RMQA 4R0LB 3S96A 1CBVH 2HJLA 5C0GA 1YEIH 2HRPL 4QY8A 4N68A 4RAVA 2IF7A 2DJUA 3WLWC 2VH5L 1W72B 2ZUQC 4Y5YA 3O6FD 4HLZH 4KK9C 3QCTL 4HULB 4MA1B 4MQXC 2HH0L 3HC0A 3OKMA 4LAJH 4M7ZC 4YHZL 2BVQB 2BSTB 3OKLA 5I1HH 4BSWB 2IBBA 1YY8A 4NO3B 3PQYB 2VDNL 1JF1A 5F6HI 1YC7A 2X6MA 1OT2A 2YSSA 5C08B 3V6FA 4LPUA 5DMIH 1FIGH 3K8KA 1EGJA 4U6HA 1TFHA 1MOEA 4Y5XA 3QIBA 4XHQA 3VXQA 5CGMA 3C6LA 2NX5B 2W92A 3HS0B 4NN5B 1N4XH 1N5AA 1CFSB 3MRHA 3SEPA 4X8JB 2EYRA 2BXZA 4L8DB 1XCQB 1A5FH 1QHOA 4QRPB 2VH5H 3VXNB 3QIBD 3C6LD 3WHXB 3QCTH 4ZO9A 3BPCB 4YHZH 4JN2A 4MYWB 3BUYB 1PJ9A 3BWUC 1RZ8A 1EVTC 3WN5C 4WI3A 2VDNH 3BUTA 5JPMA 3NIGE 4YHKL 5L8JB 3F6LA 5CBEB 1OAQL 3PG2A 1KUMA 4XVSL 3P73B 3LN4B 1SBBA 3WFHA 4BELD 5JZ7C 2WP3O 3BOVA 5HYIA 3P3YA 4GKNA 4OUUA 1GZQB 2YUXA 4LF3A 2NCMA 3G04B 5E9DE 1JZ5A 1Z9MA 5I8CA 1ZOXA 2FL5B 1AGDB 5HGDB 4HKXB 1NDGB 3IJYB 5DJYA 3KNBB 4KROB 2DOCA 4ENED 3D3VE 3P30L 2N7AA 2QSQA 4G42A 1TDQA 3ZDXF 1TETH 4J8RA 4Q9RL 4C59B 3OGCB 3GMPA 1JHLH 4F7EB 3HNVL 2P4AB 4XCNB 1S8DA 2FEEL 5J4MA 3A6CH 3MLRH 4DZBB 1MHEA 3N1PC 2VXUL 2Z8SA 3CSYA 2Z31C 3EYVA 4PJXE 2OTWA 4XPGL 5JPNB 5I9QB 1KJ2B 1ZA6B 1N3NB 3LH2L 1F3DJ 1ZE3C 2IQ9H 3CVHA 1DVFB 5C2UB 4OGAD 3OBAA 1MI5E 4HXAH 3V0WL 1BHGA 5KZCB 5ICXA 3P30H 4OLXL 2V5RA 4Q9RH 4QWWC 4KI5E 2CDFA 4MXQD 1MVFA 4NQXA 3I3BA 3HNVH 5ANMA 3K7UA 3ARDA 4G7VL 2VDRL 4EI5A 5GZOC 3EOTH 1ETZB 3QA3A 5I8OH 4KH2A 2VXQL 3AU1B 4G8IB 2VXUH 4PY8I 2YZ8A 1NGYA 3ARDD 4DGIL 5J56B 1U8QB 4Z7NF 1RZKL 5GRXG 3MJ9A 2JTDA 1OQOA 3LH2H 3QULB 1KCVL 4HMEA 3PIQB 3F7VB 1NAMA 1GCFA 5CILL 3V0WH 5TQ0H 5T1LA 3GK8L 5DD6A 1VDGA 4LSVH 1CGSL 1J8HB 5CAYB 4KV5F 4OLXH 5DI8B 3MLPA 5K93A 3RIFK 5BVJA 3GIZH 5T1LD 5D1XC 2P24B 3GM8A 3REVB 4UDUA 1WCQA 2GFBB 4ZSOB 5I8KH 1YEKH 2BVTA 4G7VH 2XXMB 3D18A 3U7WH 1MELA 5F7YC 2VXQH 3IFNH 2R39A 4PLKC 5HHQA 2CH8A 5LWYH 3Q6FA 2YPLB 5E8EA 5F89B 5I16B 1IGJB 4YGAB 1GAFH 1KIRB 4DGIH 2PXYA 5L7XL 1X5FA 1RZKH 2CUHA 3GSVB 3IFOA 4PP2B 1SBSL 4KI1A 3L5JA 4LKCB 3DUUA 2GK0A 3EO1A 3MBEB 5HJ3A 1EERB 1AO7A 2EDNA 2PXYD 4H1LH 4U1MA 5CILH 4WNQB 2E3VA 8FABA 4XBPB 2COQA 2Q7YA 3GK8H 3O6LL 3WSQH 1CGSH 2W59A 2XWJB 2WIMA 1AO7D 1W0VB 3B8SA 3WIHL 2B4CH 1YMMA 3VXUA 1HSBA 4MDJB 5GISL 2YXMA 2VL4A 5EO0A 5H35B 1GGUA 3IKCA 1KCUL 5ENWA 5T3XH 1AH1A 4I48A 1YMMD 3VXUD 3EHBD 2BVUA 3QCVH 4HCRL 5J1TC 2XY1A 3HAEA 4G43B 1BVKA 4YFEA 5HHXL 4FTVB 1YUHA 2P5WB 1JWUA 3D69A 3C9NB 4NKQB 3L3DA 2X2YA 1W8NA 4KKLC 3TZVA 2FJHA 2ITDB 3KR3L 4JQXC 1R5IA 3MV8A 5FKAB 1DDHA 1BX2A 3O6LH 2H41A 5HY9B 4NJ9L 4V1DE 1PKQB 3B9VA 4ODTL 1X4XA 3TZVD 3G5ZB 3IDJA 3MV8D 3SJVA 4XCYB 5IBLC 3RWGB 4KQ4L 3C5SA 1K4CA 5KOMC 2OP4L 5DQJA 2XQBL 3SJVD 3QR2A 3GRWL 5JDSA 1WF5A 3S36L 3DHMA 1JGDB 5F8QC 1JFQL 4CJ0A 5JA8B 5LG1A 4OB5L 4L9LC 4TN9A 5A3ID 1CQKA 1LE9B 1SEBB 3OJDB 4HKBB 5CWSA 1A7OH 2FIRT 3HHRB 4NJ9H 4PJCF 3MTRA 5IEKB 2Z92B 4OCMC 1P9MC 3UMTA 4XPBL 2OI9B 2CIIB 3ULUH 1NCCL 5C0AA 1F97A 5C71A 3SQOL 4X99B 4L4VB 3EO0B 2OP4H 1PDKA 3QDME 3A0OA 15C8L 5LBSL 5C0AD 1QRNB 1IKFH 3VFTB 1EEYA 4GQPH 1JFQH 1WTGT 1TPXB 4Y4KA 1ZMYA 3O2VL 5C70A 4M61A 4PREA 2N56A 3DVFA 1Q9LB 1H3XA 1LD9B 3DV6B 1MJ7H 4W70A 5GS1C 5SWSB 3O41B 3RVWC 3WXWL 4PJ9B 4XPBH 5I66B 5DJXA 4Y4KD 4PJEF 1VESA 3DJ9A 1OAXL 4LCIL 3NABL 1IILE 2HJFA 2Q6WA 2AQ2A 4TTGA 3HB3D 4OD2A 1R3JB 2R1YB 3W9EB 15C8H 3SCMB 1WFTA 5H37H 2E6QA 4PLOB 3MV7B 2VQ1B 3IXAA 1UXSA 1E4XI 1QLEL 3BZFB 4HIEB 1SY6H 5BZWA 5CJ5A 1T4KA 2R0WL 1I9RL 3GNML 1A7QL 2WM0A 3FRUA 1F4WL 4CVWA 5IB2B 3O2VH 1S7TB 2VLJA 1AQDA 1JTOA 2VZ1A 1GPOL 3FT3A 4RMRA 3NMEA 3RWCA 3WXWH 3VXSB 1QRKA 1PFCA 2YD6A 3M45A 4RMUA 3SDAA 3RY6A 3CDGB 2VLJD 4LCIH 3OKKB 3BPOB 3MV11 4LVEA 4LSPL 3RHWF 3GSNA 3PWPA 3SY0A 4OZHB 2PF6A 3SDAD 3IU3B 3HMXL 2EH7H 5K9KA 1T5XB 4ZO6A 2NY4D 3GHEL 3PWPD 4U6XA 3HR6A 1QLEH 2W0FA 1HKFA 2BNQA 2R0WH 1MAJA 5I74B 5INCA 4TSAL 3GNMH 2BVPB 3OV6A 1RZIA 4TSBH 4X5WA 4LSRL 2CO6B 4IRZL 3QFJE 4X4YA 2D7TL 3FN0H 3ILQC 4Y2DB 3HNSL 5ANME 3RDTD 3WJJA 2BNQD 5DJZB 3UXFA 1RUAH 5IMOA 1GPOH 4HGMA 5J89A 5H94B 4ZTPH 2XY2A 3BPNC 4NZDA 3S3PA 3PP4H 3HPLB 2IWGA 1R3LA 2WUBH 2Y5EA 4LSPH 4H5SB 4M5ZL 1HINH 1ZVYA 1T5WB 3VFWA 3SKMA 3U4EB 3EFDL 1IAIL 4U33A 4F9PC 1NLDL 5FO9B 4Y2OA 2J4WL 3O4LB 3HMXH 1KPUB 4ZFZA 5F1OB 2X9XA 4XMKL 4DUXA 2J8UF 3VXPA 3DO3A 1J1OH 3IS1X 4ZD3L 3WE6B 2VISA 4DOHE 2E7HA 1HDMB 4JFDD 1GGTA 4TSAH 4D8PB 4YH6A 4LCCA 3ZE2E 4LSRH 2JJUA 1NCNA 3TYFA 1D5XA 4BK4A 1R3KA 5IP4A 2VR4A 3HNSH 4KJQC 2QHRL 2A2QT 1CGWA 1SJHA 4UNTA 2GJZB 3KPNB 4OT1L 3FO1B 5IIEA 2XG4A 2EYSB 2VNCA 3GHBH 4PLJD 4GO6B 2EDOA 4M5ZH 4FQHA 2AK4B 3REWA 1FZKA 3E2HC 5EPMB 1DUYA 1HQ4A 5J1AA 3EFDH 3B4NA 4GLRI 3OXSA 4Y1AA 4HWBA 5DJ8B 4LVHC 4WHYH 4JVPA 2J4WH 2B5IC 1R0AL 1OF2B 1JHKH 4Q0XH 4XMKH 1PX4A 5IJVA 4LRNH 4Y1AD 4FQ1L 4ZD3H 3LN9A 4MS8D 3CFDB 3DRTB 1ADQL 4TYUA 1GIGH 4X4XB 1ZSDB 3J8F7 1UT9A 4WEBL 3PHQA 1J0ZA 1YMME 3VXUE 3GJFA 3HRZA 2VDPH 4PJ7F 3TBTA 3SO5A 4I3RH 2G9HA 3X12A 2Q8BH 4OT1H 1WCBA 4ONHB 1G7QA 5GGRY 5C09A 1NANH 1FQ9C 4PJ8B 1EAJA 1A6TA 5EC1A 2CIKB 4I2XB 5E95B 3K80A 3PDDA 3FAWA 3B5GA 1T0NA 5C09D 4K7FA 1AGEA 5ALCH 3ZE0E 4GBXB 1CDYA 5AZ2L 2GCYA 1KG0A 3MV8E 1FNEA 2RIKA 5D6CB 1VPOH 4FQ1H 4JE4B 4PRNA 1FE8L 2D31A 4MCZB 1ADQH 3MLTA 4OIIL 5EBWA 1K9TA 4OZGA 3C5ZC 5L0QC 3OX8A 4RGMC 3K2UH 3SJVE 3UPRA 1J05A 1YNLL 1NCWL 5IVXF 5ADOH 4M7KL 1IAOA 1RVFL 4Y89A 2GJ6A 3RX8A 4RMSA 5E4IA 5TDNB 2PW1B 4DCQA 1CGTA 2XNAA 5I73C 1FYHB 3RWIA 4TPRL 3LKOA 3DX6A 4Z78A 4O4YH 1XR8B 3P0GB 5HGHB 5DMKB 3HI6H 4P5TC 4KKAC 1MLCA 3DI2B 2GJ6D 1PKOA 5BOZG 4BSVA 3CLFL 5E7BA 5EUOB 4K7PH 1QFHA 1F2XK 4N0FA 3VFGH 5D7LE 2J88L 4KJWD 4FFWD 4OZIA 1FE8H 2DLFL 4NRYA 1GGCL 3G6AB 4OIIH 4K3HA 5I8EB 1D5IL 1GC1C 2V2WA 1OARL 4JY6A 4GSDL 1BZQK 5C0AE 4PRID 3UTSA 1JPSL 3FB5A 4I0PC 3ECBB 4M7KH 1RVFH 3X13B 2IPUG 3UTSD 3DMMA 1UWEH 4HKZA 3H42H 5DGRA 4ZS7L 4B50A 5DMJB 1BFOA 4KQ3H 1JN6B 3AREA 5DS8A 3CLFH 3K4DA 4LVNB 3DMMD 1RUKH 5GRVK 5GRUL 4OCRH 1NCUA 4GRWB 2EE9A 3D0VB 4PJFA 2J88H 4XWOD 2H2SD 1L0XA 1RJLA 2P5EB 4KKBC 3CU7A 1BIHA 3ARED 2DLFH 1GGCH 3S36X 3VD4A 4ORGB 1U41A 4PFEA 2HTKD 1S7VA 1OT1A 4PRDB 1ES0A 3LZFL 3MROA 1OARH 3KPRB 1U92A 2EIBA 2IQAA 5D5MB 2FZ3A 2EDKA 4WRLA 4B0MM 1KULA 1HSAB 3VXTA 3BZ4A 2QQKH 4MD4B 4U1SB 1HILB 3VU2A 4Z76A 4IOFC 4OFDA 4N0YL 3AROA 3RUGA 2HFGL 4BH8B 1U8JA 4ZYKB 1AD0A 3QIWB 5IFHH 5MP6L 3MACL 3CFCL 5CD5D 3C8KA 3QI9B 1JV5A 2R1XB 5GRUH 4EDXB 2BCKB 2XYCA 3BAEH 3R4DA 5DF0A 2NTFB 3PJSB 1SHMA 2GQHA 2VLJE 3B6SB 2R0ZL 4X4MA 5D6DC 2AJYL 1A7NH 3QG6A 2GKIA 2YBRB 1MUJB 1F11A 4R3SB 4WO4B 3I84A 2YS4A 3UDWA 1T20B 4F7PA 2WIIB 4NCDA 3JUZA 1Y0LB 1NKOA 3PWPE 1EA9C 3Q3GA 1YYML 5JIKA 2LU4A 3PABA 5E9DB 2EKSB 4X6CA 5K9OA 5B39A 2AGJL 1A4JB 4CRPA 3LB6C 3VFSB 4N0YH 3QEGH 3IGAA 5B38A 2HFGH 1FL5A 2O5ZL 1A6WL 1FGNL 3QJHB 3D3VB 5KG9B 5GRVL 5DRZB 3VI3E 1P7QA 5MP6H 3MACH 4YDJA 2JJTA 1TZIB 2BJMH 2VDQL 3CFCH 3I6GB 5ALBH 2B7DT 2ZG2A 4YHMH 5IROA 2SEBB 2R0ZH 4JO2L 1YZZA 1FIEA 1P7QD 5GS2H 1O7SA 4FMKA 2FIKA 4UDTB 3C08L 4JFZL 2H1PL 4PJXB 4I0KA 1Q0XL 1OCWL 3NFSL 3UCRA 3I6KB 4OGXL 4YHNA 3Q5TA 3WLWD 5GSVA 4IRSA 1ZKAA 2DL2A 5EU4B 1NL0L 2BRQA 2NY7L 2JK5B 3BO8B 2D7NA 2O5ZH 1A6WH 1FGNH 1TQCC 3D2UB 4IRSD 2AP2A 1Q9OB 1QEWB 4JFYA 2DQEL 4PTUB 4QCIB 5EBMB 2YUVA 3MJ8B 2X4RA 2X40A 2VDQH 5C6WH 1ZK9A 4Q9QL 1F6LL 3P40A 4DKFL 1CL7I 5IF0B 4WHTA 3LD8C 5JLZB 5L88H 1HYRC 4JO2H 3HZKA 3WKNA 1KJ3L 4WY7L 5SX5K 4P49A 3VRLF 3ROOA 4X98B 4G8FA 4JFZH 3SHSA 4HIXH 4H88H 5J13B 1Q0XH 1OCWH 4LGSB 1HXMB 1QPPA 3NFSH 4YQXL 5I2IB 2D4FA 3W39A 2WBKA 2X4PA 4Y1AE 3ARZA 1EAPA 4CVXA 4DVBB 3NFPA 3NA4A 2VLKB 4MSWA 1XGQB 1MCQA 2PO6A 5JOFB 25C8L 2I60H 4ZPVB 3GB7B 3QSKB 2PTVA 2M26A 5DD5L 4NRZB 4Z6AT 3QUYB 3EYUH 3CU1A 2PO6D 3O3DA 4XNXH 4Q9QH 4DKFH 2X4TA 2FATH 4MNHB 3SO3B 3U7AA 1YMHB 4YK4B 4WY7H 1MCKA 5CZVL 1JUFA 1AJ7L 3GIVB 4MJIA 4NQDB 5C09E 4PB9L 4ETQA 5DLMH 3S7GA 4YQXH 3SDCC 5CBAA 4OV5B 3MV9D 4MJID 4BKLB 3EYSL 1F3RB 4MAYC 5FYJH 4XNZB 1UYWH 25C8H 4PGDB 3X17A 5KVMC 4GT7A 1KIQB 4XXDA 3UAJC 4LHUA 4LL9A 2AABL 1WAAF 3EBAA 1KB5L 3GSXA 1JNJA 4HUUA 4OZGE 1QR1B 1WFUA 3PE9A 4F57L 1T7ZA 3SE8L 2AJZB 4LHUD 1K4DB 2ZCHL 5DJCA 5CZVH 1FO0L 2GTWA 2JCCA 4ZUWB 3VWKB 4E5XA 1AJ7H 2GJ6E 4LDOB 3ZHLA 3KPLA 1Z3GH 2E8ZA 3W0WB 4PB9H 1T21B 5EIIA 3KLAB 3HUJB 1CXKA 1IGML 3IF1A 4GRLB 3HZMA 4U6VH 3T3PE 5HGBA 4PJGB 5D7JC 5JHDA 3EYSH 1TVBB 3WLBA 3S5LG 3PXHA 4WWKC 1OAZL 4Z5RA 4R7NB 4KPHL 3VRJB 5JHDD 4OZIE 4NPYB 2EXWD 2PYEB 1KB5H 1G7MB 5GZOD 5SX5H 3UTSE 3OKNB 2UY7A 1RI8A 3QCUH 2ZCHH 2G5RA 1FO0H 4OTXL 5E2UL 2HJLB 3TIEA 3O2WL 3DX9A 4HS8H 3STBA 5MENB 2D0FA 5IR1B 5DZOA 2OQJA 3ESVF 5J11C 1WV7T 1JPTL 5I0DA 2BERA 5D1XA 3G6JA 3RP1A 2X1XR 1WT5A 4M48L 1CE6A 1YNKL 2CRYA 4PYHA 1EH9A 5A2LH 1YY8B 4B41A 1JF1B 1OAZH 3FQRA 4PJFE 5GRWA 4KPHH 3WDJA 3B2VH 4P2OB 5D1XD 4HWUA 3KPPA 4NOBA 4LCUA 4Y8DC 3EZ8A 2QADB 3MNVA 3V6FB 1WUNT 4FFYL 4IM8A 3SKOB 4F3FA 4LPYA 3TFKC 4PLKD 3QDMB 4MA8L 1RZ7L 3FO0H 3QUZB 5I1EH 2X05A 3OB8A 1KJVA 3WIHA 3B3IB 3LPWA 1D6EB 4IOSD 1KFAL 3RUGE 1E6OL 1FYTA 3BZEB 4M7JL 5HDQL 1KOAA 3RZCB 1D6VH 1JPTH 3ZT6A 4JN2B 1YJDC 2MNUA 4NCC2 4M48H 4P5MA 5MERA 1YNKH 1VA9A 3DWTA 1FYTD 4U1LB 3MREB 3RA7L 4N1EA 4X6EA 2YC1A 1LEGA 4X4ME 5IGXL 1IGTB 1UCTA 1REIA 2HVJA 3IDIA 4LQFL 2VAJA 2XKSA 2XN9B 4M3JA 3QIUC 4FFYH 2BY3A 2VABB 1QKZH 4OUUB 2VZUA 5F70A 4LF3B 1RZ7H 5L2KA 2IBZX 1G6RL 4JO3L 2A6DB 2NY1B 3ZKQD 1CDCA 5I8CB 4X6CE 1U8LB 1HK6A 4PD4K 3L5XL 1D5MA 1WEJL 1KFAH 2IFGA 1H0DB 5DJYB 1E6OH 3D6GA 5IJKC 4M7JH 5L2KD 5HDQH 4KKLD 4S1RH 4MB3A 2DQFB 3HE6B 4L8CA 4QT5B 3H9SA 1Q94B 4RDQG 4E41A 3GRWA 1H5BC 3GBNL 1XGYH 5HYJE 1OW0A 5IGXH 3MRMA 4JKPL 1XIWC 3H9SD 4OQTL 2NY3B 5DVKA 1RJZB 3UBXA 3QQ9D 4OBRA 4E41D 1IFHL 4P46A 2R2BB 3ZKMC 1HQRA 3JTTA 1F3JB 2W91A 3K81A 5MEQA 1DUZA 2ZCLL 2OTWB 3TYGL 1YECL 2BOCB 4FABL 4CW1B 1T0MB 2E6PA 4P46D 4P9HC 3O4OC 2KKQA 3EDEA 3K2MC 2OL3B 4L9LA 4HC1L 3IFPA 3L5XH 4EIZC 4A6YB 1WEJH 3U0WH 2C1OA 3BW9B 4P9HL 3HCVB 4NO2A 1XF4B 4JZJC 1OSPL 3QFJB 4XTRD 3TN0B 2AV7B 5EUKB 3NIDF 3CCHA 3GBNH 2R2HA 4K9EC 5JUEL 3VGBA 1AXSA 3W9DA 2KH2B 4EI5B 5F1KC 5EH1A 1MFBL 4GW5B 1XAUA 4K9EL 2FBOJ 1OSZB 3CXDL 3QB7C 4ODWA 5JOPE 3NCYS 4QLRA 4OKVA 5J3HC 4BZ2L 1NGYB 2EYTA 5BV7H 5HI3D 4WFGE 5C2BL 1Y6KR 3BP4A 5EWIL 3WIIL 5C0RH 4Z7UF 4UUJA 1C08A 1TTGA 4JHWL 4HC1H 2IFFL 1UCBH 4HHAA 4PJHF 1BLNA 4YFLI 3UYRL 2LV4A 4HQQH 1FNGA 5E8DH 2GK2A 1BOYA 4I4WB 1OSPH 5F1NA 4MA3A 2P7TA 3EOBA 1D5ZA 4UBDD 4YNYB 4YUEH 3UTTA 1RZJH 3OXRA 5JUEH 3VDBA 4KK5C 1VKXB 5DQ9B 4LSSL 5E00B 4X0KA 1QLFA 3D18B 1YNTA 1RUML 5HHMD 4PRAA 3UTTD 1XT5A 4FXKA 3CXDH 4CU6A 4MJIE 3QYCA 2VLMD 3Q6FB 4NDMA 4P3CH 1KN2H 1M71B 2PXYB 4P23C 4LLVB 5C2BH 3IFOB 2P49B 1C12B 1UZ6E 1UB6B 3D39A 4QRSA 4R90L 5EWIH 2A74A 2ZSWA 5BZDA 2KBGA 4MZ2A 4KWUA 4JHWH 2Y9RT 2VN7A 5IBUB 4K3DL 3HPJA 4QKXB 4WW2F 1W72L 1IC5L 3D39D 4UNUA 4X6DE 4C55A 5BQ7A 3UYPA 1HH6B 3G08B 3HMXA 4YC2B 3UBXI 4AENA 1AI1L 1ZLUK 4R9HA 3HN3A 1DSFL 4WCYL 5EO0B 1I8IB 4LSSH 1MY5A 1RUMH 4W4NA 2JCCE 1JGVL 4XH2B 2B0SL 4IIQB 4HIIB 4P48A 1JBJA 2CK0L 3RWEA 1BBJB 1IJ9A 5F3BA 3F6IA 2R23B 5LGJB 1T1ZB 3HAEB 2GUOA 3CSGA 3VG9B 4R90H 1J87A 2RCSH 4PGBB 5IVZB 3ZKNC 4S0TD 4C83B 5JHDE 3P9LA 3L3DB 3PDGA 3MZTA 4ZQKB 3STLA 3BN9C 1SJXA 3NCFB 1W72H 1BX2B 5HGAA 4G6AD 3PWVA 3LKNA 3ZO0A 1FZOB 5B21A 3KG5A 3AY4C 4U1IB 4QRTA 2EDLA 1DSFH 3F12A 1K4CB 4WCYH 4F9PA 5A16B 4OF3A 5T3ZL 3VFPA 3FO2B 4UZGA 5E8OB 4GG6F 4QHNB 3HR5A 1NJ9A 5E5MA 3UEZA 1JGVH 3D25A 3L5WB 2CK0H 5F1IA 5JDSB 3TO4C 1QSVA 4O2EB 2VDOL 3HLAB 1RJYB 4XMLL 1A6AB 4HLJA 4ZMAT 3AUVA 1NCBL 3MX0A 5EU3B 3G6JE 5T3XE 4KROC 1N2RA 1X5IA 3T2NH 1U3YA 3SE3C 2X1QA 5IW3A 5D7LB 5DK0A 4ODXB 3OGOE 1FORL 3AMLA 1O7VA 4OM0H 4FQLH 2FR4B 5J6HB 1WZLA 4PJCB 3CVIL 4U1HB 5D2NA 1ROWA 3QDGA 1FFNB 3GSRA 3O6KH 3S3SA 5T3ZH 1BECA 4PBWD 1FC2D 5F9OL 1ADQA 5I9QC 3QDGD 3F5WA 3M17B 5FIEA 5D1ZB 2VDOH 3MO1A 3J7HA 4XMLH 1CLOL 4Y88A 1FYTE 1DVFC 4ESKA 1Q72H 3QEHA 1I4FA 3EO9L 4U6YA 3LHPH 3TBWA 3NZ8B 3MGOA 3MRLB 4FQQA 1BVLA 5I1CL 2OTUA 1CFQB 4FNLH 4U1KA 4BYHA 2IAMA 1WBZA 4S10A 1FORH 5KVEL 1ZLUH 2X7LA 4X7TA 5LKNA 1IAKA 4QYOB 3O6ML 1U8NA 5DMGC 2DIBA 2F53B 2X1WL 3CVIH 1EEZB 2IAMD 1U8OA 4LLUB 4Z0XB 4C56A 1CXIA 4WI2A 4IMLA 3WFDL 4ONFH 5FCSH 4UAOC 5L2KE 1CIUA 3ULUE 3F7YA 4C56D 4CL7A 3AXLB 4MDIA 1CLOH 1N0XL 1Z6JT 5TGBA 1KJ2H 3C5ZA 4JLRA 3HC3L 5CEYA 4KK8C 3BH8B 3QDAA 3H9SE 5I1CH 2AVGA 4E41E 3PWLA 3C5ZD 4MNQA 5EU6A 3L6FB 3VXMB 3FT3B 4WGVB 5IBUG 3KDMB 4KHTL 5KVEH 4UB0H 1K8DA 3O6MH 1HZHL 1I8MA 4QTHB 3HE7B 3W82A 4MNQD 1G9NC 5AD0A 3L3OA 4XX1G 2XZAH 2H45A 3MRPA 3WFDH 5CMAA 4KKAD 1G9NL 4KXZH 4OAWB 3CUPA 4NZTL 3GSQA 4F37K 5DJ6A 4U6XB 1NANI 3WUWA 2ITCB 2CUIA 4C54A 1N0XH 1RFDL 4O2CA 3HC3H 4GS7B 1DEDA 4X5WB 5IFAH 1C16A 2AJUL 3O45B 1MNUH 4J3OC 2DLIA 3IAQA 1BFSA 5DO2C 1NMBH 4HBCL 4KHTH 5EFIA 1EHNA 3RWFB 1FFPA 5D72L 5DEGB 3S98A 5DJAA 2OBGA 1S7WA 5SWQB 1LO5A 3R0MA 5I1AA 3KYMB 4ZFOA 1P1ZA 1JYXA 4JFXA 4B7LA 3BZDA 1U8IA 5CJXC 5LJYH 3FRPA 4J4PA 1NFIA 4HKJA 4NZTH 4B5EA 4P2QA 3KPOB 2XZQL 5BW7A 3VXPB 3DYOA 1RFDH 1QG3A 4EXPX 5FM8A 3QXWA 4E0RB 4J4PD 1JNHA 1MQKL 4P2QD 4QRUA 1U3ZA 2AJUH 1X5YA 3U0PA 5F93C 3U46A 2JJSC 4DFIA 1INQA 5D70L 5ID0A 4HBCH 4XP5L 1BIIA 4AH2A 3U9UB 2RR3A 2RFXB 1XH3B 5D72H 3MYJA 2HT3C 3ARFC 5DWUL 3KPSB 5DJ2A 5D7IE 1DUYB 1F58L 2E9JA 1DLFL 2X4UB 3D39E 4PV8B 1KLUB 4R4BA 3OKDB 5C0DB 2AXFB 1FNLA 4OF5A 4Q6YA 4G9FB 5TDPA 4P5KB 2LE9A 4YO0A 5GS2D 2N4IA 2YD7A 4OUOA 4HUXA 4LPCA 1K3ZA 4X7CC 5CP7A 3H7LA 1MQKH 2H6PB 5I71C 1BOGA 3RWHB 43C9B 3LRSA 3SGJC 2EICA 3V7AE 4FFVD 4LGPB 3AVEA 1CDHA 5CS7A 3N1MC 3QG7H 5F9WB 3TBTB 2OJZL 4P2RA 5BS0A 4EN3A 3MRBB 5A2KH 3TVMA 2H26A 5DFTA 4FQJL 4PJ7B 3TBVA 3CX5K 4AZ8A 1MIEL 3ISWA 5DWUH 5HYSG 1A6TB 2LVEA 3R0NA 3E0GA 5BS0D 4NKIH 4YXKL 4ZOAA 4JFOB 1F58H 3JV6A 4NC0B 3RGVA 3TVMD 1DLFH 4NKMA 1B6DA 1AGEB 4PR5A 2GW5A 4TUKL 2LAGB 1RZFH 4IBLT 1A9EB 3RGVD 3SDXA 5HPMB 4UMGA 1I85C 4JM4L 4I9WD 2BNUA 3ARGB 1F8TH 1P4BL 3RNKA 1MFEL 1OOAA 2BDNL 5TE7H 3UPRB 4GXUM 1MFCL 3HMWL 2WINA 3PWJA 4KUZL 3MCLH 2PNDA 5IVXB 2ZOLB 4RZCA 4FQJH 3P2TA 1JPFA 1RU9L 3QQNA 1MIEH 1RK1B 1HI6A 4MQSB 3SCMC 4HFUH 3DHJA 4YXKH 3RBGA 3U1SL 2FEDD 5CJOH 5DUBA 5IMKA 1JGUL 2QTEA 4LFHD 3RPKA 3IDUA 3H9HA 4TUKH 3H3BC 3PGDB 1F45A 3VI3F 5J9PA 1NSNH 4JM4H 3L3IA 4EDWL 2ADJA 5IB5A 1P4BH 1MFEH 2V2XA 3BPLB 5F3HB 2BOBA 1AY1L 3GUTA 3QZWG 5D2NE 1LMKA 1LEKA 4Z7WA 3QDGE 1MFCH 3VGHA 3HMWH 2BVOB 5TQ2H 4KUZH 1WBXA 2QBWA 2VZSA 3BPOC 1AGFA 2W60A 2F5BL 1RU9H 4ZAKC 4FQ2L 5EBLB 1I9IL 3VJ6A 2NY2D 3G6DH 1U8KA 3GMOB 4CN1A 4XI5C 5D2LA 1BFOB 3QH3B 1U8MA 5K33A 2O61B 1IGYB 3W81A 5I18H 4N8VG 1KV3A 4L8BA 4GXVL 4TUJB 4P4KC 2YR3A 3UZVB 4QHUB 3V7MA 5IWLC 4L3EA 4YX2H 3QXAB 4Y2DC 5L9DL 3SN6N 3SDCA 4KDVA 1XZ0B 1IM9A 4NGHH 1ONQA 4P4RB 1AY1H 1XF3B 1U92B 1XR9B 1P4LA 4L3ED 4M1GL 4C56E 3OF6A 3BZ4B 3IDMB 4MAYA 3FQTA 2F58H 4LDLB 3SDCD 1TQBB 1IM9D 1QBLL 1KB5A 1LK2A 4ZUUA 1ZS8B 5CGTA 1OTUD 2F5BH 4FQ2H 1I9IH 2P1YA 1MWAB 5J0BA 1JNLH 4H20H 4MAYD 3P11H 4OIAA 1FO0A 1RURL 5TF1L 3NAAL 1LVEA 1CT8B 3UAJD 3D85D 4XAKD 5J8OA 1UEMA 4NNXB 3ZYJA 4LDEB 3NIFE 4Z0BL 3FQUB 3KYOB 1X9QA 5EU6E 1FJ1A 4Z7VA 1R5WA 1Z0NA 1RHHA 2DI9A 2VIRA 3ULVF 2IJ0C 4F15B 1PG7L 5JMOC 2R2EB 1AIFB 3MBXL 1BQSA 5E6IB 5DTFA 5K9OB 2MQ0A 4S1DC 1WZMA 4UQ3A 3GBMH 4OKDA 5DK3A 3MRGB 4PGEB 5D7JD 1AR1C 3MODH 2EH8L 4RISH 2R0LL 5D1QB 2NXZB 4ZUTA 1INEL 3JUYA 1RURH 1UENA 4NKDB 4TVPL 3DYMA 4QGYA 3G5VA 3HTLX 1I3UA 5DVMA 3LQAL 3AC0A 5HYJB 1ED3B 5GJTL 4XNQB 4JO4L 1P2CB 3UP1A 4Z0BH 3X3GL 4Q2ZB 1U3HB 5EIQA 1A6UL 4ZDHB 1NBYA 2HLAA 1PEWA 3MLSH 5JW4R 1DLHB 4YHNB 1TJGH 1PG7H 4Q58C 4PJ8C 4BM7A 3MBXH 3I3DA 5E2WL 1H15A 1P6AB 3IXTB 1QLRA 3QUXA 5BXFA 4P2QE 5B3JF 1W2KT 3PGCB 2Z8RA 2EH8H 2H3NB 1NFDA 5C9JA 3VXOA 2R0LH 4OD1H 4JG1L 4LAQL 5IQ7L 1NGZA 1CICA 3FOMA 1YPZF 3QUXD 2ARJB 4ZUSB 4E42A 3LQAH 2D03L 3FONB 4K8RC 5EB9A 4WHTB 3ROLA 4JO4H 1PY4A 5JIHA 3CZFA 2DDQL 4PRPA 1CICD 1OP3K 4K8RL 3ROOB 1LE5A 3RKDC 3TFKD 4RIRB 5MEOA 1FC1A 1WZ1H 1N59A 3TT3H 4PRPD 1OB1B 1J88A 2ICWJ 5E2WH 4CVXB 2XPGB 5HHOE 5IBTL 3KYKH 1SMAA 4MSWB 1YY9C 5IW6A 4LPWA 3F7QA 5K9QG 4JG1H 4LAQH 3V6ZA 2DL9A 3QFDB 5IQ7H 1CE1H 3QIUA 4HK3N 1G6RA 4NIKB 3FFCB 5BRZB 2I9LA 2XRAL 4PJFF 4QRQB 5DUPL 4HGWA 3LPFA 3QDJD 2DDQH 1F4XL 1BZ7A 1HE7A 3QIUD 1JTPA 4NJAL 4P2RE 4NHUB 3TCLB 1JUFB 3S4SG 3ET9F 5H2BA 1U58A 4ETQB 5B4MD 4NQVA 3KPQB 2OSLA 1KEMH 4XVUD 3D0LA 4OQTA 4PD4J 1H5BA 1G7IA 5IBTH 1L7TH 2HN7A 4MNGB 4M6OL 3PXJA 4ODHL 2R4SH 2EKJA 1XIWA 4M3KB 2ICWA 4FQXA 2X4QB 4LVNC 1MCSA 4X6DB 5E8PB 3L7EA 5EO1B 1BWWA 4WV1B 5E6YA 4BFIB 1Z2KA 3KXFA 5F9AC 4HC1A 2X70A 1XIWD 2BY0A 1W0WA 4FQXD 5DUPH 5MEPB 2ZZUT 4HSQA 5F9JB 5E99L 4WIQA 3KVQA 4PG2A 1J18A 2J5LB 4NJAH 5CP3H 4DZ8B 3KXFD 4PJDF 2X5PA 2ESVA 1NEZG 2A6IB 1JF6A 3H0TA 4HAFA 2VAAB 4U1NB 5E08L 3T2QA 2WWKT 3HZMB 1SYVA 2ESVD 2CDGA 3IDYB 1A14L 2D3VA 3ZDZE 1WGOA 2AEPL 2AKRA 1R3IL 4GKSA 3RI5F 4GW1A 2CLRB 3MRFA 3QIWC 5DFVD 1CLZL 3I02B 4BZ1L 4Z5RB 3VFRB 2AJVL 1S5HA 3QI9C 1A1NA 2VZTA 3P77B 3P9MA 1T04A 3FFDB 5GSRA 3VFNB 4LKXA 3LEXB 4KGLA 1OP3H 5CGYC 4H1LB 5FYJE 4RFNB 4D0BB 5E99H 1FVEA 4GRWH 3UJIL 3EJJX 4Z7WE 3LKSA 5M94B 5KSBA 4BQ9A 3MLZH 1S7SB 1SVZA 3L7FB 1I7RA 5A40E 5E08H 2R1WA 3NFNB 2HKFL 4FXGA 4X9FA 4LLWA 1FHGA 5D2LE 4Z77A 3G6JB 4AL8L 1ULVA 2VQUA 2AEPH 4R4ND 5I1KH 1CLZH 3FQRB 5CINL 2EDDA 2AJVH 2DYPA 1I3RB 5INDB 1IEBA 4L3EE 4R0LA 4KK5D 4DWHA 4CJ1A 1S9WB 2DYPD 1W72A 3UJIH 2BVEA 1WLHA 3FT2B 1NMAL 4JPWL 2P8LB 1GGIL 2BVQA 3TWCL 2BSTA 3LKQA 2X41A 4BSWA 4NO3A 3PQYA 4EZMA 2EDWA 4JDVB 3KAAA 4MGXA 4F2MB 5I1LB 2ICWI 2ORBH 4AYFA 3UO1L 5FM4A 2DWDB 4AL8H 1KCKA 3B83A 5C08A 1UADC 4M02A 3PQYD 5TF0A 4YDKH 3MQIA 5EC2B 1ZVHA 4KI5C 2ZG1A 3U30B 4X6EB 4HF5H 1JYWA 4JDZB 1KCRL 4WW1B 5C08D 4Z7VE 1FNAA 2HVJB 3HS0A 4D0DB 1CU4L 3U7YH 1YEJH 3RQ3A 2UZYB 4P9ML 3K8MA 1EHLL 1CFSA 4X8JA 5CD3B 4L5FL 1S3KL 4L8DA 1XCQA 4QRPA 3VXNA 3N0PB 3ZT7A 2NX5D 3WHXA 4JPWH 2OMNA 1FLRH 3DV4A 3BPCA 3VG0L 3KYNB 3TWCH 3RVTC 3IJSA 5MI0B 5I75B 4QRPD 3EAKA 4Z8FL 4ZXBB 5LAXB 1CFTB 1AGBB 5FGCE 3HNTL 1TJIL 3UO1H 1T7VA 5CBEA 2V7HB 1BFTA 3P73A 4UT7L 5T3ZD 3LN4A 1IZKA 1KCRH 4OM1L 1GZQA 3UBXB 4LEXL 3MRNB 2OXHA 2Y7QB 4OGYH 3G04A 1CU4H 4OLWL 4P9MH 5DYOB 2ID5A 3HI1B 3JTTB 3ORJA 1EHLH 1MCOL 2FL5A 3QISA 1AGDA 5HGDA 4HKXA 4CMHC 1NDGA 4DEPC 3IJYA 2OYPA 3KNBA 1JHTA 3V9FA 2UZIH 1G9EA 3VG0H 3QXDB 1K5NB 4OLEA 5AYQA 3OGCA 4Z8FH 4OI9A 4F7EA 4KROD 1IC7L 4XCNA 2JJVA 4NO2B 3HNTH 1TJIH 2Q20A 2X1PA 2VKWA 4AQOA 4XNZC 3MJGX 4DZBA 1PG7X 3HFML 2R9HD 5KS9F 3MC0A 1UWGL 2OM5A 3BKJL 2DQUH 4UT7H 5JPNA 4PRPE 3O8XB 4P2YA 4OM1H 1KJ2A 1ZA6A 3QUKB 4LEXH 1MSPA 1N3NA 4QNPF 5DR5L 5IHUL 4OLWH 5CZXC 1L4IA 1DVFA 1MCOH 2XFXB 4EUPB 2FLRT 5FUOH 4JVWA 2WW8A 4UUJB 5IQ9B 4N0CC 3EGSB 4G7YL 3KPMB 1DVFD 1FV1B 2A6KB 4TOYL 1A22B 3F8UB 4HMDA 4Z7UB 1Q38A 5KZCD 5ICYB 1IC7H 1MCEA 1X6LA 3X11B 4PJHB 4HJJH 4K2UL 1KTRL 4OZFB 3VWJB 2P7TB 4LU5H 1RMFH 1ETZA 5EU5B 3HFMH 4G8EA 3AU1A 4G8IA 4MWFB 3O3UN 4XXCA 3BKJH 5A43C 1U8QA 5AUMA 1Z5LB 1JMZA 3WDIA 3GKZA 5DR5H 1A7RL 3QULA 1JNNH 3O6FC 3PIQA 4NZUL 3PGFH 5D7IB 3NN8B 4TTDC 2R8SL 3CX2A 2Q7NA 2A74B 1J8HA 4Y5YC 5F7KC 4G6JL 2CRIA 5DI8A 4JM2F 2HFEB 1BQHB 3WS3B 4KMTL 4KK8D 2P24A 2Z91B 3REVA 4GG8B 5KSAB 2WAHA 1J8HD 4K2UH 2GFBA 3N50A 2R0KH 4WW2B 4ZSOA 3UZEA 5FOBB 5BQ7B 4RRPG 1KPRB 3BP5B 4IJ3B 2WBJB 3KXFE 3WCYA 1V8HA 2YPLA 5F89A 5I16A 3MRQB 1IGJA 4CUCA 1KIRA 2QADC 3GSVA 4PP2A 4LKCA 2ESVE 4UIKL 4Y5XC 3O9WB 3QIBC 3X3FH 3MBEA 2YPLD 3PHSA 3S6CA 2CJUL 1IBGL 4WNQA 1NCDL 2MKLC 2ZPKL 2R8SH 2D9QB 2XWJA 4G6JH 2D7MA 3MBED 4KRPB 1W0VA 1UJ3B 1R6VA 4KMTH 3ZKXC 5JXEA 4OLYL 2K9UA 3OWEA 4MDJA 3NBNA 5D8JL 5H35A 3E1F1 2EC8A 5DO2D 4H0HB 5JXED 4QRTB 3ZKSD 2NZ9C 4ONOA 3K74B 4UI2A 5IEHA 3SKUD 4F58L 1CR9L 3O3BB 1DTUA 5LVEA 3C09B 4G43A 2AJ3B 3D25B 2VKXA 4FTVA 4UIKH 5KSBE 2P5WA 3TGXA 4GG6B 3C9NA 1MHHB 4ENEC 2NY1C 3SE4A 1IBGH 2ITDA 3TA3B 3IDXL 5FKAA 2ZPKH 2A1WL 4XP4H 4DAGL 1LDPL 2FH6A 3MLUL 1A3LH 4FTVD 5HY9A 1LNUB 1PKQA 1GGBH 2P5WD 4U31A 5F96L 2ZUYA 1RD6A 3G5ZA 4KXZI 4PPTA 4G5ZL 1LP9F 4XCYA 3RWGA 3NACH 1ZGLM 5AG8A 1P7KB 3NCCB 1TZHB 1L0YA 2FX7L 3S88L 5HHVL 4NP4H 1BJ1H 4OCSL 2DQIL 1VFAA 4JREB 2NY3C 2EE3A 4WU5B 1OM3H 4OCWL 3P0YL 3CH1B 1CR9H 1JGDA 2XWBB 3SKNB 4L3AA 4OGAC 3QQ3B 4WI6A 3RBSA 3CPLB 5FM5O 1SM3L 5T33L 4OQ1A 3PQYE 1LE9A 3IDXH 1SEBA 1BD2B 2A1WH 3OJDA 4HKBA 4MXQC 5DT1L 5IEKA 2Z92A 3SGJA 5JDJA 4EUPG 1BVLB 5JHLL 2FX9H 1I7TB 4PP1C 2OL3L 5F96H 5C08E 2CIIA 4Y16B 1A1OB 4A6YL 2P47B 4JB9L 9CGTA 4X99A 1HNFA 4JHZA 4L4VA 5IHZA 4X7TB 3EO0A 4YHLL 3BYYA 1QPXA 2ZP0T 3FL7A 3S88H 3TBSB 1QRNA 4EI5C 2AERT 4H0IA 5JMRA 4MMXC 1XGTA 4QRPE 4L4VD 3VFTA 4OCWH 4F7MB 4M8VA 2ZCKL 3WO4C 5E56A 3ZYOA 4CMMA 3SBWC 1QSEB 3CX5J 5E2VH 1QRND 1S78D 1FVDB 3AAZB 1XGRB 1NGXA 4I13B 5T33H 4ISVB 3SGDH 1A02N 4NQSB 4MA7H 3QNYB 1Q9LA 1JMXA 5T3ZE 1LD9A 4RNRB 3DV6A 5DT1H 5SWSA 1CGXA 3O41A 5JHLH 4PJ9A 5I66A 2OL3H 3RAJL 3R8BB 1PLGH 4S0SD 4K3JL 4JRYB 4A6YH 2I25N 3FJTA 1BQLL 5EO9B 2PR4L 2HWZL 5EU6B 1BQHG 2GITB 5SWSD 1IQWL 4YHLH 4PJ9D 1R3JA 4ZO7A 2FH8A 4O5LL 4W6XB 1CZ8L 3MV7A 2VQ1A 3P4LA 4LASL 3BZFA 4HIEA 1MCDA 3TPKA 3IRPX 1P69B 4B53A 2RQ8A 4EIGB 3SCMD 4JY5L 2PXYC 3IDNB 4JRXE 3MV7D 1AQKL 2YRPA 2CPCA 2GSGB 5IB2A 3BDYL 1S7TA 4YDIL 3QNZB 4HUVB 4NM4H 6FABL 3GM0A 2YKLH 2E9BA 3RAJH 5E2TL 4K3JH 3OKKA 2PR4H 2HWZH 1MPAL 1JWMB 2VRAA 3C8HA 4YC2C 5LGHL 4OZHA 2XA8H 2WWKO 5DRWB 1IQWH 3EHBC 1HHIB 4M6AA 8CGTA 3IU3A 2ZUTA 4O5LH 5GGTL 3WIFB 4NUGH 1JRHH 3N1FC 1T5XA 4S1SL 4YEFA 4G6ML 4IIQC 4LASH 4ZFOB 4TNVK 2VXSL 3MRDB 1FL3B 4JY5H 1NFIB 2BVPA 4GAGH 3WFEH 1CF8L 4XI5D 1AKJB 1I1CA 2DM2A 3BDYH 1X5GA 4YDIH 5DJZA 4PBVC 4POUB 2AXGB 1L0QA 3T0EB 1L9NA 3U46B 3TJEH 5E2TH 3HPLA 1YEFL 1E4XL 1DBBL 4KJPC 1MCPH 4H5SA 1KELH 1NGPL 5LGHH 2F54B 1BIIB 2OS7A 1MJ8L 1QQDB 3U4EA 5ICZB 4L29B 2VERN 5FO9A 1T1XB 5GGTH 5KVDH 3MRJB 1KPUA 4S1SH 1F2QA 2FJFB 2LQRA 2DQCH 5HHOB 5AWNL 3WE6A 1J8HE 1HDMA 3O4LD 2FHFA 5A3IC 2F8OA 4D8PA 4MQ7B 4LEOB 1F4HA 1TIUA 4MQTB 5FYJU 2DTML 5TDPB 3DECA 3K46A 3QXVA 5E7FA 3EIFA 1QOKA 3E6FB 5J1SC 4ZSOE 3P4NB 2DBLL 4PV9B 4UT9L 1C5BL 2CRMA 2GJZA 1BOGB 1IC1A 4HAGA 3L95B 4DN3H 4F7CB 3KPNA 3OB0K 3FO1A 2EYSA 4G80B 1G9MC 1DBBH 1A6VL 4UU9B 4P2RB 4F7TB 2AK4A 4EN3B 5EPMA 1MJ8H 1D7FA 4OBSA 5GHWL 1MH5B 3MOAL 5I1GL 1OTTD 1G9ML 1TENA 5DJ8A 1FGVH 1YYLL 4OCYH 2NLJB 1VADB 5GGRA 1OF2A 3L3HA 4S1DD 5DEFB 1QYGH 2AK4D 5FFLA 3VE0B 1HHGB 3RWDA 3DGGB 4TVPD 4Z7OE 3WXVH 4NKMB 2W0PA 5D1ZC 5BCAA 7FABL 3CFDA 3DRTA 3A67L 1UEYA 1TNNA 4PS4L 3V5HB 1Y18B 2BXYA 3AS1A 4X4XA 5CKGA 2Z4QB 3RHWK 5K59E 3GGWB 1LHZA 2C3WA 1MIML 3H9ZA 2DBLH 2OXGA 3N1QC 5HVHB 1CCZA 1PEZA 4ONHA 3OKOB 4PJ8A 4WI9A 4RBPK 4HX1B 3N9GL 4I2XA 1QHPA 4KVCL 5I1GH 2DMBA 1YYLH 4PJ8D 4FTVE 4LNVA 5ADPL 2L7JA 2P5WE 4DKAA 4GBXA 4YGVB 3M8OL 5D6CA 1VHPA 5FK9B 1P53A 2DQTL 4FXLA 1PKQE 4GBXD 4PS4H 5M95B 4ELMF 3MUZ1 2YPKB 5F21B 3NGBB 4K8RD 2O5YH 4KUCD 1VENA 3DROB 4X5LA 3U4AA 2IH3B 5C0JB 5KTEH 2ADJB 3BP7B 4N8CL 5TDNA 2PW1A 1VACB 1CGUA 3RKDD 4Z7WB 3SDAC 2MFNA 5HGHA 5DMKA 3N9GH 3TM6A 2J7LA 3D48R 2NY4C 4YPGB 1EXUB 1EEUA 2CKBH 1LO2L 5ADPH 5EUOA 3X14B 5CJQH 3IFLH 1J1XL 4RFOL 1YY9D 3QWRA 4QRRB 5CP3A 1U8MB 2X4NB 1E0OB 3G6AA 3NVQA 5I8EA 3JWNC 4I3GA 5GS0C 1J1PH 4M8QA 2HRLA 3OB0H 3BGAA 5ETUB 3ECBA 1TNMA 4L4VE 1MAML 3WJJC 1B4RA 1T3FB 4N8CH 5GS0L 2XV6B 3X13A 3BRFA 4Q6IB 3O3EB 1XF1A 1QRNE 1JWSB 3RU8L 4PIRF 1XGPB 1PSKH 4A2LA 5C1MB 4CN6A 1E6JH 2VLLB 3LMJL 1JN6A 3DGCR 3L1OL 4KZEL 2G60L 4RGOL 2UZXB 3L9RB 1S9YB 5I0ZA 1J1XH 4RFOH 3D0VA 1HKLH 4NHCL 2D7PA 2C4XA 2J1KA 2P5EA 2XI9A 4K94C 3CXHK 1RAMA 1CD9B 4ORGA 2EE6A 3DI3B 4PRDA 3KPRA 4YBLB 4W81A 2FJGB 2P5ED 2BNRB 5D5MA 2LAAA 3WV0A 4POZD 3UTQB 1MAMH 2OX5A 4RBPH 1B9ZA 3LIZH 4MVBC 4PLJC 5GRJL 4MD4A 5GS0H 3T65A 3KPRD 4PJ5B 4U1SA 2A77H 3RU8H 3MV7E 4XB7A 3IAPA 4BH8A 4WVRA 4K55A 5DVLA 2Q8AL 4OV6F 4ZYKA 1A8JH 1EZVX 3INUL 3QIWA 2R15A 1T03H 5FM5M 5GRYA 3L1OH 4GMTL 4UQ3B 3QI9A 3UTZB 2R1XA 4RGOH 4EDXA 2NTFA 4MS8C 1YQVH 1EJOL 1JGLL 3PJSA 5FGCB 3B6SA 3QIWD 3ZHKA 2ZSVB 1UB5B 3DIFA 4HWZB 2PETA 1MUJA 3QI9D 2Y6SD 4R3SA 4WO4A 3RWJB 5GGUB 2WIIA 2YWZA 2IPTL 3SDXF 5CGYD 2CXGA 5H8DA 4OZHE 4WO4D 5E9DA 3S5LA 5IT2H 5GRJH 4WUKL 1NBYB 1JI1A 1A4JA 3VFSA 1A3RL 4GAJL 2A9NL 4PRHB 1DANT 2WK2A 4HWNA 3QJHA 4JVUA 3D3VA 3JV0A 4KMLB 1EO7A 5E9DD 2Q8AH 5KG9A 5DRZA 3INUH 1I9JL 3W2DL 5BXFB 4L3CA 4XC1L 3I6GA 2FB4L 4GFTB 1CVSC 4ZPTB 3GMRB 2X9YA 3D3VD 5HD8D 2J12B 1EJOH 1JGLH 2SEBA 3BT2L 3ME0A 3T0DA 3NTCH 4N5UA 5BVPL 2DWEB 2I5YH 3MUJA 5AAMA 2KZWA 5C0IB 2IANB 4UDTA 1YPZB 3MXVL 5BO1H 2NW3B 5FDWB 3I6KA 4M6NL 4ZFFB 2DI8A 5D93B 1A7BA 2XKNB 2A0LD 5I1IL 4WUKH 2EDXA 3GSOB 3I85A 4PJIB 1IAIM 5EU4A 4KHXL 5I19L 4PJAE 1A3RH 2G75B 5I6XB 3BO8A 2JK5A 4XNMA 3L5IA 1I1FB 1OHQA 1I3GH 2QSCL 3D2UA 2E7BA 1Q9OA 1QEWA 4PTUA 4QCIA 5EBMA 3SGKA 3VGAB 3IB4A 3SDDB 3MJ8A 1I9JH 4H8WH 2OTPA 4KJWC 5FOJA 2FB4H 1EEQA 1KEGL 2MTPA 3E8UL 3D2UD 1Q8MA 1MCNA 3Q5OA 5JR1H 3HI5L 4ZFGL 2X1OA 5BVPH 1RIVH 4OLZH 3CGTA 1HXMA 3NZHH 5I2IA 3BPLC 2UYLB 4M6NH 3OZ9H 3TT1L 2ZNWA 2AK4E 2EDYA 4X7SH 5I1IH 2QR0B 4KHXH 5I19H 2VLKA 4TQEL 3T77A 4N5ED 1XGQA 5JOFA 4JFFA 1KNOA 4ZPVA 1CFBA 3GB7A 3FHQA 1SEQL 3KS0H 2QSCH 3VH8B 1A0QH 2NXYB 4NRZA 3QUYA 2EC9T 2VLKD 3OHXB 3VFUB 2HN7B 3DXAE 4NO0B 2JJWA 2DN7A 4IRJB 1I8LA 2NW2B 3AREC 4MB5A 2QQNL 4OLUL 5BV7B 4MNHA 2QV2A 1DQQB 2ENYA 2HTKC 3QUYD 1F6AB 3HI5H 4DFHA 4ZFGH 4YHIB 2YEZB 3GIVA 4M03A 4NQDA 2K7QA 2LFGA 3EDJA 1BJMA 2PYFA 4LSTL 2FBJL 5DRXB 5D7SL 1ACZA 2NY5C 3QHFL 1FH5L 2JLLA 3CJJA 5GGSB 4AIOA 1OP9A 5CHNA 3T1FB 5T1KA 4OV5A 2HG5B 2O26U 3G5XB 4NQDD 1GVIA 2NY5L 4LLQB 2O93L 3CC5B 4PJDB 1OWWA 1TQBC 5KAQF 4PGDA 4QXUL 1IZJA 1KIQA 1SEQH 5CD5C 4ZO8A 4JEGB 2G5BA 4KMQA 2XZCL 4W6WB 1QR1A 3S34L 5DC9B 2QQNH 1MWAL 3JWOL 2AJZA 4OLUH 1T2JA 2NY6B 3NCJL 4KAQL 5GGSY 1K4DA 1CBVL 1JJUA 4MJ6B