4MDIB

Immune receptor
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
189
structure length
189
Chain Sequence
DTRPRFLEQVKHECHFFNGTERVRFLDRYFYHQEEYVRFDSDVGEYRAVTELGRPDAEYWNSQKDILEDERAAVDTYCRHNYGVVESFTVQRRVYPEVTVYPAKTQPLQHHNLLVCSVNGFYPGSIEVRWFRNGQEEKTGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSLTSPLTVEWRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A molecular basis for the association of the HLA-DRB1 locus, citrullination, and rheumatoid arthritis.
pubmed doi rcsb
molecule keywords HLA class II histocompatibility antigen, DR alpha chain
molecule tags Immune system
source organism Homo sapiens
total genus 45
structure length 189
sequence length 189
ec nomenclature
pdb deposition date 2013-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00969 MHC_II_beta Class II histocompatibility antigen, beta domain
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4mdiB02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 4mdiB01
3IS1X 2PTUA 2B0SL 5DDHA 2RFXB 4NPYB 4QXGL 4KI5D 4M7ZB 4G9DA 2R1WA 5E9DA 4U0QB 2E8YA 1I8IB 2ITCB 3W5MA 3NOIA 4G42A 1ACZA 5C0ND 4Z8FL 1SVCP 3S5LA 1AD0A 3BSZL 5CILH 32C2B 4XPGL 1UWXK 4MJID 1QPPA 3WIHL 1DBJL 3N0PB 2ZSVB 1S5IH 3BKCL 4G6FB 1U9KA 2HLFC 2DRUA 2M8XA 4F57H 1FO0H 4MDIB 3RBSA 1G7IA 3KPRA 3MYZA 1FV1A 3FOLA 4OJFH 2JB6A 5E6IC 3GGWB 3QNXA 2EIZB 4AIXA 1CTOA 4RGOL 1S9XB 4YWGL 3OTTA 1PG7H 2YC1A 4K9EL 4O2FB 2NZ9D 3DHJA 3RWGB 4L1HA 2IPUG 3SDCD 4YAQA 2DD8H 5I1LA 4HUVA 1SQ2N 2XZCL 4TSCL 4FQIL 3QXAA 1A7NL 3QUZB 1DJSA 4HFUH 5BJTB 1WV7T 4JHWL 3LQAH 5EU6D 3SDAA 3BP5A 1A1OA 2JB5H 4GAFB 1UVQA 5IVXE 1I8LA 5DO2C 2J8UA 3ZYZA 3QJHA 3GSNL 4JRYB 5CCKH 4P2OD 2FEEI 4K3HA 4HIEB 5DEGA 1OSZB 5LGJA 4B5EA 3CFEB 2PXYD 3TZVC 2C7UB 3GRWH 1KB5B 4JFZH 2FJFA 5GGVY 4DGYH 1K8IA 1QOKA 4X6DB 1NAML 2F5AL 2DWEB 3U0PB 4OZFH 4ZSOA 3VRIA 3LV3B 1LWRA 5GSVA 4DVRH 2JIXB 3LRHA 4FTVB 3QUYD 2X4NB 4R4NC 4FRWA 1JPFA 2V6HA 1LEIB 5IB5A 1AXSB 2BRRH 2H1PL 5DJ6B 3PHQA 1IGMH 1NGPH 3O3BB 2E9IA 2JF1A 3RGVD 3VGGA 1D5BB 3EDDA 3EDEA 2CO7B 1G9EA 4Y5VA 5EC1A 1HQ4A 2ZUXA 3RIAF 1YC7A 3BKMH 4JB9H 1YDPB 3QEQD 1JWMB 2IPTL 3WLWC 2JCCA 4G8GA 4Y4HB 3ES6B 3LSOB 4Q9RL 5KANG 5CZXD 3TNNB 2HVJB 1BD2E 1T22B 2ATKB 2CKBB 3F7PC 4HLZH 3EHBC 1CFQA 4PGZA 4MS8C 4NYLA 3MLSL 4EOWH 4LHQB 1RAMA 1LDPH 5ADPH 5JTWA 3ARBA 2Y72A 1CDJA 3TBTB 1WLHA 3O9WA 1NL0L 1FG2A 3CLFH 4MNQE 2X4PA 1RHHB 4A6YH 1A7PH 3D39D 1UT9A 3H7BB 3EJYD 4FXKA 4OM0L 3RWCA 4PJXA 2VR4A 4U6XB 5D70H 3WKML 1MRDH 3T0ED 4ELKB 1JNNH 4R4FL 4PRBA 1U42A 4GUPA 1X5JA 2ENSA 5E6IB 3VFVA 1NCAH 3EAKA 2MPAL 1H15B 5IVXB 4XPTH 1ZT4A 3H7LA 1J1PH 1J8HA 4PLJD 2CIKB 3DIFB 2EDNA 5TDNB 4JGJA 1YEDA 3RBGA 5DUMH 3G6DL 5E2JA 2CR3A 4YZFF 4HH9B 4FP8H 2O61A 4R96A 2YD3A 2I27N 5I74C 3L3JB 1MIEH 3MRIA 5F3BB 1JTPA 2C1PA 1KN4L 4XCEA 2IH3A 1D9KB 3OZ9L 4N9OB 4KVCH 5E5MB 4TTDD 4OLUH 3BXNB 1JMZA 5BV7H 4QCIA 2X9XA 3UTZB 5EC2A 3TZVB 3BQUD 4YUEH 4NUGL 5CD5D 5JLZA 2DQJH 4NKIH 2J1KA 4JFDD 1A21A 3CX2A 4YDVA 5MP6H 2A74B 3BJLA 4CKVX 1KNOA 2CJUL 2W91A 4RFNC 3QSKB 3WFDH 1IBGH 1MJ7H 4G6AC 3FL7A 4HKXA 3BZFA 5ETUA 3D85A 4WI8A 3HB3C 1WICA 3FRPG 2EXWC 1WBYA 1HH9B 4L9LC 1TVBB 3VI3F 1QFUL 3U0WH 1OAZH 1CDYA 1HSAA 4R7NA 5HYFA 3L7FB 1KIPB 1XF1A 3AROA 3GSOB 3W9EA 3OKNB 4F7TB 2WNGA 3P4NB 2DJSA 2P48B 5I1EH 4J8RA 2B1AH 3VE0B 4ZS7H 4WWKB 4HC1L 2P8LB 4U0RC 1I3UA 3PGCA 4AL8L 2DOCA 5KANI 1WSST 4F80A 2R4RH 5DRNA 2VDOL 3I85A 1VGEH 1IGYA 1ORSB 2DIAA 4X6BB 5K93A 1CU4L 4F7CA 2BFVL 3S4SA 5IW6B 4I77L 4EBQH 3QFJA 4JFOB 3RKPA 3D3VB 1T5XA 4ELMF 4TUOA 1S7SA 5CIPH 4LLQA 2YRPA 2C3VB 2A73A 4GRWE 3VD3A 4JDVB 1CGVA 3OKYA 3ULUF 4PJDE 3SQOH 3R0MA 1BBJB 3ARFD 1P84K 4JPWH 3CFCH 1UYWL 4QRQA 3RUGB 5CBEB 3MLVH 3WIHA 1JJUA 2J88L 2X40A 3VXMD 1U8MB 3QDJA 1QBAA 3DUSA 5IP4A 5FDWB 3OMZA 2HTKD 1HYRC 5EBLA 3GI8H 5HVGB 5IB3B 5IVOA 3ZTJG 2PYFB 5E6ZA 2AQ3A 3C8HA 3ULVF 3LEVH 1H3XA 4XBGB 5I74B 3O6LL 1PYWB 4RISH 2C1OA 1NSNL 1RZKL 4Y4FD 4Z7UB 1CLYL 4XMPH 2PO6B 3C6LA 1XF2A 5FYLE 1FNSL 1HN1A 3T09A 4Q74A 5F9DC 2XTLA 4B7IA 4ODSH 1G7LA 5JQ6L 4F3FA 3BMWA 4YHIB 4EIZC 3LIZH 5GJSH 4GAGH 1FYTE 4UUJB 1FVEA 2Q76B 1FFRA 4FZ8L 4BFBD 3MACH 3IGAA 2RQ8A 3GBML 4RFNB 1AP2A 4LVHB 4M1DL 3GSNA 2FSEA 3IDGA 2DL2A 2XN9D 3NGBC 4WIQA 1IC1A 1OARL 4PLOB 5J1AA 1SMAA 4LAJH 1KENL 1XZ0B 4KTEL 5DFWH 4O2CB 1FNEA 4GLRI 5F44A 1MCHA 4QRTA 3SDXF 3TESA 1FAIL 4ONGH 5EO1B 12E8H 5CGYC 4L9LB 1DDHB 5D96C 5DA4A 5CP3A 4LSRL 3EJZC 4WCYH 4QRPE 1IEBB 2I60L 5FKAB 2GK2A 4I2XB 3BP4A 5E2TH 5DMIH 4C57C 4UV4H 4XC1L 3TN0B 4RRPG 5CJ5A 1A8JH 4BZYA 3QIWD 4PJ7A 4MGXA 3C8KB 2AGJL 2P43B 1C5CL 5DUPL 4KQ3H 3W9DA 2ZUSA 3Q3GA 4E0RA 4U0RB 3H9ZA 2AEIT 3RIAK 4UOW0 2FR4B 1KB9K 1RURH 4PJDB 4PJFA 3X3GH 1P4BH 1EA9C 4LLWA 2DMCA 2O5XL 4MA3A 4U2ZA 4ZUTA 5JW3L 1X9QA 1WWBX 2CDFA 3VXUB 2BSSA 2HJLB 3DYPA 1JPGB 4YC2C 3M17B 4TSBL 5CEZD 4GJTB 2FECI 1EHAA 1QRKA 5FYLL 3ZHKA 4RAUB 4Q58C 4JM2D 5BCAA 1VKXA 1TJHL 1FLTX 5D7LE 5JDSA 1AFVL 1WFTA 2V17L 3U6RA 1NGXB 5MENB 5F9AC 2PETA 3DGGA 4GAYB 3WE6A 4PIRF 3I6LD 5BO1L 3F8UB 4J6RL 4APQC 4YDLB 1PD6A 2FATH 3GMRB 4NFBA 5EH1A 3OKLA 1FYTB 1JZ3A 2AAVA 3DI3B 1Z6JT 2ZCLH 3VFTB 1RD6A 3QBTB 2JKXA 3TIDA 5GXBB 2FD6L 1FCCA 3VCLA 5IW1B 3SJVD 4Y16C 3VGEA 2R0LH 2FHFA 4PP2A 5FB8B 5A16A 3FQWA 3K8MA 3MOAL 3QT2A 4NP4H 1JHTB 1JBJA 1U8IB 1A7RL 4CW1A 1EZVY 3WUWB 3OKMB 2FWOB 3KWWA 1G7HA 2J8UF 4NFDA 4QRPB 4YHLH 1CLZH 3HE7D 3NGBB 3BAEL 5EORH 1G6RH 2P8MA 3HZYB 3ARWA 4KKLC 4XP1L 2HH0H 5JOPD 2DLIA 5JA9A 3JTTB 1HXYB 4ODVL 4OAWB 5AEAA 3U7YH 5IFHH 1SY6A 4CGTA 5LWYH 4KY1H 5D96B 5T5FL 4Y5YA 4ZFZB 2MQCA 3FQUA 4M7JH 2OL3L 4M6NL 5FYKE 4KK6C 5HYEA 2OJEA 4EDXA 2CIIB 1BQHG 2KPNA 3GZKA 3MREA 1ZHKA 4MNQA 1ZLWK 2JCCF 2LU4A 5GJTL 2VLJE 5L7XH 4K8RD 3X12B 5TFSH 4NJ9L 3ECBB 4O4YL 5HYJA 3AU1A 3S37X 2DQUH 4MXVE 1Q94A 1FNGB 1MI5E 1MJJB 2I9TB 2ZZUT 3NCBB 5B3JE 3O81A 3MBEC 2XA3A 1OAKL 2MSPA 2MWCA 3UYOD 4NQSB 4YC2B 1BQUA 5ERWB 1FSKC 1LP9F 1MCLA 5EOTB 4ZTPL 4HZAA 1FZOB 1YPZE 4UI2A 3V4VH 3CJJA 2BVUA 2F9BT 2XTJD 2R0KH 3OX8A 3JWOH 1T1WB 2H3NA 2B4CL 2BJML 5MHSD 5B38G 2EDKA 1R5IA 4XRCB 4LF3A 4JFQA 4PJXF 4XWOD 5EPMB 5HYQB 4TRPH 1FIGH 4Y4KC 5KVFH 1CXFA 3L3GB 4APQB 5I1AB 3GDBA 5E0QA 5F1OB 4P23D 2R4SL 3HTLX 3MV9D 3SDDD 4JVPA 2HN7A 3DVIA 3HC3L 2F53B 2NTSP 4L8SA 4IOFD 1T5WB 1N5AB 3G6JE 4Y16B 5GZOD 3OJDA 1NDGB 4M6AA 4XP4H 3SHSA 2FEEL 3VRJA 1OSPL 2X1XR 5EA0H 4OLWH 3OHXA 2F54B 4DZ8B 2EZ0C 1EFXB 1S9KC 4DQOL 3F7VB 3DI2B 4L3CA 4OGZA 1Q9OB 1BAFL 4PJ9A 4YHZL 5L6YL 3PHOA 3MRDA 3PP4L 5MEQB 1YY9C 3GNML 3Q5OA 1NKOA 4JZJB 2Y06H 4HUKB 3Q0HA 5FOBB 4DEPC 5SV4A 3WDIA 4NC0B 2VLJB 1MEXH 3KR3L 4GMSH 5D1XC 1C08A 4PJIE 3O11B 3OAZH 3NCCB 3OR6B 5A2KH 4O02L 3H3PL 4ERSH 1HDMB 2PF6A 2ZPKH 3VI4E 4H25A 2DQDH 2KH2B 4L29B 4DTGL 3QNZA 4FFZH 3BZEA 3AAZB 1GL4B 1EHLH 1QNZL 4WNQA 4XNXL 2D3VA 2J6EH 4KJPD 5F1NA 4QOKE 3V5DB 2XWBB 35C8L 2C3GA 4H20H 3I2CH 1B4JL 3LQZA 4L3EB 4KC3B 1PX3A 2XICA 4D0DA 3CU7A 4U1NB 4X8JB 3MBEB 1AGEA 1BZ9B 2M26A 4XNQB 4IHOA 5HVHC 1N0LA 3UC0L 1BFSA 4NIKB 5IJKA 3DECA 3EO0A 1NBVH 2YMXH 5F7WC 5C0IB 3TBVB 2XWTB 4F9LC 2X70B 4R90H 4TSAH 1GZQB 4JN2A 5H8DA 5IOPB 2H8PB 4LBEB 3X13A 3T0WA 2HT4C 3UTSA 4X5WB 1KCSH 5JPNA 3FFCB 5GRJH 1S9WB 5HYSA 3FB8A 4OF5A 3G6JB 3WD5H 5I9QC 3NN8A 1DVFA 3RDTD 5CSGA 5FA3B 4Y4KB 1T0MB 4HWZB 3MLZL 5I30H 3QHTC 5F9WB 3DO3A 1DQLH 1A14H 4E42B 1AKJD 1REIA 4BQ6A 3MV8B 1WEJH 2AV7A 2UY6A 3CGTA 4HUMB 3PNWB 1U58A 1EO8H 3D69B 5E8DH 4BZ1L 1LE9B 1FRGL 1MSPA 4DKFL 3IU4H 3GKZA 43C9A 4Q6IC 4YIQA 1IAOB 4AMKL 4P2QD 2PW1A 1KTLB 4YFDB 3TO2A 3P4MA 4YXHH 1CF8L 4W4OC 2YA1A 3V9FA 1EGJL 4X6CB 1WIPA 3L5XH 5DD3L 4KWUA 3KLHC 4KK5D 1R5VB 4D2NA 1J18A 1OAQH 2A2QT 4NQEA 1JF1A 4WFHD 1NLBL 3OPZH 2ED8A 5DJYB 1C16A 1LO3L 2PYEA 2Q1EA 3KPSE 1GIGH 4DEPB 1NEZG 4X7EC 5JW4R 5D7IA 3CZJA 3BKYL 5D1XB 4G8FA 1FAKT 3V79C 1M7IA 2KQMA 5D2LA 1N7ML 1OP5H 4QOKB 1UZ6E 3QG7L 5ICYA 3N85L 2JJSC 4X6EA 4JVUA 1AGFB 4EN3A 2XIDA 3U9UA 4FQHA 2VXTL 2EDJA 4OB5L 5I8EB 4DK3A 4LIQE 1QRNA 2XWJB 1RZIA 5ICZB 2P5EE 1IGCH 2OL3A 3VG0L 1DN0A 2LFGA 4Z0XA 1J11A 5HJ3B 4KJYA 1M6OA 1YJDL 1DZBA 1YN7B 3HPLB 2VXVH 3VFOB 1IAMA 4PJ7F 5FO7B 2YBRB 1N5YL 3I84A 4HXBL 1E28A 4U1LA 1EV2E 3F7QA 5D7LA 4HG4J 3WXWL 1T7WA 3SE9L 4IMLB 1CVSC 2VH5H 5GZNC 4LSVH 1T83A 4I48A 3CLEL 4ZFGH 4PJFF 1N2RA 4NQUA 2BX5A 4EUPG 4TNVF 2X89D 3U7WL 2DI7A 4IMKA 3AS0A 3GSXA 4V2BA 5DRWA 1T0NB 4LRIA 3F7RA 2NPLX 4MNHB 5I9QB 1F4YL 3UJJH 1I1AD 4NQVB 1RFDH 1MWAB 2H32H 1B2WH 4KJQD 4XWGL 4PLNC 3K1DA 4NO3B 4ZO9A 2YSSB 3JV4B 3MBXL 2DJUA 2EDWA 3SGEH 2AI0H 1WBZB 3CD4A 1ZKAA 2Y5TA 1HK6A 1VADA 3R4DA 4OCMC 4PYHA 3WFBH 3FQTB 4WFFE 1IM3B 3BGFC 5E94B 4Q6IB 4ZD3H 2PTTA 4PRDA 4F2MB 1KFAH 2R0ZL 3KPSB 3Q6FA 5ISZA 2Y5EA 3L5HA 4K7FB 4LCIH 4H88H 4ZFOB 1OLZA 1UENA 3FO1B 5I8KL 2XPGB 3LKPB 4DKDC 4U1KB 2EDYA 1EH9A 3MRRB 4MQ7A 3SE8L 4TPRL 1B0RB 1MHEA 4FQPA 2MKLC 5DDHB 3TJHC 1OTTC 3TIEB 5HHPA 2IF7A 1I8MB 1XCTA 5T33H 4HCRH 2AW2A 4S1RH 1RUML 3HMXA 3ARZA 5TE4L 2P5EB 3MZGB 3UAJD 4ONHB 2AK4E 1KTKE 2DQGL 1KTRL 1TENA 2GK0B 3O6KL 5BW7C 2IALA 4I8DA 1QBML 1CGSL 1MI5A 2WIIB 1N4XL 3BRDA 3PWPE 1HYSC 3D0VB 3ZKNC 3DXAD 2QR0A 2APTA 3CDYA 1A6VH 1S7WB 2VJXA 1A4KA 1VENA 5EZJB 2D0GA 2VDLH 3S36X 1K6QH 1FBIH 4WI9A 2NYYD 2Q86A 5K9JH 4X9IA 1AY1L 1QA9A 1HHJB 3IFOA 1F58L 1EMTH 1PFCA 1Y0LA 2NXZD 2PCPA 2BVQA 3L3KB 2P7TA 2UVFA 4JQVC 1A1OB 3O4LE 4F9PC 3D18B 1BFVL 1I9JH 1VEMA 2G75A 4Z7WA 1XR8A 1R5WA 2ESVE 2ZOLA 1IE5A 1ZS8A 4LPXA 4ZXBA 4KDTC 5E5UB 1T89C 2QSVA 2MJWA 4LOUC 1NKRA 2J8OA 4MAUL 3CDGA 1OD7A 4G8EA 3P77A 5FF6B 3O3AA 5DS8A 3PWVB 5IJVA 4YGVB 5DD6A 3VRIB 5DD1L 3CIQA 4DVBB 3MA7B 1P7QB 4MMZC 1HH6A 5C7XH 3OBAA 5DK2A 4XPHH 1NGWA 3MRNA 1JPFB 4JQIL 3S37H 4CU8A 3TYGH 1QTYT 1INEH 4JY6B 2JK5A 3INUH 1F11A 3TPUA 3VXNA 4Y1AD 5J13B 4K71C 1HEZA 5A2IH 4JFXB 1UWGL 4MA8L 4BELD 3BGFB 5DA0B 5IBLC 5F96L 3V52L 4AIZB 1NLDL 3EGSB 4B0MM 3UTTE 4DGVL 2CLZB 4C83A 1H8NA 2D03H 5F1IA 3B8YA 4LPWA 1TITA 3BRFA 3BIKA 2CLVA 3V8OA 2AK4B 3B9AA 5T3ZH 3RJDA 3O6FA 4NQCD 4GBXB 1EBPA 3KXFE 4KXZH 1MNUL 3BH8A 4HJGA 3WNOA 3SCMC 3D87B 4YDIL 4HIHA 4RMSA 3PWPB 4WHTA 1TZHA 1ED3A 1EGJA 5KAQF 3O9WB 2EKJA 1MUJB 4TVPD 1M05B 5IWLA 5F7NC 3CUPB 3TBWB 3X17A 1B9ZA 4K7PY 4YBHA 1QFWH 5HD8C 4MVBC 1YEKH 3L6FB 4MWFA 1OTUC 5DQJA 4F57L 3BHBA 1QLEH 4J3VA 3RX8A 4WI4A 4LLUB 3HE6C 2YOCA 4JRXE 2FEDC 1ETZA 4EQ2A 2P44B 3N1QC 1A1NA 2YUWA 3O4LB 4HJJH 4EQ3A 2EKSA 2NY1C 1PG7L 6FABL 4WTXA 3SKNA 4Y2DA 3CFKB 3F65A 5EOQL 3QG6A 2UWEA 5CZVL 4LCWD 4Z7VB 3MYJB 1MJ8H 4R96B 3ILQC 2CR6A 2G9HA 1EEZB 4GRWF 4ZUUB 1HHIB 3LQAL 2JB5L 5DT1H 1ZE3C 5FK9B 4OI7A 1PX4A 5CCKL 4I5BA 4QCIB 1XCQB 5EZOL 2OZ4A 4JFED 2BVTA 3G04A 3GRWL 4NN7C 3QWRD 3PV6A 1CDHA 4DGYL 4NQXA 4N0YH 4X0KA 5JLZB 1SVZA 4YDJB 4MCZB 4CVZA 3DMMC 3W11C 1NMCC 2WINB 1Z9SA 2NY2C 3QEUA 4DVRL 4HDIB 1WAAE 4U7KA 5E2WH 1OCWH 2BRRL 5ETUB 2K1MA 1AJ7H 3HI5H 3FB7B 5INCB 5IEKA 1AIFB 4TNVK 1AGBA 1BIHA 1O5DT 4KTDL 3LH2L 1W8OA 2V9TA 3V95A 4ISVB 4WI6A 3EUUA 2ZUTA 5I15H 5JMRA 2V7NB 4K71B 1GHFH 3S6CA 1MRCH 3P9MB 5SWZA 3F7YB 3KXFB 3GSRB 4KROC 5C08E 3HI1A 4P5TD 4X7CC 4XHQA 5I1IL 3H8NA 3TVMC 1RK0B 3QZWA 4XCNA 1KJ2B 5DD0H 3F5WB 4CAGA 1PG7W 2VQ1B 3U4BH 1CE6A 3W0WE 2DBLL 2Z8RA 5FA4B 3HG1E 2IH1A 4NKMB 4FXGA 1JP5A 1ZTXL 5FGRA 3PGCB 3SCMB 3BYTA 3P4OA 4ODXB 2ZUYA 4EI5C 1LDPL 1CD9B 1A2YB 2FGWH 4OIBA 1IGYB 3IFLL 5FUOH 4NZUH 5D6DA 4H5SA 3S4SB 5C0AA 3CLFL 2D7NA 3QHZL 1NGZA 2Z91B 4GT7A 4OIAA 4A6YL 5IIEB 5CEZH 1A7PL 3LQMA 2WIMA 3LKQB 2WUCH 2CRMA 3V5KB 3TNMB 1JHKL 1YEHH 5HHQA 2OTWA 4O58H 4LCYB 4NCC1 2EXYC 4LRNH 4G6FD 1E0OB 1MRDL 5D2LF 5ESQB 4F7MA 2Q3AA 5EUOA 1JNNL 5CJQH 1RJLB 1NMAL 2LTQC 3RKDD 1ZXQA 2ZSWB 5DQDH 3VFPB 1K4CA 1UCTA 2VDQH 1FFNB 4M7LT 5KW9H 3CNKA 4I1NB 3X14A 4FP8L 4D0CA 3B83A 3EOTL 3DVNB 3QI9A 4G6KL 3SY0A 4IS6A 5E8EA 1Q9WA 1V7MH 3RVXD 4Y7MA 2A83A 2FYYB 1DL7H 2Z93A 3QUZD 5HHNA 1BQHB 3QA3B 1H3UA 1CICA 5I1JH 4J1UB 5BV7L 1PGRB 3ARVA 3N1MC 5D6CB 4WDIB 1T04B 4JRYD 4NN7B 1RVFH 3U0TA 2Z8VC 4QRSA 4S1SH 2EEDA 2BHUA 4PYGA 1MLBA 4ZOEA 2DQJL 1NMCB 4NKIL 2DQHH 2NY2B 4DAGH 2X4UA 4N0CD 4X4XA 5DVOA 4WU7B 1AP2B 5I16B 1M4KA 4L4TE 3WFDL 1MJ7L 2JIXD 4FTVD 3KPPA 2ZP0T 2AJVL 4K23H 3U48A 5CP7B 2DKSA 3N1FC 3UBXI 3VRLE 2B2XH 3W0WB 1TNNA 4HGKC 5DR5L 1IC7H 3MJ9L 2ID5A 2YD5A 4BH7A 1MOEA 4HT1H 3U82B 3U0WL 5C0CA 3CX5J 4JEGB 1Y18B 4KROB 4DN3L 2HFFA 3RL1B 1XR9B 3TVMB 2P5WA 3ABZA 4Y4HD 1HCFX 5B38B 3V6OC 2JJTA 4F8TA 3MXWL 1K5NA 1X4ZA 4GXVH 4IOIB 4KFZC 4K8RH 1LEKB 3SGDH 5I1EL 2B1AL 1BECA 4ZS7L 5J6HA 3NCEB 3C2SA 2GFBA 3MRJA 4RQQB 3C9NB 5GRYA 2XY2A 3IJSA 4J12A 4OLZH 3WFEH 2R4RL 5E6YA 4W6XB 5C2BL 1VGEL 1S7TB 1F42A 2ZOKB 4ODTH 2BSRB 3LS4H 3HZKB 4U1MA 3DRQB 3AY4C 4ZUTB 5IESH 3LN5B 1XGPB 4OF0A 2ICEB 2DF3A 3P11H 3MV11 2NNAB 4YR6A 1K8DB 3D9AL 3EW3B 3AS3A 3FONA 2OR8A 1N26A 1UACL 1XGRB 2HT3C 1RJCA 4JPWL 3SGJA 3UYRL 4FQXA 3C2AH 4WEBH 5JDSB 5L2KA 1HKFA 2CDGB 3MLVL 4I3SH 4MXVF 2Q7YB 1FIEA 3MUY1 2OXHA 4IRJA 1CCZA 3LHPH 4WV1A 5E6ID 4GRMA 1FO0A 1WZ1H 2D7TL 1QSFA 1X44A 3WDHA 3GI8L 3BD5A 2ESVA 1I7ZB 3CCHA 2DM2A 3FO9A 4P5KA 5DYOA 1PKQE 3LEVL 1YEIL 5LVEA 3OKLB 4AH2B 3SGEI 2BNRE 2CUIA 4RISL 4HG4K 4PJBA 4MA7H 1GC1C 1DBBH 1MHHA 1TFHA 4XMPL 1PY4A 1YPZF 1A6ZB 3RL2B 2IANB 1D9KD 2KZWA 4WENB 1TQBB 4QTHA 2NY3C 3TA3C 3TZVD 5DVLA 1W72B 3ZDXE 4GAGL 4CW1B 4S11A 3KWWB 4Z7WF 1FCGA 2W65A 3MLRH 3VGFA 4N0UE 3S36H 3HLAB 1INDH 3T1FB 4R4ND 4NWUH 3UTTA 3O41A 1WCBA 1P2CA 3GRWA 5BZDA 3MO1B 2H6PB 2L4OA 1JIBA 4WW2C 1JGDA 1HHGA 5HI4C 4ONGL 5JIPA 5EO0B 5GIRB 3RPIB 4BH8B 2FJHA 2MHAA 5HDQH 1DBML 4Z78A 3ZE2E 3F6IA 4M1GH 2WWKO 3CVIH 4NOBA 3HPJB 4QRRE 5E2TL 4GKOA 3PJSA 4UV4L 4PRAA 5SWSB 2QSCH 4RGNC 1SM3L 1CD0A 5EO9A 1KIRA 5T1DH 1R3IL 2HWZL 2YWYA 4H8WH 5TDOB 3T0VA 3TWCL 1FC1A 2APBA 3MREB 3PP3K 1X5GA 4X9HA 3EHBD 1LO2L 4WWKD 5LGKA 2NR6C 1IEAA 4MJ2A 1CGUA 3HC4H 4MS8D 3RA7H 3VW3H 1NGQL 1U92B 2J4WH 1RURL 4GSDL 4UQ3B 1P4BL 1RMFH 3QDGE 3OB0H 4RGNE 4JRXA 4PJIF 3GK8H 3HN3A 3DX8A 1ORQA 1KJVA 4UQ2B 3K4AA 5C07E 4N8PA 2VLRE 3D3VD 4AIOA 4KJWC 1HQRB 5JUEH 3TJEH 5CMAB 4FXLA 4LKXA 5DRZA 4XMKL 3VI4F 1D3CA 5J1TC 4NZDA 5F7FA 1OP9A 4E5XB 2COQA 4WFGE 3PV7A 1IT9H 5BXFB 1RJZA 2XZQL 1E4XH 3N50A 1PKQB 3WS3A 1ADQL 1NC4B 1U3HC 3HE6A 1FE8H 2BNRB 1L0YA 1ZLWH 5HI5C 1JFQH 4A6YA 1BF2A 4F58L 5HPMA 1DBAH 4GW1B 1J12A 3HI6H 1A0QH 3MRPA 1GC1L 3X11A 1NEZB 1YEFH 5J06A 43CAA 3DROA 1M71A 5HGGS 2F74B 5GRVL 2FL5B 3JV0A 1KBGL 4PRHB 3G5ZA 2F8OA 2ZCLL 4NRZB 3SKMA 3IVKA 4N0UB 1MHCB 1WAAA 2UWEF 2PO6D 2FO4A 2R0LL 5KN5A 3OF6D 2XZZA 4YX2H 4OCRL 3SEPA 3EYFB 2EC9T 2NY3B 4HGWA 3VRJB 3BGMA 4HS6B 3TA3B 4X4ZA 4NP4L 5IV2B 5L2JB 3TGXA 5HTSA 5C09E 3RWFB 1GRWA 4NBYB 3DMMA 3P0VH 3QIBC 4CADA 5HI3C 4M8QB 1G6RL 3AXLA 1P69B 4KDWA 5C08A 4Y5XC 4YBQC 1R3HA 4G6AD 3VFGH 4TUKH 3MPCA 1JPSH 2J7LA 2V5MA 5GRUH 3HB3D 2YPKA 1KXQE 3O3UN 3U7YL 1VFAA 3KLAB 2QTEA 2EXWD 1IQWH 1S5HA 4EUPB 4BSVB 3HG1A 5J6GA 5TE6H 1J0IA 3C5SA 3R06A 1QFWI 4LP4A 2DQIL 2ERJB 3GMLA 1FQ9C 2AXHA 2EDDA 1YNTA 3QDGB 4RGNB 4X80H 2YD4A 3T0AA 4ETYA 2AJXH 3MJ9A 3TN0D 5AD0B 3QNZB 3BESR 3I6GA 4G9FE 4OF6A 2QQNH 5TFSL 1Z0NA 2OYPA 4GO6B 1F90H 1AHWC 1OQXA 3EYOA 5HYIA 3LS5H 5DEFA 5F93C 3K80A 3CPLA 5BVJA 4YBLB 1OWRM 1YYLH 3EOAB 1UZ6F 4PD4K 2G60H 2X4TB 4OZGB 1T1YB 3RVTC 4QXUH 3VXUD 3K2UL 2C5DC 4HHAB 2SEBA 1U3HB 4WO4C 5CIPA 2R0KL 4Y19B 3JWOL 3QQ9D 3QWOA 3WN5A 2HKFL 3UTSB 4XXDA 4OCNC 2VZ3A 5BOPA 3I50L 2VLKE 1CL7I 4P3DB 3FB8B 5MEND 4JQXC 4TOYH 2JTDA 1Q0XH 3CSYA 3ZZ1A 2DQFA 5KS9A 2YPVH 2IMMA 5D7SH 1L7TL 2GJJA 2EECA 3NPSC 1ONQA 1MY7A 5C09B 2A6KB 4PG2C 1FYTD 3NFPB 2I5YL 4XH2A 3GMMB 4L4VE 1KOAA 2HMIC 4AQOA 5D7JC 3T65B 4XP4L 4L4TA 1HILA 2AK1L 3K46A 4YIQB 5F7EH 5F9JB 1FL3B 2PW1B 5E8OA 1T4KB 5F97E 1JZ5A 4OLWL 3GJFB 5IG7B 2BNQA 2VDMH 4UNTA 3B9DA 3QIBB 3KPLB 5FV1L 3EYSH 2Z92A 4QRPD 2MOVA 5HI4D 3IU3B 4MB3A 4BUGA 2VITA 1J05A 2ARJA 5ITBH 1C16B 2D4DA 2PYEB 4YPJA 1S8DA 4KI5C 3R0NA 4JR9L 4GMSL 1CD1A 1T21A 1M7IB 4OGAC 5HGHB 1RZGB 2E3VA 2WAHA 3EJJX 3DVGA 1T66C 2ZPKL 4QHLA 4S1QH 5A3IC 3TH4T 3OKOA 1I7RA 2NX5A 4Q0XL 1KLFA 4UAOC 3KDMA 4KI5E 2FDBP 1EHLL 5I1CH 1NFDE 5JORA 1E4JA 1DN0B 1U3ZA 4R0LC 3MMEB 5GS3A 1F6AB 1K4DB 3VH8A 4AK1A 1EEQA 1E27B 4NHUA 3NTCH 2GTZA 1CQKA 4LEOA 3I2CL 5IMMB 2QL1A 4DUXA 1ZHBB 5IHBA 3RZCA 1E28B 3MODH 5HGDA 2NZ9C 4NJAH 4OFVA 2NW2B 3G9AB 4MSWB 1QVOB 4YGAB 3MJ8A 4MA1B 4XXCA 3W81A 3BT2H 5GPRA 1NBVL 5BS0E 4LQFH 2YMXL 4OLXH 5C0DB 3ARDA 1C1EL 4TSAL 4Q2ZB 4XVTH 4WO4B 2VZVA 5I75C 1FPTH 1AR1C 3NABH 4P2OC 3CH1B 4L4VB 4HUWA 1JN6A 5GRJL 2IPUK 1U8NB 4L4JA 3WXVH 3WD5L 5HDBE 3VD4A 1G9NC 2ZKHH 2H9GA 1HKLH 5I30L 3D2UA 5EU6E 4APQD 3S88H 5HDOA 3KPMA 3NPSB 1DQLL 5DJXA 2AXFA 4DKAA 1WEJL 4D8PA 1V3LA 5E1AA 4JGUA 1EO8L 1YMMB 3B6SA 5FIEA 2MCG1 4I3RH 2F53D 3U4EB 3IKKA 3WJLA 1VHPA 3EOBB 2EYTB 1MFCH 4Y16D 1U36A 1W0WB 1MCPL 3PWJB 5ISZB 3VD5A 4PJBF 4YXHL 3NZ8A 1JF6A 4HPYH 3KHOA 4OGYL 3Q5TA 5GGSA 3L5XL 2GJZA 5H37G 5D2NC 2F54D 3N9GL 2DBJA 2VOTA 1EFXD 3DX7B 5DJZB 3ZHLA 4YHKH 5FYKD 5F1SA 5IB2A 1KIUA 4HIXH 4NKOA 1IGIL 4KKLD 2CMRH 2FLBT 1XCTB 2W9DH 4POUB 4WTZG 1FHGA 4JY5L 3T0XA 2BSTB 4A2LA 2F19H 2FH8A 5A40E 2ICWA 1NFDB 3TYFB 4XNMA 1JNHA 2HFTA 4L8BB 4PLKC 2VLJD 1G6RA 1OT2A 1EXUA 1FZKA 2IALB 1TQCC 1ZHLA 4N1EA 2X4RA 1HXMB 2Z31A 4Q9QH 1S3KH 3AS2A 4XNUH 5F7DA 9CGTA 3CC5A 3EJYC 5JR1H 1W0YT 1GPOL 2BY2A 3L3OB 3BP6A 1IGCL 4NZRH 5C07A 4R0LB 2VLRA 4YXLL 4XPBH 1VACB 3CFDA 1JZ2A 3K81A 5BS0B 3H0TA 3H9SB 1A22B 4NT6A 1BJMA 2VXVL 3MRBA 2Q86B 1P4LB 2YUXA 5DK0A 3ZLQC 1WQVT 4L3ED 1LEGB 2QQQA 1TXKA 4PLJC 3GSWA 3TO4B 3C08L 3CU1A 7CGTA 3JV6A 1I3VA 3MBED 3Q1SH 1FL5A 1Y0LB 4U6HA 1JGVH 2VIRB 3VWJA 4ENEC 1ZGLB 4N5UA 4ZFGL 1FVCA 4Z5RB 2ED7A 4TN9A 1MCOH 1WT5A 2G75B 4FABL 4K3GA 5KSAA 4PB9H 2PKDA 3BRGC 4CMHC 1A5FH 4M6OH 1SYVB 1UG9A 1CD8A 3FFCD 3UJJL 3WO4C 5FO8A 1D5XA 4JKPH 1WCQA 1B2WL 3E6HB 3GSUA 5IQ9A 1SMOA 1J0YA 5IMLA 2JK5B 1I7UB 2AI0L 1FH5H 1T0PB 2W60B 5FUCC 5E24E 2YA2A 3MV8D 5ID0A 4CVUA 4MDJB 5I76A 3T08A 1UXSA 3TT1L 3RVVC 1KFAL 5DC4B 5EIIB 4JFDE 1IGFH 4LCIL 4H88L 4R7DA 1UCBH 4M5ZH 1T03H 2GAZB 5D2NB 1WAAF 5GGVH 5FUCE 1KXVC 3BZ4A 2DIBA 3I6KB 4EKXA 3GIVB 3NAAL 4HJGB 4Y5XA 1U3JA 3JWDC 4NUJB 5T33L 1YY9D 4S1RL 4X4ME 3FRUB 1TZHB 2R1XA 2ATPA 4OF8A 3BW9B 4G9FA 4PGBA 4AEEA 1DFBL 5D1XD 3HRZB 2I25N 4HIJB 8FABA 4QOKD 4BK5A 3QDAA 1JZ7A 5IFJB 3NIDE 1TQCB 4ZOBA 4PGDB 3ALWA 5SWQA 3VJ6A 1VA9A 2UYLA 5A2LH 1OAYL 1DBJH 4NO2A 1BJ1H 1HI6A 1NUGA 1L7IL 3BKCH 1A6VL 1YEEH 4I0PA 1GGTA 3U30C 2NY5H 4NBXB 2VDLL 4LNVA 5C9JA 3ARFC 1MCEA 1FBIL 3MGTA 3MOBH 3HRPA 1EEYB 3O8XB 3KAAA 4MNGB 1HWGB 4ZUWA 1T20A 3QUKA 4NQTA 3SKNB 5K9JL 3UTQA 4QHNB 1JUFA 3DUUB 3RWHB 4KH2A 2WMPA 1CFSB 1U8PB 3VFNB 3ZE1E 4RGOH 2J6EA 5HXMA 1KG0A 2X7LB 4K9EH 3OV6A 1UWEL 4NO0A 1FYHB 4YJZL 2X4QB 1D6VH 1EAPA 3S96A 2AEQL 4LL9A 4TSCH 3RZWA 3FT2B 4FQIH 3QULB 1CDCA 4K94C 1BFTA 1MCSA 5GSRA 4AT6A 1EO7A 1UM6L 3RWEA 4CMHB 3NZHH 5D1QA 2HRPL 5TDPB 3L95B 2KUTA 4YQXH 4GW5A 2HJKA 4YXKH 3C09B 5B4MC 5F3HB 2HT4D 2DLFH 4FQJL 1VEPA 1YY8A 2CK0L 3B4NA 4P2CG 4IRSC 3WO4B 3O2VH 5C7XL 2V7HB 2KQNA 3CMGA 4XPHL 3QR2A 5EU3A 1NAMH 25C8H 4ZNEE 3S35H 5IEKB 3TYGL 1INEL 1C12B 3FT3A 1R3KB 3MRKA 2X4OB 4ETQB 4GG6B 2V2WA 2AXGA 1UJ3A 2YKLL 3ESVF 3A67L 1P6AB 1QFOA 1DQQA 5KS9F 5AWNH 2R2BA 3ARXA 4KHTH 4MD5A 3VWKC 1BVKB 2YEZA 1I9EA 2R1YA 5E7FA 3KPSD 3H2WA 2GT9A 1NH6A 3JWDL 2IPTH 1TJIH 1Q0YH 4Q9RH 4L1DA 1F3JB 1XF5B 3QUMB 4FXGB 1G84A 5K9QI 3GIZL 2FNBA 3VRLF 2DYPB 1RZFH 4UT7L 2DI8A 3MLSH 3UZVB 2BVPA 5E95B 2P5ED 4CU6A 1HNGA 5F88A 1HSBA 1IARB 3DV6A 5C0RL 4HJ0D 1J88A 1QFWL 5F7KC 3S8WA 1YEKL 5HHQB 1T3FA 5DMKB 5K59F 2D7QA 5C1MB 3UBXA 3BISA 4HD9A 4MJIA 1P9MC 1GYAA 3KYMB 1PZ5B 2K3TA 4Q6YA 1MCWM 3EKCA 4MHHG 4RMUA 1FORH 2VNCA 4HJJL 4P2YA 1K4CB 3I9GL 3EYQC 4R4FH 4EJ1C 4U33A 2DN7A 5IKCB 3B9KC 1J0KA 1U93A 4U7SA 3X14B 3QDHA 4RNRB 2AQ1A 5I8CB 2P47B 5TGBB 1B90A 3LN4B 3FQXA 3QNYA 4WW1B 3G6DH 1IVLA 2A1WH 2A83B 3SDCA 2OXGA 4XB8A 5GZND 5CSZA 5HHNB 5DHYB 4WJ5A 4P5MB 1DLHB 2QBWA 4PGCA 4XP9H 5L8JB 1J10A 5KSBB 2GSIA 5EU6A 1ZT7A 1KN4H 4N0YL 3OZ9H 1Z3GH 3I6LE 4F37K 4P2OA 4PJHE 4CNIA 4IRSB 2PXYA 1NANI 5E2WL 1ZA6A 3QRGL 1P7QD 2IEPA 3VMNA 4NHCL 1AJ7L 5DEZA 3HI5L 2X2YA 4JY4B 3P73A 1IZJA 2X44D 3G6AA 5IK3A 2F8VA 4PREA 4KKNA 3SJVE 3QUYA 5E7BA 5JOFA 5I15L 4PJ5E 1BZQK 2HP4A 3EYVB 1GHFL 2MQ3A 4AJ0A 1MRCL 1EHXA 2HFFB 3RGVA 3VWKB 2H32A 4HX1A 3B2UD 3ELAT 3ZDXF 1QFUH 5FO9A 1JWSA 5DD0L 3I02B 3QEQA 1NCTA 4NRXA 4RFOL 5JOPE 4UIMA 1JGUL 3U4BL 1XGUA 3WLBA 4WI7A 4JVWA 2AK4D 2GFBB 3IJSB 4FQQA 3STLA 2E27L 3E2HC 4GBXD 4AY0A 2IADB 3TBYB 1A4JA 1UKQA 2FGWL 4R4BA 2FIKB 4HK0A 4HC1H 1C5BH 3V0VA 4NZUL 1N8ZA 3KPOA 3PWPD 1IQDB 4AL8H 2QQKL 3O9WD 1DUYB 4U1MB 4BKLA 5E4IA 2VDOH 3BDYH 3FOMA 5GGUB 1LE5A 1AO7E 3W2DH 1ES0B 1AD9A 2VXSL 1G7MA 4O58L 1CQYA 3GM0A 4YNYB 5C6TH 2XXCB 4WW2F 3FONB 2HTLD 4D94A 4PJEE 5HBBA 5B8CC 3D39A 1HINL 1MAKA 5CJQL 1HYSD 3MGOA 4FQXB 3ZKND 5C0FA 1BEYL 3FN9A 3T0EA 4GRMB 5DQDL 4HUXA 1FO0B 3O4LD 2W0FB 1JYNA 5BMFH 1UYWH 4QF1B 2VDQL 3IDXL 1DBKL 5KW9L 5DTFB 3B9KB 3VFWB 3PWLA 3PGDA 3NFNB 4MHHI 3RWDB 2IC2A 3OXRA 3ZMRA 2OMNA 4Z76B 4XVUD 4OZIE 4AG4H 5EFIB 1DL7L 4P23C 5JW4M 2NW3B 2H26B 5ICXB 3QXVA 4ORGB 2BVOA 2HG5A 1LHZA 5MHSE 3TBSA 5DI8A 1RVFL 1CLYH 1U6AH 1FNSH 4PJ5B 3BO8A 3REWB 1YN6A 5JQ6H 3BQUA 2OP4H 3MV9E 3PWNB 1IKFH 4LK4A 4GKZA 4K23L 2CD0A 1XH3B 3CSGA 1A1MB 4FZ8H 4WFED 4MCYB 1GOFA 4ZUVB 3GBMH 2I07A 3DPBA 1RUKL 3P9LB 4OZFB 4XGZB 1ND0A 3OAYK 4HT1L 5ACZA 4KTEH 3QQ4B 5IHUL 1MH5B 5IR1A 3ZKQD 1FAIH 5IBLD 3KXFD 4MXQC 3CFJB 1NJ9A 4Y0GA 3PJSB 2GTWB 3G5VA 4LSRH 2W9LA 4GXVL 5EO9B 3TCLA 2QKIB 4AEFA 4K8RL 2I60H 5EU5B 1AO7B 5DFVD 4XC1H 4GRWH 2D0HA 5DQ9A 3E2HB 3WFEL 4JFFE 2DDQH 3LMJL 2AGJH 3SCMD 2VSDA 4PJEB 4HKBB 4M43H 1KN2H 1TTFA 3LS4L 4WI3A 1OQOA 4X5XA 5FHBH 4D3CH 1JPTH 5F8QC 4WHCA 5EIQA 3PDGA 3ARQA 5C0JA 5T3XE 1RZ8A 4PP1C 5HD8D 1OGTB 4MVBD 1OTUD 2OR7A 1NCWH 1G7PB 3LKSA 5B8CB 3PP3H 2FEDD 3C2AL 4TSBH 4TYUA 4OZIB 1KPUB 3DETC 3MLPA 3SOBL 3SDYH 3FZUC 4EI6A 2R2CA 4NC2B 4JFYA 5KVEH 4HZLA 3BMVA 3MRPB 1OF2B 3LRGA 3DROB 1QEWB 1N3NA 2XNAB 3VXMA 3ALXA 3BDBA 4F7PA 3L3HA 3FKUS 2AJSL 4HWBH 2ADGB 3QO0A 5I17B 3ILQD 2NY0C 1I3RB 4MA7L 3G5ZB 3O6MH 5HSFA 1DBBL 1E4WL 3FB6A 4J6RH 1RIVL 3C6SA 1V8HA 1ZSDB 2MQ0A 1BX2A 4OQTH 4M6MH 3L1OH 1Q9LA 8CGTA 2E7HA 4Y4FA 1T7ZA 5JW5B 3QIUC 5C0EA 4HFWA 4R3SA 1INQA 1JWUB 1J7VR 3CK0H 4AM0B 5GS0C 3MA9H 5DJ0B 3W11D 1EK3A 2NY2D 3MOAH 1F4WL 2G5BB 1OY3B 1ZAGA 1INDL 4NWUL 2I24N 4KK5C 2C4XA 3UPAA 3PDDA 3ISWA 3EO1A 4FZEH 1VFAB 4NRYA 2XN9A 3EIFA 3GMPB 4XP1H 3PL6A 3W0WD 4P2QE 5HDQL 1MREL 4ODVH 4JFFB 4M1GL 4IOSD 3CVIL 1U8HB 3E6FB 4KROD 5GS1C 1M1SA 3HS0B 5ALBH 5T5FH 1RY7B 1TZIB 3OAUL 5TH2A 3TVMD 4WTWA 2OL3H 5T1DL 4M6NH 1GZPA 4H8WL 1NGYA 5IQ7H 4QNPE 2PR4H 3PWUB 4WFHE 1BLNA 3I6GB 1P7KB 1IL1B 3SKOB 3VXSE 3WO3B 3HC4L 3QIWA 3VW3L 3L7EB 4HXAH 2AXJA 3WHE1 3TM6A 5GJTH 1RMFL 3LEXB 4PJCE 3Q48A 2DTMH 5DEFB 3CPLB 2UZIH 1R3JA 5B21A 5I1GL 4JJ5B 1ZHNB 4ZUSB 3IDUA 3KLSA 5JUEL 3TJEL 1I1FA 4RWHA 3BH9B 2L7JA 1DQML 4XC3H 5IW3A 3S98A 5L9DL 4RSVA 4NO5A 4WUKH 2RR3A 1IT9L 2DQTH 5DZNA 5GRVK 2Q8AL 2EXYD 3RNQB 3ZKSD 4KI5F 1NCCL 3OB8A 2E6JA 1TJGH 1JFQL 5J4MA 1KPRA 3VU2A 3ROOB 2YZ8A 4UDUA 2W07A 5DJDB 4JM2A 4KKBC 5JW4N 3BPLC 1YEFL 2LU7A 3RI5F 4U1SA 4PJAB 1DEEB 1XF3B 1J0HA 2BJMH 1ZGLM 1HCVA 3KLDA 4PPTA 2NY0B 1ONQB 3E1F1 5F7HA 3DX6B 3MC0A 1QQDB 4LGPB 1CIDA 5GS0L 3LKRB 1F97A 2R4SH 3DTXA 5GS2D 1O7VA 1QFPA 3HC3H 4P99A 5CAYB 4G43B 2IAND 3QIUB 3ULSA 1IGTA 4E9LA 4YHPA 3SJVA 3LCYA 5FYKH 3VFUA 1X3DA 5HDBF 4UILH 4CVXA 3P0VL 1WFUA 4H1LG 1OSPH 2R2EA 1I1RA 3CXDL 4PR5A 4G7VH 3VFGL 4PBVC 3RY4A 1QLFB 1QO3A 3PDOB 3HE7A 4DQOH 1FGVH 1DTUA 5EN2B 4YHZH 3VXSB 3EZ8A 2FIRT 5DJ2B 5GS1B 3TC9A 3UAJC 5JNYA 3DVGB 4PJCB 4QHLB 4X80L 1I7RB 5ESVA 2K7QA 1RPQA 4O02H 1WFNA 5SWSD 3H3PH 3JVGC 1JV5A 4GMTL 4M7KL 4ODUB 3JTSB 3QUXC 5JORB 2QQNL 3EFFA 4QT5A 5IB4A 3PUCA 3SBWA 4J4PA 4CJ1A 5KSUB 1U95B 4C59B 2JLLA 4DTGH 2GCYA 4LEOB 4GH7B 3FT4A 1KXTB 4K55A 3MTRA 1F90L 1PQZB 1QNZH 4P46A 1F3DH 3BP7A 1JK8A 1C5DA 3LS5L 4DWHA 2JE8A 3IFNH 5ENWA 4RAVA 4QXUL 4ZPVA 2QQLH 3GSVB 3DXAE 4PV9A 4RIRB 1IC4L 3ZDZE 3MRGA 1FFPB 2ZNWA 1QD0A 5MEOA 2HFEA 1NC4D 3DBXA 4HULB 3RY6C 2BNRD 3BEVA 4X99A 3NA4A 4AENA 4GG8B 2FRGP 5MERB 1ZGLP 1E4KC 3BPLB 1S7UB 2CDEA 2V9RA 2RCSH 4NDMB 1S7RA 2H9GB 3WJJA 4HUUB 1LK2B 1EJOH 2RAMA 4U1IA 5IHZB 5I2IB 4Y8DC 1UQSA 5EWIH 1S7XB 5E1AB 2Y7QB 4PRHD 3L5WA 4X4YA 1X5IA 1D5ZB 1ZANL 4MQTB 3MV9A 4NCC2 3SDDA 4URTB 5FECB 4LSQL 4QYOB 4I18A 5F7EL 3VGBA 5EUKB 3OAZK 1FRGH 3H3BC 2NY3D 1NEUA 1H8OA 3TA3D 1IAKA 1UH3A 4P4RA 4LAQH 5F6HJ 1UJTA 3EO9H 1OGAB 1RK1A 1CF8H 4KMLB 1QFHA 2VDPH 1EGJH 3QPXL 3OXSA 1VGKA 4JZOA 4XP6H 5DD3H 2QHRH 2NY4C 3MFFA 3MRMA 2Q3ZA 4QRUB 4NN6C 2ICWB 5CBAA 5CKAA 5GRXG 3QJFA 3SGKC 1LO3H 3LPFA 4WY7L 1G7JB 4HH8A 4K3DL 3BKYH 3VFMB 4S1QL 1XIWC 1V7NL 4HQQH 3QDGD 5LBSL 3THML 4RGND 3QG7H 3WEXA 4LDLB 4C56A 3DV4A 3WV0A 3QUXB 4P4KB 1KCVL 2BOCB 1I85A 4UBDC 3STZA 5C86A 4K2UL 2BP3A 3KHQA 2VXTH 1D6EB 2NR6D 4TVPE 3NTCL 4LU5L 2VL5A 4BA8A 4FOMA 1OW0A 1CZ8L 2HT2D 3VG0H 3DNKA 4X98A 2YUZA 4PY7A 1WBXA 1YUHA 3MODL 4C4KO 3A0OA 4PUBH 4BYHA 5J7CC 2ZUWA 4NZTH 3NIDF 4GKNB 5E00A 3BT2L 2F5BH 4HXBH 1U8KB 2IMNA 2ZUUA 2R8SH 4OLXL 2LABA 4UZGA 5KSAB 5TQ2H 2R2HA 5JZ7C 2VB5A 1U3HD 2CUMA 3WIFB 5HI5D 1FPTL 4Y19D 3NABL 2DTSA 1ZVSB 3NIGE 3OKDB 1JTOA 1KGCE 1ZLUH 3F6LA 3UTSD 2H2PC 4X9FA 3MRFB 1A7OH 3NCMA 4CMMB 3MJ7A 3RNKA 3WFHA 1HKLL 3ZE1F 3WNMA 1KLUB 5ECJE 1AC6A 5IROC 3DARA 2A6DB 1Q8MA 1F4YH 3GSUB 3RDTA 2WWKT 5CJXA 3HCVA 3MCLH 5DUBA 1CG9A 4NQDE 5C09D 1QR1B 5A2FA 3MRCB 4XWGH 4I3RL 2WUBH 2OSLA 4BQ9A 5CEXA 3MBXH 4XAKE 1AKJA 1MFCL 1UXSB 3CZFA 4Z7NE 5LAXA 3RI5K 3BFOA 1ZWIB 4LCUA 4N9GB 4BFIA 4P5TC 1FN4A 4HPYL 2FJGA 3CVHL 3D25A 2IPKA 2R0ZH 4P2QA 5FGBA 5SX5K 1WVZA 5EU4B 3QIBD 5HI3D 1PVHA 4JANA 2WQ8A 3KJ4C 4OZHE 4TVPL 2CMRL 4YBQD 4LIQH 3OKEB 1AGDB 2W9DL 2NY4B 3HR5A 3SE8H 1P4IL 2BC4A 1A6UL 4ELMA 1MFAL 2PYED 2HJFB 5IEHA 4GQPH 3ZKXC 4M7ZC 4XP5L 4PFEA 8FABB 4GLRH 5TE4H 4A2MA 1FGNL 3T77A 1MVUB 4Q9QL 1XIWB 1S3KL 4WEUD 1JCKA 2UYLB 3RTQB 4B7LA 4NNYA 1FFOA 3O6KH 3IJYB 1GSMA 5ID1A 4O51A 5JR1L 5EBMA 4NKDA 1QBMH 4XPBL 3UPCA 5CEYB 2ITDA 5I6XC 1W0VA 4O5LL 5H94A 5L8LB 1XF4A 1N4XH 1PKOA 3MGTB 4K3EL 1DP0A 2A6JB 3IXTA 5ANME 2A77L 1TCRB 3STBA 3RKDC 2E9JA 3RGHA 4NZJA 4OFKA 1I1YB 4KUCD 1AY1H 5C0GA 1A6TA 4LEXL 2OTUB 3RVTD 3DX9B 1SJHB 1MCOL 4IIQC 1U91B 3KYOB 1QSEE 4PB9L 4LFHD 2AABL 4F8QA 4P3CL 2VKXA 3O45B 1KCRH 4HS3B 1A5FL 1XT5A 4WO4D 1UZ8B 4JAMA 4MXWH 1BFVH 1NBQA 4NQDB 2VDRL 1RUPL 2X89A 4L4VD 4H0HB 4MAUH 4N0CC 1Q1JH 1X5KA 3L9RA 1F13A 2PW2B 3JZ7A 1I1AA 2FB4H 5CJBA 5B39A 4JM2F 3MRKB 1FH5L 5ADOH 4PJGA 3REVB 1S9YA 3HUJB 4UT6H 1N6VA 1AGCA 2L0DA 5TPWH 1YMMD 4OZHB 2HMID 1FZMA 1JGEA 2VAAA 1BBDL 4LCCA 1YA5A 1IGFL 4MB4A 3U36B 2R1YB 1UWGH 4JZNA 1JPST 2CGRH 1WC7A 1KEGH 5ISZD 2N7BA 4PJHF 4QY8B 1R3LB 5F96H 4M5ZL 4FTVE 1NLDH 4HEPG 4Y4HC 3VXRB 3BX7C 3ZTJH 3H42H 3O2DH 2DM4A 1FVDB 3KJ4B 3VXTB 1CDUA 3CMOL 2ADJB 1KYOJ 1RJYB 3IKCB 3V0WH 3SKJL 3FQRA 2B7DT 1MNUH 3ZKXB 4CUCA 5F6IC 4YDIH 2XKNB 5E8PA 3DV6B 4BFEA 5ANMB 1OB1B 3WMSA 4OGAD 1UGNA 3MNVA 1LQSR 1T66D 5JMOC 2HVKA 5A3ID 4W81A 1O7SA 4XCYB 5IVZB 1YEEL 4G6JH 3GFUA 5I6XB 2NY5L 5H2BA 2OI9B 5FYKU 5HVWA 4GRLC 1D5MA 5MEPB 2Z4QB 3MOBL 5BS0D 3DXAA 4PV8B 3H9SD 4DZBB 1QSEB 1A9EA 1U93B 1CS6A 2XOTA 1I9RL 1HIML 3QEGL 1JRHI 3B2VH 6FABH 3O3EB 4MX7A 3TO4D 2GQHA 1D6VL 3FQXB 4KV5E 5KJRH 1F5WA 5EOQH 3HAEG 4U7MA 2LVEA 4ZAKC 4PRPA 2VABA 3IETA 5CZVH 4L8DA 4F33A 4IIQB 2D9QB 2DB8A 4M8VA 3NZHL 1KB5L 4NWTL 1MFEL 2VWEC 2WW8A 1NFIB 2D7MA 4YO0B 4YQXL 4YXKL 3MXVH 1LMKA 4NSKA 1IGJB 4ZMAT 5HGBB 1D9KC 2DLFL 3ILPB 3L3DA 3F12B 1AR1D 4NKQB 1MFDL 3AREC 3T4YB 4WEMB 2BNUA 4YLQT 5EZOH 3O2VL 4QXTA 3VFRA 3VXQA 2X05A 1QLRB 4ZPTB 3BEWA 25C8L 4LLMB 3VXOB 3FO2A 1TVHB 3S35L 3SE4C 3NCJL 2VWEE 3IFPA 3OGCB 1S9VB 5JOFB 3X3FH 3V7MA 2XQBL 5F89B 3OKKA 5AWNL 4Z77B 4KHTL 1HOCA 4KTDH 3LH2H 4XPAH 2ADIB 3AM8C 1KJ2H 2ZG3A 3FMGL 3IXAA 4MJ5B 4Y1AA 2CKBL 2P24A 3JBG7 2VLLA 2BOBA 5FKPA 1TJIL 1Q0YL 3OR7B 4NNXA 3BKJL 4PG9B 1T1XA 4PRIE 4WU5A 5I1IH 5JDJA 3T0DA 3FQNB 4M1CC 2XXMB 5DSCB 2VR5A 3W39A 5IF0B 1PW3A 4R4BB 4WWKC 5DJAB 2DBLH 4AYFA 3DWTA 3RIFK 1RZFL 4NQCA 1N8ZB 3VDBA 1ZTXH 3CVHA 5KVDH 5K9OA 5F6IB 4OZ4A 3IFLH 4PLKD 1UEYA 1LP9A 3V6ZA 1JZ8A 5T1LB 2FHBA 2PN5A 3QHZH 3HNSL 3VFSA 2FBJL 1AXTH 4Z95H 3MRQB 3T4AA 3T2NH 3GJEB 1ZLSH 1JHKH 1FORL 3P4LA 5KBNC 5GISL 4LPTA 2EDBA 4GRLB 1OTSC 4JFPA 5LXGL 2DWDB 1E6JH 1BIIA 3IDNA 2X10A 3I75B 1VFBA 3D3VE 1NMAH 4U1JB 3O8XD 4HLJA 1Q72L 1QUNA 3KJ6L 4P2RA 3QQ3A 4DCQB 3VXPA 5L88H 2A1WL 4HKJB 4LARH 4P57A 4ZAKB 1HHHB 4ENED 4EZMA 4LCWA 3QH3B 1UFUA 3EOTH 4G6KH 5DHVB 4XP9L 1SJEA 5IMKB 2HG5B 2R15A 2KL6A 5C0BB 3G08A 3K4ZA 3RUGE 2OK0H 3TBSB 1A6PA 2IAMC 2EYSB 4OCSH 2PO6C 4YEFA 1ULVA 3BO8B 1Z3GL 1YN6B 4FN0A 3OSKA 5DJ8A 1L9NA 3S5LG 3AREB 3MLUL 2J5LB 4JFEA 3RPKA 3CFBB 1G0DA 3QWRA 4X7TB 5M94B 4OBSA 3U2SA 5J89A 4AQ1B 5LQBH 1U8JA 5EOCH 4Z7QF 1SYSB 4XTRC 1MY5A 5KSVA 4G5ZH 1SEBA 3ROLB 4MD0B 3UJIL 1A7BA 4XZUA 4GKSB 4FFVC 5I1DB 4PRIB 4Z7UE 3AMKA 4LVHC 2IG2L 3KNBB 2V2XB 1CIUA 2AJVH 3OQ3B 3O3DB 2E7BA 1G7QA 3GHBL 5IR1B 5HHOE 1R24A 5DR5H 1IJ9A 3MJ9H 1NJ9B 5IBUB 2YK1H 3RVVD 3BWAB 1WIOA 5MI0B 5JPMA 4Z18A 4DN3H 3QEHA 4P5TA 4HMDA 1NDMA 4F15C 3SPVA 3GBNH 3TN0C 2AJZA 1UEMA 3MXWH 3WIIH 2A9ML 2WWMD 3MCKB 1CE1H 1ZEAH 5TF1H 1C5BL 2VLMD 3QCTL 2DYPD 1KACB 3OAYH 2JJVA 1OM3L 4YPGB 5C2BH 4U4BA 3RWJB 3BDYL 2YPLB 2RFXA 4I2XE 4NPYA 3U4AA 3W2DL 4WUUE 2CRIA 2IFFH 1I8IA 2ITCA 2E7LA 2EE3A 1RZ8B 3WL9B 5C6TL 4YHYC 1RZ7L 4H1LB 3PG2A 32C2A 2X4SB 3WHXB 5JIHA 2ZSVA 1YNLL 3D9AH 2EIBA 1N6UA 1UACH 4MDIA 4OKDA 2Y07H 3QQ9C 5BMFL 3UYRH 1KJMB 1XMWA 1N3NB 5HHMB 4OKVA 5DVKA 3VXUE 2V2TB 1OP3K 3GGWA 2D7TH 2EIZA 3MUGB 5D5MB 1S9XA 4AG4L 4O2FA 3RWGA 4OLYL 2N56A 3IDIB 2AP2A 3C6SB 4YDLC 1YEIH 4DUVA 3IAGC 1KELH 5C8JB 2VN7A 3QUZA 2IAMB 1U8LB 2D9CA 3PXHA 3QAZC 1W72H 5MENE 3FFDB 1U6AL 4LLVB 1H5BC 2APFA 5B4MD 1WJ3A 5J9PB 4MJ4A 4OCYH 4JRYA 5D1ZC 5T5NG 5L8KB 1KEMH 5HHOB 4HIEA 4IRSD 2OP4L 4MZ3A 4Q7DA 2C7UA 4RFEB 1KB5A 1IKFL 4X6DA 4CBPA 4ONOA 2DWEA 3U0PA 2UVEA 2MFNA 1DQDH 2BVEA 3LV3A 2AKRB 3QDME 4NRYB 1M7XA 2JIXA 3PL6B 4FTVA 2X4NA 5FFLA 1LEIA 2W92A 1AXSA 5DJ6A 7FABH 3O3BA 1NAMA 5FYJE 3VWKD 5DD5H 1D5BA 4HV8B 3C5ZA 4ZQKB 1DBMH 5TH2B 4PJGF 1ACYL 1T1ZB 4BQCA 1YDPA 4WRLA 1JWMA 4F15B 1BLNB 1LGVA 4WUUB 3ES6A 3LSOA 4D0BB 3PQYE 2UUDK 3TNNA 1OVZA 2HVJA 1SM3H 5I1KL 1R3IH 2HWZH 5JHDE 1T22A 2DDQL 2ATKA 4KHXL 1I9IL 3TWCH 2DLGA 4LNRB 1X5FA 4K3JL 4M43L 1LO2H 3KYNB 1KN2L 5B3NA 5AZEL 2E6QA 1TCMA 5FHBL 1NGQH 1SEQH 2HLAB 3BPOC 4D3CL 1JPTL 4M61B 3TV3H 4GSDH 2QLVB 1I1FB 4MD4B 4LHJB 3TBTA 1XGQB 5I0DA 4YHYB 1NCWL 3IDMB 5LG1A 2EDXA 1RHHA 4KQ4L 4XMKH 4YHOL 3UTOA 1UC6A 4EXKA 2X5PA 4OFIA 3V6FB 5A2JH 2ICES 3H7BA 3SDYL 4FQXD 1HHKB 3L3IB 2XZQH 5KVEL 1ADQH 3MV7E 4O00A 4U6XA 5J8OA 2NXYC 1BVLB 3LKOB 3GO1L 4ELKA 3MROB 4F58H 3EYQD 5IBTH 3B9KD 5E6IA 4HWBL 1LK3H 1H15A 1GC1H 1LO5A 5IVXA 2PTVA 4OV5B 2D2OA 1XEDA 3S9DB 2CIKA 3O6ML 3DIFA 4XMLH 3G9VA 5TDNA 4WHYG 1J9CT 5HY9B 4HH9A 1KBGH 1UB5B 4OQTL 1MQ8A 4OTXL 4M6ML 2NLJB 3L1OL 3QAZB 4LKCB 3L3JA 3QDMB 1H5BB 3S4SG 5IFAL 4R97B 3K2MC 3M1BB 4JG0L 5F3BA 4UTBH 1XGTB 3CK0L 4PJ5D 3MA9L 4ZFFB 5D1ZB 4OCRH 4CVXB 2FX9L 5E5MA 3BXNA 2R2EB 3UTZA 4IDLA 3TZVA 1BJ1J 4XCFH 5ILTH 3ARGC 4FZEL 1DQTA 2F53E 4EUPH 2A74A 3DURB 3NA9H 3PQYB 4F7EB 4X9GA 1BD2A 5JHDB 1P7HL 4JZJC 5I66B 4DGIL 4DN4L 3OB0K 5ALBL 3WHE0 2DMBA 2EH7L 2F54E 5BQ7B 1HH9A 5CWSB 3BPNC 3IF1B 1TVBA 5IQ7L 2PR4L 1YMHB 5CD3B 2DQIH 5GGQL 3L7FA 1GGBL 1KIPA 3BPCB 1D7FA 2ARJQ 5FUZL 2R56H 4M5YH 3GSOA 4QT5B 1AO7D 3OKNA 4YHML 1MCBA 4F7TA 3P4NA 1BOGB 4HXAL 1A9BA 1H3VA 5SX4I 4P9MH 5IM7B 4U3HA 1MQKL 2DTML 4LGSB 3G5YB 2RJMA 1KYOK 2UZIL 2P8LA 3BPOB 1RSFA 4R2GC 4ZDHB 4JLRB 4RAVB 3MV7B 3LRSB 4XC3L 3HZVB 1I4FA 1H0DB 1ORSA 4X6BA 3V7AG 3H9HA 2R9HD 4WUKL 4U49A 5IW6A 4HC1A 4JFOA 3D3VA 2DQTL 4MAYC 1FLRH 4OUUB 3TFKC 1J5OL 3MRGB 4YZFE 1NCBL 3HA0A 4XI5C 2C3VA 1ZOXA 1TJGL 4S2SB 3K2UH 1MRFH 1UA6L 1J0ZA 3BEVB 4OD2B 2GI7A 1GVIA 3BVNB 4L3EE 4JDVA 3UPRB 3I3BA 2XI9A 2VE6A 3DHMA 4HAGA 2NXYB 1BBJA 2HKFH 3H6JA 1HZHH 3LAFA 4YK4C 4MJ6A 2GITA 1MFBH 1Z5LB 3I50H 4FQCH 5CBEA 1DE4B 4YHNB 5GGRB 1JRHL 4U1IB 5FDWA 4HIIB 3TLRA 3UTPE 5AZ2L 1L7TH 4KGJA 5IB3A 4TQEL 3HR6A 5F9WC 4PS4L 4RMTA 5F9OH 4N8VB 3C60C 4NBZB 4I18B 2I5YH 4XBGA 3WDJA 1KPVB 2FX7L 2FHCA 4U6YA 3FFCE 3NIGF 1CFNB 4Z7UA 2PO6A 4PJ8C 2W9EH 1U8QB 3SO3C 5FYKL 3G5XB 3VI3E 4UILL 3OF6A 2AK1H 4E41B 1U0QA 1RULL 4G80B 2IQAB 3PIQB 3ARGB 2WBJC 5AYQA 4G7VL 3FCTA 4YHIA 3V4UL 3MV8E 2Y6SD 4JO2L 4UUJA 1KLGB 3MFFB 1ITBB 2Q76A 4QO1A 1FGVL 3QP3A 4U1HB 4GOSA 4O2EB 2EDEA 2OS7A 1AXIB 1T7YA 1XZ0A 3D0LB 4JFFD 2P8PB 4QHUB 5L0QC 4O2CA 3LPGA 4JR9H 2UZYB 1M7DA 4MXQD 1U8OB 2WANA 3ULUC 5EO1A 3BPNB 4X6CE 1GGIL 4L9LA 4HWUA 1DDHA 1BZ7B 1NBYB 3BUYB 3EDKA 3EDJA 4C56B 4H0IA 4OCXH 4N8CL 1IEBA 4JN1L 4LSDA 4R9HA 5IB1B 3IJHA 1DQJB 5FDYA 5FKAA 2CRYA 4HPOL 4I2XA 3MRLB 4W6WB 1EFQA 1TPXC 3NH7L 1FC2D 3KPNB 2VR9A 4UDTB 1OAXH 4Q0XH 2VL5B 2VZTA 4N0FB 5D9SB 5FGSA 2APWA 5T3XD 5GGRY 1FL6B 3C8KA 4X98B 5DWUH 3ULUE 3ULVC 1S7VB 3GMQB 3KS0J 2WLZA 1QBLL 3PXJA 1MCIA 2AV1A 4R2GB 3IFNL 4JHBA 4PJDA 2QQLL 1IKNC 3HZMA 5IMOA 4MAYB 4LASH 4XAWL 4PP1D 4OF7A 2D31B 5E03A 5GGTL 1KULA 1KF9B 1J87A 2HJLA 3RX5A 3V5HB 5TJWK 1JPGA 3M17A 3MUZ1 2GUOA 3DETD 2CLRB 4S0TD 1C1EH 3FZUD 4RAUA 5K33A 2RCSL 3GUTA 4UV7H 4LQ1A 3DUHA 4YK4B 5K9KB 3MJ7B 3WFHB 1EJOL 2XYCA 3B3IA 1KCUH 4P9HC 2FZ3A 1NGXA 2P1YA 5C6PB 5MENA 3GSQA 3ZTNH 4OSUH 4JKKA 2AJ3B 3HCVB 4GAYA 2NY0D 5EWIL 1EAJA 2NY6C 2RHEA 1PAMA 1X7QB 2DLTA 3BOVA 4ODBD 3RWIB 2OSLB 4KGLA 3C60B 3GMRA 3CZFB 1FYTA 2CRZA 4HWBA 5BRZB 5INDA 2YUVA 3VFTA 1FN4B 3QIUD 2FJGB 5I0ZA 4I4WB 4PJ8B 3SO3B 4LPUA 1CT8B 5IW1A 5JXED 4LAQL 5GS0D 1JYVA 1MCPH 3EO9L 4OQTA 5FB8A 3E8UH 3GMNB 2IFGA 2VDPL 3MLTB 5A1AA 2WBJB 4OGYH 4XP6L 1U8IA 3DRTB 3HAEB 3N9GH 2QHRL 3BN3B 3HR5B 4OFDA 3WUWA 3OKMA 4ELMB 2FWOA 4V1DB 3U9PL 1FDLL 2VMFA 5SV3A 4QRPA 2RB8A 3V6BR 5IEHB 1MLCB 1IGIH 3HKFA 1D5IH 1L4IA 3HZYA 1EUUA 4JY5H 1DUZB 1H3TA 1TMCB 2WP3O 1J1XL 5D4QA 3VXSD 3JTTA 4X6DF 5L0QB 2WBKA 4OAWA 4JPIB 5T1MA 2HRLA 5FCSH 5EU7C 1Y6KR 4HQQL 4M02A 4ZFZA 4HJ0C 2DKMA 4NNYB 1FFOB 1PSKH 5FM8A 5SX5H 4ZYKB 2XG4A 2ITDB 1TPXB 5E9DE 4EVNB 3BYYA 2CIIA 3K74B 1GPOH 4YXLH 4LHUA 5EU7E 1CDGA 3QXDB 1OWWA 4RMWA 1OLLA 3P30L 2VZUA 4LDEB 3ECBA 4PUBL 4NZTL 1B0GA 2YD6A 3K7UA 5KAQG 1FNGA 2F5BL 4LDOB 2R8SL 1CBVL 3C08H 3KPRE 3BZDA 2EE2A 4LLDA 1GGYA 1N59B 3R8QA 5TQ2L 2AVGA 3GB7B 4NQSA 3SDAC 1JNLH 1I8LC 3PHSA 4FABH 2VQUA 5EOTA 5ESAB 5EZIH 4J23A 1G9NH 4ZO7A 1J1OL 1MWAL 2B20A 1A7OL 4HKZB 4KKBD 1F00I 3GHEH 2XZAH 5CGTA 4UU9B 4Y8AA 1F6FB 1T1WA 3SDXB 4J2XA 2BY0A 1FZJB 2DMKA 4JO1H 5EPMA 4Y89A 3MNWB 3MCLL 4ZOAA 2X41A 1WUNT 2NY6B 5HYQA 2E8ZA 3L3GA 4APQA 2WUBL 3DO7B 3FTGB 3QPQC 4QEGA 4N0RA 3J7HA 1PLGL 1UH2A 2HFGH 4ZFOL 2GJ6B 5IVXF 5J13C 4Y5VC 2F53A 4PRNB 4TUJB 3LKNB 3B2UC 2FX8L 3TT1H 1T5WA 2AEWA 1N5AA 4Y16A 2XFXB 1NDGA 5CHNB 1G0XA 1AQDB 4R26L 1BGXL 3VGHA 3QYCA 1OGAD 2WQRA 4PTUA 4LIQL 2F54A 4DZ8A 4GBXC 1EFXA 1A3RH 2BY3A 2BRQA 3F7VA 3FQRB 1Q9OA 3NAAH 1PBYA 4G9DB 2R1WB 5E9DB 1OPGL 1ZT1A 5DVNA 5MEQA 4I13B 5HYSG 2P45B 3O9WC 3RQ3A 2Q6WA 4G42B 1OAUH 1ODAA 4TULH 2Z8SA 3S5LB 1AD0B 1DFBH 2VLJA 3O11A 3OR6A 2M2DA 1MCKA 1HDMA 2HTLC 3QUXD 4P4KD 3FJTA 1OAYH 1G7IB 3KPRB 1FV1B 3FOLB 1L7IH 1BF8A 4L29A 4P0DA 2JB6B 3AAZA 4KI1A 2EDTA 1QACA 3QNXB 3U1SL 3V5DA 3UZQA 2YC1B 2XWBA 1F8TH 1F2QA 1YPZA 4J3SA 1A64A 4L3EA 4PJXE 4YAQB 4PRPB 5I1LB 4UB0H 4HUVB 4XVUC 3AGVA 4K7PL 3QXAB 1UWEH 3MBEA 1BZ9A 2XV6B 3T04D 4XNQA 5KSAD 2AEQH 1KCRL 2QSQA 3SDAB 3BP5B 3MLYL 1UVQB 4NSKB 4IDJL 4MXWL 1J8HE 4R8WH 2J8UB 2FECL 1QG3A 3QJHB 4M93C 1A6AA 1UM6H 3TBVA 2XWTA 4RA3A 5DEGB 5LGJB 2X70A 1XFPA 2HRPH 4HMCA 5IOPA 2H8PA 4Z7VE 3VXQB 2FJFB 4LBEA 1K8IB 1Q1JL 4GXUM 4IBLT 4FQJH 5AUMA 2W0KA 4ALAH 4ZSOB 1JI1A 1YYML 2CK0H 4X5WA 1S78C 5GSVB 3VMOA 3RHWF 2FB4L 1S9WA 3G6JA 5ADOL 3IAPA 3BD3A 5FA3A 4Y4KA 5IB5B 4KK8C 1I3GL 1MCDA 3PHQB 1FNAA 4UT6L 4HWZA 5TPWL 2EIEA 4UINH 4HF5H 1X5HA 3RUGF 3RX7A 4W70A 4E42A 2IGFL 2YKLH 3IXAB 3MV8A 4Y5VB 3A67H 1HQ4B 5EC1B 3SQBA 3PNWA 2CGRL 1KEGL 3D69A 2JCCB 1LE9A 4NNXB 4G8GB 3QUMH 1SJXA 5D72L 3SN6N 5I73C 3H42L 3O2DL 4MQSB 4WFEE 1IAOA 4WGVB 4NGHL 2K7PA 3JWDH 1KTLA 1CFVL 1T6VN 4LFHG 4Z7UF 5DFVC 4PJIA 1CFQB 2NY4D 4NYLB 3V0WL 1CLOH 1R5VA 3GIZH 2A38A 1JHLL 1GCFA 3ARBB 4J7RA 1LP9B 4PGEA 1VPOH 4UT7H 1FG2B 4PD4J 2YHGA 2X4PB 2VN4A 5D1XA 1GOHA 1YQ2A 2EH8H 1XIWD 5C0RH 4QOKA 3RTQD 5DJCA 2AERT 4FXKB 4G6JL 1QZ1A 3RWCB 4PJXB 2CH8A 4UBDD 3DYOA 1AGFA 4N1HB 1MFNA 3CSPA 4KKCD 2XWJA 4PRBB 4GUPB 5ICZA 3VFVB 3UCRA 1ZT4B 4KVNL 5HJ3A 1J8HB 3B2VL 4P2RB 1KC5L 1IAIM 1JYWA 3ZO0A 3I9GH 3HPLA 1YEDB 1KGCD 5KJRL 3VFOA 5JIIA 2YBRA 4K94H 2F15A 2O61B 1SJEB 4QTIH 1CGTA 3MRIB 2DQCL 4IMLA 2C1PB 3MXVL 3IRZA 3C6LC 4XCEB 5JZ7D 1IRAY 2IH3B 4PJDF 4M93B 2MCPL 5DFTA 4F9LA 4NQDD 2H2PD 5EC2B 3PGFH 1WGOA 4XAKD 1F4XL 2NCMA 5I19L 1SBSL 3GKWL 4DJMA 5D8JH 1CL7H 2QADC 4YDVB 2BERA 1T0NA 3P0YL 1KNOB 3QRGH 4MNHA 5AAMA 1V3KA 3X3FL 4NQVA 4HKXB 1WTLA 3BZFB 5CSBA 5C71A 4NHCH 2B5IC 1MWAA 3D85B 1ZMYA 1UM4H 1F3DJ 3AS1A 3NACL 4XPAL 1WBYB 4NO3A 1UM5H 2YSSA 3JV4A 1KJ2L 3ZT7A 1K9TA 1WBZA 4OGXL 1HSAB 2X09A 4R7NB 3JV5A 3V7AE 1IM3A 1AI1H 5I73B 5E94A 5FHAH 3W9EB 3QFDA 4Q6IA 3VXRD 4F2MA 3KPSA 2AJZB 4ZFOA 4K7FA 3K4DA 4C4KT 4W4OA 3FO1A 4J8RB 4RFOH 5AAWA 2XPGA 1JGUH 3LKPA 2O26U 4U1KA 3MRRA 3WS6C 3IT8D 3BWUC 2E27H 5KVDL 2EO1A 1BWWA 1H3PH 1B0RA 5DRNB 3QCVH 3TIEA 1JNJA 1BREA 1I8MA 4F7CB 3ZSSA 3QFJB 4EEEA 3MNZA 1T5XB 4UIKL 2QQKH 4TUOB 2P5EA 4PJ7E 1S7SB 4LLQB 4XCCH 3DSFL 1JZ6A 1AXTL 4ONHA 4Z95L 3T2NL 1ZLSL 1X6LA 2GK0A 2VXSH 2A73B 2FO1A 2JJSA 4JFHD 4U3CA 5EB9A 1ZA3A 5DMJB 4PY8I 1RZJC 4PJFE 2WIIA 2YN5A 1E6JL 1HINH 3J8F7 3FAXA 3D0VA 3CXHK 4QRQB 3B5TA 1QSED 1OT1A 1Q38A 1S7WA 1BEYH 4OKVB 3QDJB 3DUSB 5EZJA 4RWYH 5J3HD 3FRPA 1WZLA 5L88L 2QV2A 4FQLL 5EBLB 3IDXH 1DBKH 4LARL 1MIML 5JHLL 5KTEH 1HHJA 1CGWA 4MB5A 2C1OB 2OK0L 4GXUN 1CR9L 4OCLC 3ARUA 3L3KA 4OCSL 1XF2B 3C6LB 4IEFB 1Y6NR 3M07A 5ACMA 1MAMH 3D18A 5DGQA 1G7LB 2GEEA 1TQBC 4F3FB 3UROR 4ZS6D 1X5LA 5LQBL 2Y9RT 5EOCL 5CUSH 5HHVH 1FVEB 2X9WA 4G5ZL 2QADB 5FF6A 1OP3H 3PWVA 4YGVA 4HWNA 3IGAB 3GSNB 2FSEB 3IDGB 4DVBA 3MA7A 1P7QA 5J1AB 2B5IB 2C3HA 1YEJH 1X5XA 3A6BL 2IANE 2EE9A 4POZC 2F58H 5DMGD 1FNEB 4WGWB 1NAMB 4QRTB 4N90D 1RUKH 2E9BA 4JY6A 5IGXL 2YK1L 1LO0H 2EEAA 4Y5YC 3C5ZB 5IHUH 1WFOA 4JFXA 2C26A 4XX1G 3RHWK 2IBZX 3LDBC 3BP4B 2EC8A 4AIZA 3EGSA 3GBNL 2CLZA 2IJ0C 3WIIL 3MOQA 4PJ7B 1CE1L 1ZEAL 3MR9A 4N5EC 5TF1L 2AK4A 3W9DB 1P5UA 3Q3GB 4E0RB 3QO1A 5D7KE 2C9AA 4GBXA 1QP1A 3LMJH 3O2DA 4HK3J 4PJFB 2CXKA 3V6OE 5SWSE 2IFFL 3PWPA 3KGRA 4LLWB 1EPFA 5EBGA 2YS4A 4MA3B 1MUJA 1NUNB 5T1LD 1RZJL 5E2UL 1M05A 2CDFB 2BSSB 1WWCA 3WUZA 3CUPA 1W8NA 3TBWA 5HYJE 5BW7A 2UUDH 4OIIH 3L6FA 3RFZC 3LB6C 4GRLD 4AEIH 1T2XA 2XA8H 2Y07L 4LLUA 1VKXB 2DL9A 3SOBH 1LD9A 5DLML 3U6RB 3QZWG 3QWQB 3DGGB 4S10A 4AEHH 1LO5B 3O4LA 3WE6B 5CJOL 2BY1A 5B3JF 3CFKA 1QBBA 3FN0L 4ZAKD 2AJSH 4Z7VA 3MYJA 4UNVA 4TTGA 2MKWA 2XQYG 1KELL 1E4WH 1W72L 5C0BD 1RIVH 3TIDB 1L6XA 1EEZA 4JQVA 2R0WH 4L8SC 4RRPA 1HHIA 4X6FA 4ZUUA 3VCLB 3VDAA 4F9PA 2O5YL 3CDFA 3S7GA 4PP2B 1B88A 4OCYL 5FK9A 5A16B 3FQWB 1KEML 4KDTA 3ARED 1XCQA 1HNFA 1T89A 1KSRA 4LSUL 4GAJH 3VG9C 1RZKC 4M03A 4PRHE 1G7HB 4YDJA 4MCZA 1DQDL 1SY6L 1YEGH 2WINA 1F4WH 5LGHH 1T2JA 2P8MB 4HDIA 4PJ9C 4PRID 1QSZA 4G3YL 1DSFL 1BD2B 1KJ3L 5C3LD 5INCA 3FB7A 7FABL 2EDOA 1AIFA 2HKHH 4QXWA 4Y5YB 5DD5L 4ISVA 1ZVHA 5H35A 3G6JF 3FQUB 3LY6A 1MREH 3NIFE 2V7NA 2FCBA 5DVMA 3P9MA 3F7YA 3GSRA 3KXFA 3LDBB 2R69H 5DC0A 2OJEB 2ERJC 4KAQH 5T3XH 4EDXB 3OAUH 1RK0A 2Q7NA 4JM4H 4M1CD 4OD3L 1KJ2A 4OCWL 1ZHKB 4MNQB 3F5WA 1A9BB 4LSTL 2VQ1A 3B9VA 4M9PA 5FA4A 2A9NH 1EO5A 4NKMA 5HYJB 1MPAH 2HT2C 3AU1B 3R8BB 2CO6B 1SEQL 1Q94B 3TV3L 3SCMA 5T3ZD 1II4E 4ODXA 1A2YA 2YPLD 3S3JA 2PNDA 1I4FB 1CFTA 2YXMA 4X6CF 3H9HB 5H37H 4YBLC 5I1GH 1GJIA 4OFYD 3VD7A 1RHFA 2Z91A 5IIEA 4OM1H 4Z0BL 2VXQL 1DQMH 3N1PC 5L9DH 4M62L 5IJKC 3LKQA 2DKUA 2QHLA 2VDNL 3V5KA 3TNMA 4PTTA 4LCYA 2Q8AH 2EO9A 1NCCH 1OTSD 1NCDL 2VE6B 3OX8B 4HAFA 2ADFH 5ESQA 4L8CA 2H3NB 5IBTL 2VUOA 4W4NA 2UV3A 1RJLA 2ZJSH 4MJ6B 2GITB 4OZGE 1RIUL 1R5IB 4LF3B 4IM8A 1LK3L 4JFQB 5HHMD 5DF0A 2ZSWA 1DVFC 2Q87A 3VFPA 4XMLL 2I9LA 1FFNA 3LN9A 1C8PA 3LEYL 4Y19E 3DVNA 1F3RB 2AJUL 2ZCKL 2HN7B 3UTSE 1MCWW 1RV6X 4U6YB 4L8SB 2FYYA 3W82A 2IAMD 4JJHA 4UTBL 5GS0H 1BQHA 1C7SA 2R29L 3QA3A 4I9WE 3OJDB 4JDZA 4J1UA 5D6CA 4WDIA 1T04A 5HHOD 4XCFL 3OHXB 5ILTL 3VG9B 3FCTB 1RUAH 4XTRD 4L3CB 4FFVD 3CXDH 4PJ9B 1N6QL 4WU7A 5I16A 3PHOB 3MRDB 3NA9L 3PL6D 5CP7A 3RAJH 5E2VL 1M7DB 3W0WA 1C08B 5E08H 1NCUA 5JXAH 1JVKA 1Y18A 2YRZA 3RL1A 3IJHB 4NQEE 1XR9A 5FM5M 2R56L 4M5YL 3TVMA 4EN3C 4WUUD 4H25B 5B38A 2PYEE 4M7KH 4GMTH 5KZCB 3BZEB 3AVEA 4IOIA 4P9ML 2IQ9H 4FG6C 4WNQB 5DRXA 1LEKA 5D7IE 5CLWA 5D2LE 5F1NB 2APXA 3WS6A 4RQQA 3C9NA 3OJ2C 2AV1B 3S35X 5TE7L 4GRWB 3LQZB 4EI5A 5M7QA 5I1HH 4JPKL 1S7TA 4D0DB 4EXPX 3HZMB 1OD9A 2ZOKA 5IMOB 1AGEB 2BSRA 1QRNE 2G2RA 1BM3L 1FLRL 2DM7A 3DRQA 3HZKA 4IHOB 5KVMC 3LN5A 4MA1C 1T83C 1XGPA 3EO0B 3GI9L 2EE6A 4OZFG 2ICEA 4BK4A 1MRFL 5ALCL 3KPTA 1IC4H 1MF2H 2GUOB 2NNAA 4JN2B 1K8DA 3ZT6A 1P1ZA 4KU1A 15C8H 2AJYL 1XGRA 1MVFA 4IMKC 3X13B 3GUTB 1CXIA 1HZHL 2E7CA 2ARWA 2WZPD 2OQJA 1MFBL 4KK9D 4FQCL 5JPNB 2CDGA 2VQTA 3B3IB 4LRIC 2FZ3B 5HYSB 2Q7YA 3WFCL 3GSQB 3NN8B 1DVFB 4LLYA 2JELH 2VUYA 3BN9C 4FQ2H 2Z9TA 4XNZC 1I7ZA 4DKEH 3K3QA 5LKNA 5F9OL 1FG9C 2B4CC 2AV7B 3UX9B 4AH2A 1U58B 5INDB 2Y25A 1AE6H 1ZANH 3CFIC 4HLZG 3EYUL 3QDMD