4N48A

Cap-specific mrna (nucleoside-2'-o-)-methyltransferase 1 protein in complex with capped rna fragment
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
407
structure length
401
Chain Sequence
VDWRDEPEPSACEQVSWFPECTTEIPDTQEMSDWMVVGKRKMIIEDETEFCGEELLHSVLQCKSVFDVLDGEEMRRARTRANPYEMIRGVFFLNRAAMKMANMDFVFDRMFTNPRDSYGKPLVKDRELLYFADVCAGPGGFSEYVLWRKKWHAKGFGMTLKGPNDFKLEDFSELFEPYYGEGGIDGDGDITRPENISAFRNFVLDNTDRKGVHFLMADGGFSVEGQENLQEILSKQLLLCQFLMALSIVRTGGHFICKTFDLFTPFSVGLVYLLYCCFERVCLFKPITSRPANSERYVVCKGLKVGIDDVRDYLFAVNIKLNQLRNTDSDVNLVVPLEVIKGDHEFTDYMIRSNESHCSLQIKALAKIHAFVQDTTLSEPRQAEIRKECLRLWGIPDQARV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of human 2'-O-ribose methyltransferases involved in mRNA cap structure formation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/rna
molecule keywords Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase 1
total genus 137
structure length 401
sequence length 407
chains with identical sequence B
ec nomenclature ec 2.1.1.57: Methyltransferase cap1.
pdb deposition date 2013-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01728 FtsJ FtsJ-like methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.12760 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4n48A00
4N49A 4N48A 4N4AA
chains in the Genus database with same CATH superfamily
2X2OA 4J1QA 4RFLA 1E59A 1CZKA 4TN5A 2QLBA 2FCAA 3OZDA 3Q41A 1Q84A 4I9GA 3ZLVA 2OFOA 5JADA 1NVAA 3I32A 3KE8A 2PTGA 2VQDA 1K92A 1TM7E 3DM5A 1NDHA 2FK8A 3BD7A 1QRRA 1KZ4A 2PKQP 3MFQA 4P83A 3SAJA 5JARA 1M1NA 5HS6A 3PA6A 1N33B 4LTDA 3DEFA 1YMVA 3MCWA 4WOJA 1LNQA 5G4LA 1NVUQ 1KGDA 1PZMA 3SX0A 5JI3E 2GF0A 3JYNA 3FG9A 3HR7A 2QVYX 4O63O 3ROTA 4BQQA 1E3WA 5JRDS 3R0IA 1P1IA 3FR8A 3M4NA 1UJ6A 3IDFA 4CQJA 2H07A 3O4FA 4FYHA 1IHOA 2YOFA 2FPLA 2BTEA 3IHLA 1K7EB 1UMCA 3H11B 3HRHA 3K6JA 4IJVA 4QXQA 5EIBC 3KS9A 1U65A 3SKYA 4QLOA 3DEJA 4C7MA 1UADA 2YUIA 4EYEA 4WPGA 1NDQA 4P08A 4C0LA 2AJCA 4MHSA 1IYZA 1Q50A 2HQSA 3QUQA 4IDPA 4F92B 2VUTA 1A1VA 3V9AA 4CT0A 1YI8A 4I4TB 3MILA 2I62A 1X38A 1FFBA 2IZ0A 3NONA 4O2BA 3P9NA 2VAPA 2MYPA 2H7YA 2Z4TA 1ZGGA 3Q85A 4KBFA 2WM3A 4EI2A 3VR2D 4PN7A 1N6KA 1LLFA 3EVZA 3LGXA 4TMVA 1M0SA 3WISA 5BW5A 5TF4A 4HRVA 1P62B 4NE2A 1J7KA 2C4KA 3E82A 2HSWA 2ID9A 3PIRA 4PNZA 2V6MA 1V95A 2R8YA 5CFPA 1JIKA 4GOLD 3AZPA 2JJ2A 4G81A 3K0SA 3HB0A 1FTYA 2YWGA 2FF5A 4E7PA 3I01M 1T6YA 1UP6A 5DNAA 2BC9A 1OC2A 5K03A 2XZLA 1EFHA 2MHCA 2QTRA 2RAFA 5C8YA 4XUEA 4DQUA 2VTBA 1CUFA 4A10A 3T3GA 2P6NA 2C2OA 2XECA 2ZAMA 3PQ2A 3GRUA 3U17A 4HWRA 3BB3A 1ILEA 1MC4A 1FW8A 1PJAA 3P45A 1E60A 4UU7A 2OE2A 3L1KA 2N9UA 2Q5QA 1QHYA 3GDGA 3IULA 4Q19A 3ZI4A 2VPYA 3FPLA 4EHBA 3BF8A 2BCEA 5BOSA 5FRDA 1XNHA 3G13A 3JU3A 3HUDA 2JGDB 4A03A 3HRIA 5FLKA 2JFUA 2Y67A 3ESBA 1QG0A 1YJBA 2C97A 3PQ5A 1KORA 4KMMA 2CFTA 2XQJA 1PI3A 1L5LA 2NSHA 1V7CA 2B30A 3LUDA 2AF3C 4YRPA 4FMPA 3VR0A 4OH7A 4RVCA 3PDCA 1PJQA 2PMEA 1FTSA 4DUPA 3C5WP 4KOEC 1DXQA 3B3FA 4AMGA 1EUDB 2Y68A 3PT5A 2HTEA 4X24A 1EBUA 1FRFS 2DAPA 3GLRA 4BFTA 4AAYA 2D0OB 1QU2A 1K75A 4O0MA 4F72A 2VEDA 3RS5A 1JFVA 5AI6A 3U26A 4R05A 3B36A 3HR4A 2XB2A 2AC7A 4RTPA 4IIBA 3FFXA 1PWXA 3DF9A 5AHRA 4B6SA 4ZYVA 3PLNA 3T5CA 5CCDA 3A4MA 5KQRA 4DIMA 3P32A 3MF4A 3A0RB 1B6SA 1T2CA 3Q8KA 5A7HA 1I0LA 1UM9B 1CF2O 3CWQA 1X15A 2WLTA 1VE6A 4HAUA 4ZQBA 1NI3A 4HRYA 3WDMA 2W22A 2YW2A 2QZJA 3LXMA 3AVTA 2Q6OA 1XTJA 2JFGA 4ZOCA 5K0SA 2WYIA 4Z51A 3WBJA 1CR6A 1JXOA 1VECA 1TM3E 2J41A 4DBLC 4F5EA 4U9HS 1NBAA 1DADA 1PVVA 4C6HA 2R6AA 1G4HA 1OBFO 2VPXA 3MYYA 3GRZA 3DE6X 4AJNA 3EFOB 1MX3A 3PV0A 4PC3A 4C6TB 4ZHQF 1T8TA 4L50A 3V4ZA 1F2VA 5A4IS 1QG6A 2B25A 3JQ7B 4GE3A 1TVEA 4HDKB 4B6EA 1C30B 4O1IA 2XE4A 1NMZA 3LFHA 3BPSA 5L8VA 3I6MA 1UC5B 5I7HA 1L4LA 4NJEA 3I1FA 3I2GA 3MSXA 1CY4A 4OLHA 3F3KA 3AU8A 2C94A 4Z7JA 3ASYA 1Z5OA 2JFFA 4P4LA 2IWHA 3X44A 2A9QA 1QYDA 1JU9A 2GJSA 3GEHA 5BW6B 2ZM5A 4K9DA 1M2JA 5LYJB 1R10A 8ADHA 1T5TA 3NHRA 2W2MA 4LCBA 1YC5A 4MCIA 2RJ3A 2ZTHA 2PKQO 2EW1A 4WUTA 5K3EA 2O8EB 5JASA 1RU3A 3LBYA 1ZY2A 1JBQA 4HGZA 2ZJ0A 2BUAA 5COQA 3GEGA 3AKCA 5IKMA 1Y4DE 5MN5A 5HFAA 5ALSA 2V7TA 1P18A 3H5IA 1R5JA 4XVQA 4PC6A 2MR5A 3KQHA 3VX3A 3BK2A 1FNSA 5CM8B 1CQPA 1N5OX 1FVHA 2A0KA 2AFIE 3DBHB 3EXFB 3JQBC 4BUJA 5HZKA 4WOBA 2GM9A 3KSUA 1X7HA 1BXZA 3I6QA 5F52A 4WRRA 3K0HA 2I3GA 4RPCA 1CLEA 2AFHB 2GTPA 3EUWA 1SG0A 1S3GA 1NVVQ 3K0AA 5SV2A 3WK7A 3WDLA 3W8DA 1UJ5A 2AH5A 4MP3A 1IM2A 1C9JA 1U4OA 1J39A 2XE7A 4JFRA 4LSWA 4JENA 1E3TA 5KNCA 1VLMA 2WJAA 3LGSA 1QHSA 4GX1A 4FE7A 3K2IA 5GTDA 3S8EA 4DARA 2BKAA 4U7FA 2VZEA 5JWRA 3K7EA 3PWSA 3ZJYA 2FFRA 4DWVA 1E99A 1KEPA 1T3ZA 2PMCA 2PYZA 1SXJB 3QBVA 3VSDA 4QM7A 1GQOA 2AG6A 5CDHA 3EA0A 3CX7A 3VDRA 5GV7A 1G63A 4UOQA 3D5EA 1RPZA 3CLVA 1Q1AA 2XGMA 3WJ1A 2Y1CA 1Q91A 2IDZA 1SIWA 4Q93A 1NG9A 2X9NA 1FY2A 3AB8A 1FSGA 3VKUA 4G65A 4MKGA 4BNDA 4RU1A 4Q7KA 1IN7A 2NACA 3HBFA 3BB1A 4QSHA 2QZ9A 2YUTA 4YJ2F 3R0QA 3EQ6A 3KSDO 3TW0A 1WE2A 2A0YA 4M9SA 5TQ0B 1A88A 1L7OA 2ZIWB 1ZIOA 2ZTSA 2XNKA 3E5RA 4HFJA 3J81A 2W2KA 1XYVA 4YCMA 4IEFB 1O03A 1IQ0A 1TEHA 4JIMA 4P4TA 4DCPA 1JVSA 1IL0A 2X0IA 2ZT5A 3VH2A 4E30A 5BR1A 2D1FA 1UDXA 1FXWF 3N2EA 5LBUA 1SRRA 3JTMA 1AGXA 3IUPA 1Y33E 4R2KA 4AS3A 4GLOA 1R50A 2YXBA 4X71A 3ZEAA 3A1WA 1M34B 2J1LA 1DAIA 2DR2A 5JC8A 3ES9A 1FNCA 3UB2A 2QG4A 1VE1A 5CFOA 3NTUA 4F4DA 1Y7IA 3PUIA 5DFAA 3N2KA 4BY9E 4X41A 3BEDA 9ATCA 3DLIA 4JC5A 1GYRA 3K1AA 1R6XA 4PHGA 5LD2B 1A9PA 2C2XA 2D1QA 2HCFA 4WD3A 3ZVLA 1U0BB 3FD8A 3ER9A 2ACKA 4J0EA 5TJ9A 2J7KA 3T95A 2XXAB 2OESA 1E61A 2EG5A 4OHWA 4KR7A 2O54A 2KE5A 1KC3A 3DBVO 4KJXA 1B42A 3SZOA 2ZSJA 3FLBA 2FHSA 4GSKA 4MVJE 2VAXA 2XDAA 3OPYA 2OQIA 3QWIA 4RVFA 4UD6A 1MC1A 2CL5A 5ENZA 4D9NA 4TYNA 1RAHA 3EBPA 1RMQA 2YJZA 4P4SB 3ECSA 1RXSA 3C48A 3GGPA 4DADA 2YKGA 3QWAA 1PEYA 4QOEA 4V0KA 3R7WA 3ZDBA 1QGED 1WKCA 1Z7EA 2P5SA 1RABA 1K7XB 2OV3A 2RGBA 4PYOA 4LRQA 1U1DA 4JDUA 4BKPA 1YK1A 2I2XB 4MVJM 2X4LA 5EMNA 4KO3S 1KVTA 4AKGA 1BTOA 3KHSA 1DXHA 2KJQA 2NO7A 4MARA 4YT5A 2UYOA 5EERA 3I01A 3V7FA 5I5GA 5AUPB 4RJIA 4FCWA 1UM9A 3RGGA 2Q5EA 3WK6A 3ZQUA 3SWWA 1UDCA 4XCXA 2XMQA 3RK1A 4BP9A 4ZO7A 3KOOA 2DX7A 1XCOA 4I81A 1H2ZA 3BT7A 4HH0A 3G0HA 1RKVA 3NLLA 4LXQA 4K88A 3LA6A 4CV3A 1JH8A 2M98A 1AKYA 2O50A 1ZNZA 2ZWIA 3OP1A 4MINA 4ZREA 2PUGA 2GPWA 1IWPB 1GZSA 2VSOA 1PL6A 2OHIA 3O8OB 4DLWA 4EKEA 1OWOA 2HJSA 2E82A 3IE2A 4Q7MB 4B81A 1YU9A 4KAJA 4NF2A 1YASA 1E1LA 3K6RA 4IILA 3G49A 2GN8A 3K32A 5C2JB 2DXIA 2DWPA 3EXG2 3P0JA 1NQWA 4I7EA 3HUTA 4CQLB 3RW9A 5AW2A 2O5CA 3AR7A 3ZDZB 2ZXFA 5FNVF 1G4AE 3KUXA 3QKRA 1BEZA 3VZRA 4OHMA 3IAM1 2VUHB 1JS1X 3GGDA 5DSZA 1KAGA 4I8DA 3WKCA 4DDWA 4ARAA 4RHEA 5HS4A 2WR8A 3RYHB 4NEHB 3T7IA 3O8CA 2XTJA 1OHHD 2ZKIA 2NU9B 4C1BA 4ZYTA 1Z3CA 1J70A 1UT5A 2HBQA 1GDDA 4DV3B 3ISVA 3OLWA 4HQFA 4A5OA 4XEUA 4B3FX 1BXKA 2BISA 4B3DA 1KMMA 1N5JA 4CXMA 2Z3WA 3A70A 3WYBA 3P4UA 1K5GA 1N2BA 3V8BA 1N77A 4EM6A 3C6YA 2ZE6A 2WJHA 1X7GA 5AVQA 2O57A 5ESWA 2ZRKA 3NDIA 2QL7A 4XRRA 3WBBA 2FQQA 2NT3A 2G72A 3V4FA 1MNQA 1Y8QB 3WK5A 3HP7A 4HPXB 4UFPA 3AJAA 4HADA 4DJTA 2RGNA 1SKYE 4MP6A 4NCXA 4LQLA 5CW1A 5DSXA 4EFLA 5CBPB 4ISCA 4IIVA 3PXUA 3R9XA 4OSEA 3I9JA 2QN1A 1I2DA 4RIFA 3FHOA 2I6XA 3QM1A 4FMCB 5IAEA 3CSSA 4EB8A 4F56A 4UE2A 2R8EA 1TD9A 2OZEA 1I14A 3RROA 3WYFA 4EG8A 4E5KA 4F3KA 1SXIA 3MRTA 1FVXA 3QTTA 2ANBA 3VC2A 3E05A 1VPWA 4EUSA 3EEQA 1AF7A 3A28A 4RHUA 5FWYB 4BBZA 1N3YA 1C41A 1I8TA 4BPBA 1KYXA 4LV6A 5FT9A 1PW7A 2X3UA 5LCXA 3ISJA 4DIBA 4JXZA 2EYQA 1WO8A 3C6BA 3OZBA 1T4CA 4ZJPA 1GG8A 1UP7A 4OATA 3BIXA 3GU3A 2OTCA 3O93A 4PM4A 5CU7A 5F73A 1WM1A 4O33A 4C0BA 4OH1A 4DA8A 4AXBA 4ZWNA 3UAZA 1SUBA 3R6WA 1E64A 5LJLA 2ZI5A 1UKVY 5BV0A 1T15A 3LUFA 1WXEA 3ZC3A 5BQPA 2Q3JA 3JVUA 4ND4A 5TMDA 4DCCA 3ICVA 1YNSA 4YC7A 1CS0B 4J3FA 4EIWA 4UREA 1VLJA 3PJFA 4QJIA 2VF2A 5THKA 1SEPA 3HB7A 5FPYA 3GL9A 4ZVUA 4K87A 1KE2A 2M6KA 5EP4A 5KYYB 2PUDA 2NP7A 4YO7A 1XTIA 4R2MA 4O4JB 2ZPUA 2OOSA 4MS1B 1W6RA 1YBVA 3T52A 1DKMA 3W3ZB 5A2GA 4G4JA 4QOHA 4R7TA 4PX5A 4F9EA 5F7JA 1TMKA 2GRUA 4PR3A 5FBZA 3QNWA 3R74A 3ZE2B 1HY3A 1DSSG 3ETCA 3A2MA 3LLMA 1W4ZA 1B41A 2BZGA 3WVNA 5IVPA 4TVOA 3V7UA 2GJ4A 4RAQA 2QVGA 4S1OA 2CL0X 4XIYA 4EA7A 1DC7A 1QANA 1MRNA 3G0OA 1GZHB 1SHKA 4IG4A 4ZDIA 5JY6A 1EFTA 1AF4A 1NU8A 1L3CA 4FGLA 1LGYA 4J0DA 4MIKA 2MU1A 1NQOA 3UJPA 4MUNA 3KOXA 1RD4A 3ML1A 3VXKA 4ABYA 2FZLA 2QQ0A 4G09A 5GONB 4NCKA 1RKUA 3HI4A 4AZ0A 3NDPA 5JCOA 2O8FA 5FYDA 4C4OA 3H3XA 2CFRA 5HXAA 4RGBA 2ZVPX 1V16A 3QPBA 1ULSA 3NRCA 2WMDA 1NM5C 3OIDA 3UHJA 5HKAA 3DFUA 2IPMA 4BZWA 5ALEA 1WW8A 5I7AA 4X93A 4YMIA 4Q12A 3VO2A 3NMUF 1OD6A 1K7SN 2ARKA 3ORSA 3QU4A 4ZU1X 5L3ZA 1UZAA 3U4HA 4OMUA 1CY6A 3RSFA 5LIRA 4RTSA 3FXAA 1DCTA 2RGYA 2RGXA 4K28A 1YR1A 2FMUA 2PZBA 4Y9UA 4ZKEA 5DBGA 2WSBA 1ZM2A 4DNOA 4ZZ1A 1P7YA 4JUBA 2BWJA 4XWYA 5AKZA 1OH7A 4OQ4A 4C3VA 3TTTA 2QD5A 3DVAA 3N7UA 5IEBA 3TPZA 2VHJA 1EE2A 4H6VA 4CLHA 1MAHA 3FYTA 4EPXA 2OSVA 1P9OA 2FR8C 4QVGA 2XZDA 4TQ9A 1GTZA 2GN1A 2Y93A 4LVUA 3ZZUA 4BX9A 2JCXA 3T9EA 2C84A 3TMAA 2JAHA 2A94A 4YAJA 1FTNA 3GZ4A 3C74A 4ARIA 4MIEA 3P9PA 2PT9A 1UMCB 3H11A 3WRXC 3CZMA 2D5AA 3EOBI 4N0MA 3L7CA 4XAQA 1GXSA 4NCHA 3VPXA 2H2AA 3DDUA 2NPFA 4R1PA 2VC2B 3BXGA 1L4BA 1N75A 1QTQA 1G8SA 1ZS9A 2OO5A 4AJ4A 4NE9A 4UDOA 4R8LA 5T41A 3EAGA 1Y0BA 2I1WA 1R5NA 4J94A 5D8DA 3W5DA 5KVAA 2QTCA 5JZOA 1NUUA 3W2IA 1ZFNA 2ZRCA 4K9KA 4YI5A 5M5BA 4JUFA 1EINA 2PH1A 2QMHA 2YHBA 4R6XA 3BERA 4NMXB 5BPHA 4M99A 1FTGA 3FOFC 5JNUA 1RRMA 1XZIA 1L5NA 3WB0A 4KC0A 2CK3D 1L4UA 3FTFA 2A6PA 2CV2A 5HGJA 5LUAA 1G9SA 2ILTA 1U0SY 3LCUA 3Q3HA 4EVIA 2SKCA 3SOZA 2RHBA 4MS3B 1ZQ9A 1PFVA 3MRSA 3S99A 2WHYA 3H2GA 3GARA 3VR3A 3ZQ4A 4BFXA 3RC8A 1E2FA 3NTOA 4D79A 3ER8A 1BHO1 4TLCA 1PR1A 4WBNA 1U8ZA 3W5UA 2WUWE 5DP1A 2JK1A 3IERA 3MTJA 2O2ZA 5I9MA 4JYMA 1G20A 1PZXA 3VSAA 3QX3A 1I2CA 1T2UA 1KMCA 2DMRA 5LUBA 1HX7A 5HF5A 2O8BB 3N76A 3O7WA 3QXCA 1MQSA 3A3YA 3OIYA 4YAUA 1I94B 1QFJA 1Z6XA 3KUCA 4GI7A 1JX6A 2V5VA 2JFYA 4WN9A 1U8EA 3NVDA 1YL7A 1Q0LA 3HVJA 4NK4A 2HDOA 5CYPA 4JI6B 1OV4A 5BNIA 1PR9A 3SKVA 3R3VA 2G6TA 4C88A 4CIWA 2NVUA 3KZVA 4RA9B 5JNRA 1VI5A 3F7MA 3CVVA 2BEKA 2Q21A 1NSYA 3SXPA 3D0QA 2HT1A 2A1TR 3IA7A 4GWKA 3T5DA 4UTOA 3K0KA 3OZRA 1N25A 3NAMA 1V43A 3C3DA 5T4FA 1NXPA 4MRVA 3RFVA 2IVZA 3BIOA 1ODLA 2XXBA 4YFYA 1CQWA 2LP4Y 3IAHA 5IC5A 3LLUA 5KB3A 1EP2B 2WWRA 2NAFA 3QPCA 1U2QA 1X80B 3DMDA 1OZAA 1KDRA 1KI4A 1G5TA 2HQ1A 1QFYA 3PE4A 4IL5A 1WCIB 3CUYA 3JQ9C 3ND7A 4S1NA 3D7NA 4BBJA 4C5AA 3P9ZA 4YGYA 4E08A 1B1AA 5LQRA 1QYWA 1N7GA 2PGXA 4IJ5A 3TKYA 3OLCX 4D46A 4ILEA 4MJXA 3N53A 4D98A 2QORA 4GP7A 1Q1NA 2H7VA 5CR9A 3LF2A 1WP4A 4Y9DA 4EL5A 1XRSB 4L57A 4YV2A 1IHYA 1VHLA 3FSRA 1UBGA 3BH7A 3ZW8A 1CIVA 4FQ8A 4KTTE 2GT1A 4FNOA 4MLZA 2JLZA 3GFTA 3FCSB 4G5XA 1UWVA 2YJTD 3RJTA 5KNCH 3SQWA 1Y6FA 2ZE5A 4IMJB 2P9QA 2YWDA 1L7NA 4KWCA 5IM4F 4IRXA 4KDFA 4LVNA 4M38A 2GM5A 2E49A 1BQ3A 2AX3A 2NO9A 3R40A 1Y8RA 4OGGA 4HUQA 4BQEA 3I61A 2NU8B 3EPJA 2CL6X 2HSEA 5C8XA 4K9QA 1KJ9A 3FMPB 4TM7A 4LVCA 4QRIA 4DR1B 5DOZA 3EDYA 1RXWA 2O3UA 4OQMA 1BQEA 4NBWA 3PCRB 3ZXSA 2IYYA 2JEZA 1JDPA 3U3KA 1V96A 2VZ0A 4WKNA 1WB9A 3OZXA 1XTSA 2JFNA 3PS9A 1T9ZA 2O05A 4P0QB 1DVRA 3PNLA 5IK2A 4D25A 4KGDA 4DLAA 1OHHA 4CEIA 2IEGA 4KWTA 5EYPB 1A9XB 3USES 4DCGA 1Y34E 1GVHA 2XWSA 3LYUA 3UOGA 5CB4B 5A3VA 2VATA 3OOJA 1ZGZA 2RKBA 4M1EA 3D31A 4X92A 3SBEA 5AK6A 4K5QA 4L0QA 4TXMA 5KI6A 4DA7A 4CTNA 5CBKA 1S0UA 1PEDA 2B0JA 1XVAA 1IN5A 3RSGA 2IH2A 4OFBA 3S2SA 3AI3A 3NV7A 4FOPA 2P5UA 4I1OA 4AY4A 5L7TA 1EP3B 3MRVA 3GUVA 4UMFA 1Q2UA 1R0LA 3E5NA 3UM9A 4D9EA 4DMMA 5A4JA 2EP7A 3VHQA 2M6RA 4FHFA 3ZWKA 3GXBA 3PJRA 3D6TB 4ZQEA 4ZT2A 3BXEA 3P19A 3F1KA 4IFTA 1QHIA 2ORWA 2Q6VA 3OJOA 3FWYA 4JLNA 2FJPA 1KZGB 1R12A 1H9BA 1T1IA 4CI9A 5H4GA 5KVSA 2HGSA 1P7PA 3AFHA 4EO7A 2NSLA 1RWMA 3G7SA 4DR4B 1AUVA 2EFJA 3KAKA 4QFBA 4N5IX 2B98A 3I3OA 5BQXA 3BMCA 4R98A 5GM1A 1Q12A 2GK4A 4TYPA 4F6LA 5DWVA 1N5KA 5AKIA 3OZSA 2ZBDA 3TE6A 1L7VC 3H4MA 2XCUA 3PKJA 2PUBA 4W4TA 1C4OA 4PNEA 2FWAA 3TX6A 4DCSA 2VHQA 3NWEA 1GRNA 1P5ZB 5CVTA 3JQBA 3EODA 4XM0A 2B92A 3TM5A 1N36B 2WKRA 5BVGA 5TDHA 1AHIA 3RO7A 3LJKA 4MUMA 4Y30A 4MH0R 1ZLXA 3NYIA 2ZCUA 3CVJA 5KMGA 2CLLB 3W06A 4U39A 3UFXB 5BRAA 3GJ5A 1G7SA 4RK0A 2WT9A 1LTKA 4O4JF 2QG6A 3VU8A 4EQZA 1KO8A 1WMEA 5DM4A 5ALVA 1PT8A 2GK7A 3PXEA 1VGQA 4WDQA 2AXNA 3EZYA 3VHLB 5ITWA 3T7SA 1FDWA 1BG6A 1JIUA 1GPBA 3B9BA 4QXAA 2YZNA 1UXIA 1OBVA 4Q3OA 4NPHA 4N40A 2I3DA 4OU5A 1FQJA 2NSJA 1ZIDA 3N07A 3V4LA 4YJ3A 5E6SB 5F2OA 3TPCA 1VMEA 2G04A 2XOKA 4OHXA 4EI7A 5CLFA 4WZBB 2BE7A 1P6XA 2HQOA 4LW8A 5DNVA 1ZNQO 2X4GA 3AKYA 4MQ4A 3WX0A 1ZMTA 3DBHA 3EWAA 2PD6A 4TKUA 2ZI4A 1EXWA 1H93A 1KTVA 1UOEA 2YV2A 3ASUA 1G20B 3QX8A 4XVHA 5F78A 5A0FA 2C3PA 2Q0QA 3CVYA 2O8EA 4HSEA 4FCCA 3UMFA 3V1UA 4GI1A 3RG2A 2BFEA 3LTEA 3DMNA 3OTQA 1BC5A 1XAHA 2PJDA 3G8BA 4L07A 4X1OA 3QWHA 4BFZA 4XPZA 4BQIA 1R9NA 2QJFA 2KLHA 2DTDA 2IY7A 3HHPA 4RE6A 3UF0A 4DXAA 4YHHB 4Q34A 5EEGA 2QUZA 2O7QA 3DQQA 3NVAA 4KV9A 1UXKA 3TOCA 3GP8A 2BL4A 4ND7A 1VE9A 1BD3A 3TEFA 1VA5A 5IJWA 3GFOA 4YAKA 5IFLA 4MPRA 1R6UA 1C7IA 5CJJA 1QTRA 2A0UA 4BKUA 3JYOA 5B1HA 3TTWA 2FRDA 3WL7A 2C2WA 1ZO8A 3D3EA 4HJXA 1Z17A 2IPAB 3DDZX 1HKHA 3MTEA 1Z37A 5JD6A 2O2YA 4Y7CA 2DULA 1GZUA 4G0NA 2C4TA 2IPNA 1WKBA 3LNCA 1FNBA 4GE0A 1NVXQ 2FZCA 3KOWA 2CJPA 3Q0IA 3MJRA 3ZKWB 4EHKA 1TGVA 1F9EA 1RBZA 4ALJA 3KYBA 1UBKS 3FNGA 5HJ7A 3IXLA 4EVQA 1NQ5A 3ANNA 4KMSA 2DQZA 3FPFA 2W4IA 3DOUA 3F7OA 5EJ9A 3ZTWA 2XWBF 3U09A 3F5QA 2FN9A 3FF1A 2BEWB 1M1UA 5AKYA 1OXKB 4CU2A 3A6PC 2VWGA 5ALHA 4E4YA 1QP7A 4PPFA 3NV9A 3O73A 1QJ4A 3U7IA 1JN0A 4CPDA 4QOSA 3AHDA 2PBLA 1B2LA 3FRJA 1CY2A 1I5RA 1ZN8A 4BNZA 3GNSA 1GLVA 3BQMB 3O91A 5C8YF 4MUHA 3W1WA 3KLOA 3L5KA 2QTGA 4C0XA 1SOMA 5FUWA 1FSSA 1LI5A 1C3OB 5FFNA 1I7LA 5BY2A 1PKXA 4EJ2A 4NOMA 3JALB 2P5TB 1UODA 3E22B 4DY6A 4YR7A 4HRXA 3I92A 2H1OA 2FN4A 1U5AA 2BBOA 2P6RA 3I1YA 3B3AA 3V1TC 4TTVA 1NXSA 5JHHB 2BFWA 1K2VN 4WVFA 3B6MA 3BL8A 3I39X 3NNSA 1NUQA 2UAGA 1ICIA 4UTZA 4WZAA 3ZUPA 2NTJA 5GP1A 1BKDR 3TYXA 2F43B 2X6TA 4DCUA 3HTXA 4RBNA 3PGVA 2YZ2A 2GBFA 4TTRA 4W5WA 4YRIA 4I1RA 1VA4A 3IP3A 4KN5A 4LHEA 3BRWD 4OGWA 2XYVA 5EVJA 3PQEA 3RWBA 4EATA 1SPBS 4ZAGA 2NUPB 4JBIA 1ZIXA 1Z6TA 2G28A 3C1AA 3JYLA 4RF5A 2VJYA 3IBGA 4OAQA 2J3EA 3S0JA 1AN9A 2VHEA 3V7NA 4AYXA 3FNEA 3LF1A 3O8LA 1TI7A 2P62A 4KXMA 3DXXA 3FETA 3HMQA 4WA8A 3A26A 4EUKA 4DV4B 2I03A 3CRRA 4F0JA 1L9KA 4FEYA 1C8LA 1KJQA 2H2IA 3PVZA 2JI9A 4FEAA 4R9VA 1ECCA 2R60A 2ZJBA 2V54A 3TF5A 1VIYA 1YJCA 3PDHA 3BTOA 3GUUA 4CMHA 3MELA 1BD4A 1WV1A 2G9ZA 1EDEA 3O3CA 2W7TA 2DR0A 4WFIA 3N75A 3AETB 3V7WA 4BTEA 1KO7A 4ERNA 1XHLA 2FTKE 1FYVA 4TKMA 3V4VB 3DE3X 3G0GA 1U90A 3QW2A 3WNZA 5EGNA 2PO7A 3LY9A 5M29A 3DZBA 5DCLA 1SOVA 1JR3E 5EP3A 3ZXXA 2F00A 4N3BA 4Z53A 1LVUA 2Y2VA 2PUHA 2WTBA 3RVRA 2CNWD 1J25A 2HBYA 4UEJA 3SHVA 1QIKA 1L5MA 1F7VA 1ISPA 2XNCA 1IQRA 4DMUB 3Q1LA 4F3TA 4FUTA 3DF7A 4XTRA 5KQGA 1BHSA 3M6IA 4QD3A 3CF6R 2QP4A 3K0AB 1XXHB 4LGYA 1ZLYA 1RQPA 1TKCA 1C7QA 2D5LA 2IRWA 1E2JA 4BYMA 1LVGA 2ZULA 1KI3A 1QVWA 3F74A 1PJLA 1DI0A 1N6RA 4NV0A 3FOWA 2X9VA 5I3ZA 1YCGA 1OXTA 4YAFA 5FJJA 2WQ7A 3A58B 4NENA 3V7YA 3VU1A 2QUIA 4QTUB 1U7ZA 2DM6A 2D7JA 3KO8A 2YASA 1C80A 3QKWA 2ZRGA 1ZXBA 5AK0A 2JG3A 3LHIA 3E70C 3ETNA 4UKDA 1GPKA 2XUGA 5JAPA 1GGJA 2XMGA 3A9SA 2QM3A 3NR2A 2GD6A 3D6JA 1TK9A 2H7XA 3T12A 3K15A 1KQ3A 2ZIAA 3JVDA 4DUGD 3Q15C 4UU0A 4YCSA 4OBEA 5BWLA 3AW9A 3PUWA 5A0TA 2ACEA 2IODA 4YXWA 1AA9A 1X2BA 3C7AA 3C3JA 4UUOA 2G5TA 5F77A 1NPTO 3KDSE 4BJ1A 1E1CB 3A9WA 2ALJA 1ZGAA 4JYCA 5E9AA 4WLNA 5IYZA 2X58A 4LZNA 1GSOA 1V6SA 3TRKA 4FPXA 3CNBA 4ZHSA 2R6HA 3OHPA 3PQCA 3NFYA 4DT1A 1GYQA 1K89A 2VTDA 4OBBA 5JTUA 3SSNA 4DKXA 3SEQA 3I5UA 4RACA 3R0VA 1TNDA 2HADA 2O9JA 3QXSA 3E3LA 1PN3A 2XQVA 3QPWA 3R3ZA 4RL6A 1AZLA 5BWCA 2FEWB 2GCOA 1WPQA 1IZYA 2Q6LA 4ZMSA 1N1DA 2IP4A 3VBCA 4QUDA 3M4YA 4DN6A 1QIIA 4A2CA 3QXXA 3LTNC 3QU9A 4QZVA 4IX9A 2YBDA 4EF4A 4LXUA 3U4MA 4LXGA 4AY5A 2QK4A 2RGWA 2VYNA 4BGVA 3GT3A 4IIJF 2V7VA 3S29A 1F8YA 4S12A 1USWA 4O25A 3IBYA 4O4HF 2C1ZA 3GP3A 4DR2B 1U4SA 1HUQA 1I4WA 2GYWA 2IT1A 2C2KA 3N6RA 2JGMA 1PR4A 3D7KA 3R75A 1EM8A 3CVOA 1RC8A 1UF9A 3FAKA 3M1YA 3EPHA 2GVNA 3UHOA 2I2DA 1EA7A 1QNFA 1RACA 2X9GA 3EVFA 3EXIA 3KX2A 3EHEA 4K6HA 1AD2A 1JQEA 2NQ2C 3FUUA 3H2KA 4OJQA 3VH4A 3ZJ5A 1AB5A 1IY8A 2RGDA 3QEKA 5C8ZA 1IVSA 3TAXA 2M32A 2LCQA 1UDAA 4O8CA 5G3ZA 2GCIA 2WSSD 3WNBA 3L3BA 1ZM9A 1QP8A 2DFVA 1UQTA 2ACWA 2VSNA 2G36A 4I0WB 3MWFA 4PHFA 2GKSA 2I22A 1KBQA 2CDRA 5A3RA 2W8ZA 4R1QA 5THQA 2NYRA 3AM4A 3GUYA 1Z5WA 2WKWA 2ODPA 1PG2A 3KSBC 3RIYA 4OUDA 1D4AA 2GBGA 1T6BY 3GFVA 1N2EA 3TBFA 2VHVA 1V7PC 2O3JA 1Z5VA 2NYAA 1UBHS 1E63A 1GQYA 1LPAB 2RBKA 2XTAA 4NYMR 1E4EA 5A6SA 1CK4A 3U7RA 4KFCA 521PA 3N9IA 4I3HA 2IYZA 3LDAA 2ATCA 2JJMA 1FMTA 2AW3A 2GMWA 3OPVA 4QARA 4CLOA 3VJMA 1MB3A 1M33A 3IT2A 4X1YB 4ZEMA 4ZK2A 3EEIA 2WW8A 3G9XA 2AQ8A 1KYTA 3LY7A 1DLJA 5EXSA 4KQXA 1VMDA 1XZDA 3H4VA 1L7MA 2WDPA 4MS4B 3E7WA 4O29A 5KNBH 2B1GA 2J5QA 1RXIA 3FWZA 1Q0QA 3IJEB 4KYTA 5TVGA 2HU7A 2VBIA 3QQPA 4IEEA 4QHYA 4LDJA 2N1BA 4MIOA 2DQ4A 4YMGA 1O6ZA 2HD4A 5BSHA 5HK9A 5KSWB 4PTYA 4R83A 5CYOA 3T35A 3UWKA 1VLVA 2Y1WA 4M0UA 2R00A 4MKXA 5TEWA 5E38A 4EA8A 2ZWVA 4EJ0A 5FOUA 13PKA 1MLDA 4F12A 5JXHA 3E3AA 2V7PA 3NOVA 4I6EA 4Q39A 4B3MB 1IBMB 3IEVA 3ZV5A 2MR6A 5LKAA 3L6RA 1JFSA 1P6UA 4LF6B 4UHDA 2EJWA 1EB9A 2GH1A 1E1NA 1OWPA 4UAUA 4DHWA 3D3KA 2HFKA 1KY5A 4NONA 4V02A 5DBEX 3BE5A 2OHHA 3CU5A 1QS0A 2AX4A 1WJGA 4CNBA 1Z2AA 2QJOA 2R7NA 2YNMC 1XT6A 2B82A 1YE3A 1IUNA 1G5IA 2AJBA 3E48A 4GI3A 4L8FA 4M8KA 5CPFA 5I9NA 3PJDA 1Q1QA 4DXHA 5JSUA 1LWOA 1PJCA 3HCAA 1VYVA 3MOIA 3TQRA 4OLBA 1U31A 2HJGA 3ZD9A 1QDUA 3T3OA 1UIMA 1MVNA 3HN6A 2WPNA 4MPTA 4U7DA 3G89A 1OGYA 1Y1SA 2GHQA 2ZYDA 3C3PA 3NC4A 2X5KO 1N9GA 1XG5A 4M1QA 1QGUB 1GU7A 3KEGA 3QF4B 4LECA 3TGWA 3SY8A 3WSTA 3MN1A 1N1GA 2Q4TA 3OBBA 1XQXA 1ADBA 2JA1A 3WRYA 1WXWA 2H57A 5C1PA 4ND8A 5TR9A 1E1RA 2PCLA 2Q8NA 3WL3A 1XP5A 2HI0A 3II6X 5JSZB 2AE1A 1CRPA 2Z8YA 3IA2A 4EGQA 3UK0A 3H05A 3E8SA 4L9AA 4YJHA 4QBIA 1FMJA 4CQNA 4OXQA 2Y8EA 2FPGB 4IOMA 2NGRA 3ENVA 3ZE6A 3MPOA 3ND6A 4IHJA 4KNWA 2VWPA 4KHZA 4ND2A 5BSVA 5EKTA 2IXEA 3AB7A 3UMRA 1ZVKA 1DHTA 4QHTA 3HB1A 2QPOA 4RJJA 2F8TA 2M1ZA 4D3DA 1IEQA 2V7EA 2I5PO 2J4DA 2VDMB 3LT0A 1Z4OA 4HNRA 2PKWA 4ML3A 4LSGA 1BE0A 5FOTA 1KE1A 2FSVA 5J4YA 4GDFA 1TZCA 3GDFA 4M83A 4QU8A 1JIQA 1V11B 5AI4A 3A14A 1AUPA 2HA3A 2IOQA 4L8YA 3IO5A 1E62A 3BS4A 2GBPA 4C08A 3UJ3X 1Z5PA 3CPEA 2ZYIA 5BSEA 2WC1A 3F5FA 1AV6A 3PYMA 1EPUA 1UZMA 3CRNA 5TIIA 5A5GA 2O3TA 4DR3B 4AUNA 5KBYA 3LQ1A 2WWXA 3HKCA 4FB4A 2IIBA 4KBGA 2VSQA 3GA5A 1JEEA 3HL0A 5DLPA 4BFUA 6YASA 2BFBA 1Z22A 4EBBA 3C5EA 2A1UB 1G9XA 1DEHA 3EE6A 4KQCA 3UAWA 2IYQA 5DK6A 5B3AA 5HM8A 4DLKA 1MHTA 4C0HA 4I1PA 1JG1A 2HO4A 2PR2A 1N4DA 2AMVA 2Q6TA 3PD1A 2R8BA 1YDHA 1SURA 2IXAA 2OL4A 3K1TA 3SHWA 4S1VA 3J7TA 4DNPA 1P81A 2BPOA 3R0ZA 4FLMA 3RFUA 4FDLA 4D81A 3RRZA 2HBZA 2FSSA 1NT4A 2WD7A 2JGLA 3COZA 4LZZA 1OZFA 5F9FA 1I30A 3QUAA 4FYKA 2VDWA 1M1YE 4CM9D 1GPH1 4GEKA 1I51A 3EZLA 3K94A 3HO1A 4AZ3B 5A3SA 2EOAA 4GRDA 5EJFA 3EQ2A 4C2UA 1G17A 1T1GA 2QPLA 4MRRA 4W9NC 1ZHFA 4GOJA 1SU7A 2FY8A 5B1EA 3MWDA 1NG1A 5JJBA 2DCUA 3UV3A 2JLCA 4RY0A 4TLDA 2A78A 4ZT5A 1SD2A 2BHNA 1UBTS 2DP4E 3D9QX 3KYDB 3WMFA 4DQKA 2W6JA 4GR9A 1IK6A 1BMFD 1X7DA 1XMSA 5L3QB 2XRMA 4US1R 5CB4F 4HWSA 2CLMB 2O2GA 1Q6ZA 2PIDA 4Q03A 1AKEA 1H2RS 3IBTA 4DDVA 2EGUA 4LHVA 4CQMA 2W6NA 3TZBA 1D5CA 3FN4A 1HPLA 5E3HA 4HTFB 4JJ7A 3SQNA 2XRYA 1XJCA 3Q11A 4O5AA 4AJJA 1ZBDA 2CHUA 2FWIA 3HJCA 1YB5A 3ZV7A 4AQYB 1UKCA 1XRPA 5EHNA 3UJHA 3UK1A 4HQ0A 3JWJA 4EG0A 1XEAA 1N0WA 2LR0A 4JOQA 3HCWA 1VHDA 1S6YA 3H8VA 5ALDA 4F4HA 4YAEA 5EIAA 5IG2A 1R0BA 4IOLA 3EDCA 3A6DA 1JXQA 1RTTA 2DHQA 2DR3A 1KI2A 1DUSA 2C8LA 2F8LA 4J75A 3G8CA 2HT6A 4LOKA 4L73A 3R76A 2P2GA 3CV3A 3GYBA 2EZUA 3X2EA 4Q4AA 4CLOB 4TOIA 1W5SA 1JL3A 3MBOA 4G5SA 3GIWA 5IW8A 3W3AD 3FKSD 5I6DA 3DYVA 4AS2A 1SOUA 2IHTA 3LZCA 2I3BA 3ZGYA 4QQFA 2OXFA 5KYXB 1T5OA 3P2IA 2I2WA 1XQ1A 1QIHA 3ABOB 4MEBA 3RC1A 3NKLA 4CLRA 621PA 1MEJA 2O06A 5TV2A 1T8PA 2PZAA 3WYNA 1VL1A 4AMUA 5JJCA 1Z63A 4PCAA 2QV0A 1SO8A 5CNJA 5JNWA 3CC8A 5T57A 3RHZA 1L4YA 1W4CA 1X1AA 1XAGA 1AS3A 1G5HA 3H2YA 4C5BA 1YBHA 3V8NA 3AM1A 1YJ5A 3A1UA 1WDWB 2QR5A 3Q87B 5EINA 1XZLA 1O5OA 3QBJA 3L1IA 4Q4HA 3ULKA 3ZDDA 5IVIA 1DKNA 1E0JA 1PL8A 1RLTA 3KPUA 3VX4A 2Y4NA 2DGDA 1KY4A 3JARB 3KLBA 2OYCA 1JSLA 1BGXT 2FEXA 2RMKA 4PNPA 5CT9A 1FBTA 5EPEA 4MA5A 2DYKA 5CRIA 2D2EA 2GI4A 1R4NB 3DV9A 3I8SA 2YMMA 1Z34A 3S8YA 3MSCA 4KXLA 2CLDX 4Y1RB 1SK9A 4JUAA 2ISCA 1Z9BA 4MPJA 4CJXA 4MWCA 1N9GB 3GLFB 3KT3A 5EWJA 2QW8A 4Z49A 1DO0A 3DAOA 3L4BA 4RTLA 2C7QA 2CBGA 1KVSA 3SPXA 1DU4A 3GD5A 3CLSD 1XVLA 4HGRA 3L0ZA 4FTWA 3R8XA 4QU9A 3REQB 3WAKA 1OFGA 3LXUX 4MLCA 3EXHB 3KWJA 1LF5A 5AVVA 2O14A 4UBMA 1OU0A 4X7MA 1C3OA 2HHAA 3GX1A 1ZUNB 3BCHA 2X2EA 3AJ9A 1UCFA 2XXJA 4IZHA 1NNUA 2HN9A 4MI3A 4DDMA 3CX4A 3KAJA 5K0TA 3QLUC 4P34A 4L74A 1KK1A 4ASUA 5AUNB 1LZKA 1M5RA 1VFPA 1BN7A 1H8ED 1USIA 1FU4A 2PL1A 4N48A 1UK9A 4I08A 1B1CA 2DBRA 2PEYA 2QAJA 5T6MA 2B4RO 1N3BA 4AJPA 1W88A 9LDBA 5JW6A 1E5TA 5BUZA 5U9CA 4MWEA 1ZVJA 1S9DA 3C6ZA 2X5OA 1R15A 3QNUA 5H4HA 5L3RA 4D4HA 1E8MA 2PLNA 3RC9A 1G5RA 4JQZA 4MB6A 5AXCA 6REQB 4G4SP 1BRTA 3AKDA 3ZWBA 1MVLA 2GHRA 2GCGA 2IHVA 5BNWA 1LRKA 2AOXA 1E9EA 1G3RA 4R51A 4F6RA 3SHTA 1ODCA 1NF3A 1RCUA 3VNSA 1MABB 1EFLA 1AB6A 4HLNA 1Z47A 2QD4A 5GONA 5EQFA 1Q74A 2CL7X 2JCVA 3L7KA 5I7RA 5DBIA 3IHTA 1MUUA 2B6HA 2IHYA 4O4IF 4RA6B 3RVJA 2V9CA 4RNDB 5AM5A 5GZ6A 2Y6UA 2PH5A 3GR6A 3OE5A 4DLLA 5BMVF 2WIBA 4Q4JB 3TGLA 1HI9A 1RLUA 4MPPA 5BSRA 1PQUA 1DJQA 1DRWA 2VJAA 2Z8XA 2QN8A 3ZZ0A 1FDVA 1V4NA 2GDZA 3HL4A 1FYWA 1J0CA 2D2VA 1UBCA 4NZYA 4V38A 1XEWY 3DNPA 3P9SA 3H9JA 5DM2A 1D2HA 3KDPA 4R68A 2BY4A 1E9DA 2P2YA 2VS1A 3DTYA 7MDHA 5LP6A 3K9NA 4TLBA 4XUDA 3TAHA 1JPVA 3CE6A 2Y0DA 4UCWA 4BVFA 1PW5A 4B43A 5KC9A 1NIPA 5DGTA 2JRCA 2CXPA 3WWDA 2PKRA 2RGAA 2RHCA 2RH9B 1JKFA 5CG1A 3HDHA 1GL9B 5T6BA 1OU4A 2IW3A 3TSYA 3GLGE 4QUHA 4YPFA 2LV8A 3BMCB 1XX6A 2GNAA 2Q07A 2XADA 3L8CA 5D3QA 2BFDB 2RHGB 4BVJA 4Q3LA 4WNCA 3KQLA 5BN3B 2BBSA 2WVAA 4KXWA 4LRUA 1J0EA 4R0NA 1P5RA 1X74A 5GOTA 2IUEA 1E6CA 1Q0ZA 2K6GA 1VRCA 1G38A 1UL1X 5CCBA 4PLTA 4CE6A 1L4EA 3G9UA 4HWGA 4RHFA 4JLJA 4XA8A 2DLNA 3ESZA 4X94A 3WGMA 3KB6A 2VBCA 4TSFA 1ZCJA 4NBRA 5BSGA 2XUHA 1DZ3A 2V65A 5DU2A 1DC8A 1F5NA 3ETHA 1T0UA 1SQFA 3ZPXA 5EAIA 4JCCA 2FX5A 4TRMA 4KW7A 1ZOOA 4I1IA 4IQ0A 4YCBA 3WGJA 4A2WA 2QMQA 2BEUA 1BCSB 1XKTA 2QW0X 4P32A 4KO4S 4DV6B 3QG1A 1J06A 4E2ZA 2Q41A 3AWDA 3LI2A 5C5CA 2JGEA 4NYMQ 4D9FA 1OI2A 2GFHA 2P7IA 3BZWA 3PDIA 4H4CA 6Q21A 4OY3A 5J9FA 1YR9A 4DSZA 1TU4A 1ONOA 1M8KA 1T4DA 4JYZA 1W47A 3ZDCA 2J0UA 4XX0A 1A8UA 4WY8A 4XEHA 3R7SA 1J6UA 1QZXA 1V7ZA 4ZYYA 3D0RA 3EB9A 3VYRB 2ZSUA 2FYTA 1ZKDA 1YKSA 5INTA 4E46A 4E6PA 4Y6GB 2UVPB 4DRXB 1BS1A 3QPAA 4KEAA 2I67A 3VSBA 1YI0A 2HRQA 4QT4A 4X8OA 2AIRA 1ZESA 3S8MA 3EZ9A 3PCXA 4C2BA 1VHTA 1A76A 1DG9A 1WY5A 4YRRA 3YASA 1C3XA 1ZPDA 4HAZA 1E2PA 1CT9A 3GZJA 3D2BA 4V0LA 3SNKA 3HA5A 4J7AA 4JXKA 1L7EA 3NDJA 5AESA 1DAEA 3AONB 3DFKA 3GMDA 5DBOA 4UOZA 2MYNA 4X0EA 1DFGA 2ON6A 1Z35A 1CQIB 2FPKA 2LVBA 2YFKA 1NNSA 4X91A 1H3FA 1AZSC 4LRXA 3EJ6A 1PL7A 4RK7A 5AJXA 4CDNA 4BO2A 4LAFA 1DKRA 3UMSA 1YMUA 3QVSA 3ZGVA 1PZFA 4Q9IA 3SBOA 1TCUA 3LY5A 3R6DA 4EAAA 4FD3A 2YN4A 3JQAD 1OWLA 3AG5A 3ZHCA 4M0EA 4NV1A 3DUFB 3KC2A 2EARA 3U4QB 1G5FA 3N0RA 2PLFA 1KIAA 5BN5A 4XWKA 1YQTA 1E4YA 4QEDA 1LX7A 2AEFA 4QE3A 3H1PA 4X20B 1Y1RA 3GLFE 1TDJA 3C16C 4G5HA 5KWIA 3HBMA 1AE1A 3S27A 4HNVA 3FCAA 1YACA 3ROEA 2XKAA 4LKRA 4AECA 3KJIA 2HMUA 4F6CA 2WILA 4M0CA 4BLRA 5KNBA 1F0YA 3L82B 3CKMA 4M60A 4KWHA 1A5BB 4AICA 1QDLB 1KJWA 4JQOA 2EKBA 3UZUA 4EY7A 1FLAA 4GRIA 4M9RA 3FR7A 1YRQA 5ICCA 2R0QC 2BM0A 4YALA 1M0TA 1VMIA 1UMBB 2XYRA 2PXAA 1TQ8A 3MMNA 3B9QA 2DQKA 1JIVA 3QX7A 4DIDA 2QY9A 2YW9A 2IF0A 5B4VA 1PR3A 2UZ1B 2QNIA 3D2LA 5AICA 4LWOA 1HDIA 1ZJ6A 2PGDA 1TUIA 2W6OA 3BXOA 1KO4A 4Z8XA 4L7VA 2BIFA 1E1QD 3VNVA 1H5QA 4WZAE 3D1VA 2DY0A 4H4DA 1S1MA 3MJEA 2I3AA 4L4ZA 2XI4A 5DW0A 1D7OA 1NXWA 1PUIA 4BX8A 3TIGA 4YUYA 1OWMA 4URHA 4C7OA 2GS9A 1ZIPA 2SHKA 4OJTA 3D3JA 3WSWA 3H2JA 1UH5A 2YDXA 3KCNA 3HVIA 3HJTA 4UHEA 5DN6A 1H3NA 1LY1A 1P4SA 2JASA 2DWQA 3QJ5A 3EWIA 4K86A 5FYQA 3TVDA 3DKKA 5BWNA 1P1CA 2SICE 3IL2A 1QCCA 2H9AA 2NO6A 4HNAB 1ONNA 4OHRA 3NHFA 1QQ6A 2GN9A 3F47A 5DX0A 2X6QA 2ZYUX 1IY9A 3JZAA 1L5ZA 2CJFA 4AIIA 4CM4B 5IKPA 1GTG1 1R0XA 3ZWMA 1OFUX 3PYLA 3KRTA 4BOYA 1AY0A 1VG0B 1Z0JA 1PT5A 2ECFA 1TF2A 2PJZA 2WJJA 4JJAA 4LCJA 4P4GA 4R8RA 4BCBA 2PAFA 2PRIA 4FK8A 5K3BA 4CHGA 3EIOA 3HUEA 1UBFA 4PCLA 2CNBA 1F1BA 4KB5A 4LOAA 4XWTA 5B1SA 3FMVA 3PXXA 4WZAB 2JLSA 3UJCA 5IJAA 4JI3B 5FL3A 5IDYA 1N3LA 3S44A 1E2BA 1NZDA 2Q49A 4NQRA 5K6AA 1Z29A 1FF9A 4GMKA 5DNDA 1N2JA 2WP0A 1NTOA 2WM8A 4C0SA 2FFAA 3J80A 2QLLA 1KZ6A 1QLJA 2J4FA 4ID9A 1CUAA 2LWIA 4JIGA 4J3NA 4CM3A 5JYEA 4DNXA 4N5HX 1UANA 1SU8A 4L4UA 2H0AA 5DPMA 3VYTB 3ZGZA 1FUUA 1L6RA 3JAWB 2ZRHA 4ME6A 3OSZA 1P4RA 2WAMA 1OH6A 1GNPA 3D81A 2V6BA 1EP9A 1RTKA 2W5UA 4TKVA 1UC8A 3MA0A 1XEXB 1FNMA 2FLKA 2NN3C 2IYAA 4FLFA 4JT4A 1SC1A 3FYHA 1DWOA 4KK4A 4GL4A 5ESXA 4G1VA 4G86A 3B2EA 3AILA 3IV9A 5TJHA 3GFPA 3GHYA 4EELA 3ROQA 5LQCA 4LA4A 4RAOA 1MOZA 4H6PA 3LT4A 5LFAA 2QE7A 4B31A 1R6VA 4ANFA 4RD2A 4EGCB 3NBUA 2I1QA 3LBIA 3H8SA 1CUXA 4D56A 3TZ6A 1T6NA 4BWVA 4HG2A 3GG9A 1DKUA 1JLLA 3HA3A 3KSMA 4ZCRA 1D7AA 3L8MA 2GZ1A 1THZA 3LBFA 4KFSA 1B00A 4Z4CA 1ZINA 3AY7A 1ITZA 1U5CA 3M1IA 4MOWA 3V48A 4DT1B 3IEPA 4CYMA 1MU0A 3LBHA 3P97A 1G19A 5A03A 2FPWA 3DEHA 3DLPX 5JCZA 4YP0A 3RRYA 3DLTA 3JVVA 4Z1MA 5E3IA 2AFIA 4J1SA 3DO6A 4EHLA 2Z1MA 3BJEA 4BRSA 5HQ3A 4QUGA 3GPDG 3CX6A 3ZVRA 4KXFB 2WUEA 1JZQA 3OT1B 2AUMA 2Y71A 1ADCA 2CY0A 1ECFA 5DRTA 4MVJI 4YRGA 3FMIA 5EMKA 4N8DA 1EXMA 2FUEA 3QLTA 3OQIB 1ACLA 3G5LA 5U4QA 1DQPA 2EW2A 3N74A 2B2CA 1Y6ZA 5E7JA 2FE4A 3LZDA 1JB9A 1VYUA 1DBPA 2QOEA 1TUBA 3DA8A 3TTVA 4QGBA 3HP4A 3LD9A 3PPYA 4HMOA 4I36A 5EUBA 1HEIA 4ASUD 4QICA 4F91B 2Y77A 4Z1OA 4G4IA 3U4GA 4WTOA 4LZOA 2I87A 4JOCA 4YP6A 2E6KA 1GNSA 2VQ3A 1X0XA 5KOHB 5AM3A 1F2UA 1V48A 5BO5A 4HEQA 4W82A 4P1ZA 1UEXC 1SBZA 3FM9A 3MJFA 4DLUA 1YD7A 5JS1A 2CJWA 4ZEVA 4LEIA 3G2HA 1OTXA 3DL2A 4LJ4A 2DTXA 4XSHA 2CFSA 3BTVA 1KQNA 3STXA 4Y6RA 3OZIA 3FYUB 4M1WA 1T5BA 1FX1A 2PAAA 3KDAA 5TGDA 2B8NA 2ZSFA 4GGPA 2O8DB 2J3KA 2AWOA 4FVTA 4JX9A 2EWWA 1JR6A 1QO0A 4EVRA 2BSXA 1IHUA 3FNHA 4Q18A 3IT3A 3M34A 1TLFA 1LW6E 4N0EA 4PX9A 3T99A 3WLPA 3NZEA 3QKSB 3VGPA 1F1JA 3RJ5A 1EGVB 1OX6A 2XYQA 5DTRA 2P2NA 4K9LA 1SA0A 5ED4A 2UZ4A 4BFLA 4DZZA 3HEAA 4E33A 2JJ1A 4PGHA 5J40A 4UQOA 4S35A 3OF2A 1EM8B 4Q3AA 3CIFA 4IF6A 3L4SO 4UUAA 2COUA 1X8JA 1QRSA 1FUKA 2XODA 3IP9A 5KTYA 4TPKA 3UT5B 5BVGB 1UKYA 2AT1A 3EXEA 4OHBA 1TYZA 4PZLA 4QYTA 3UKOA 3HR8A 5BWOA 5CA1B 4DEYA 1E9SA 3U9SA 1YZUA 4I8XA 1CEYA 5JPIA 3HACA 3WK8A 1XVTA 2AI2A 4Q9NA 3SS7X 3FKJA 4YO8A 5CA0B 2MOKA 1BHJA 3OECA 1C2TA 1DRUA 4ENQA 3TS1A 3GYGA 2R8ZA 1PF7E 4CF3A 3LLSA 2QTFA 5AI8A 3HU1A 1YS2X 2OYSA 3OTGA 1K6MA 2ZTUA 1Y1PA 5K8JB 2XUPA 4FINA 4OQLA 1QFXA 2BHTA 4CNQA 5HFNA 1V8BA 5IMBA 3MTDA 3G2MA 2QG9A 3TDKA 4ZU3A 3SJZA 4QNNA 2CDCA 4H7JA 1EFPB 3NX4A 1V45E 1TCAA 2WM9B 1Y9EA 4B80A 1D0IA 1KFEB 3AUAA 3CLTC 2HPZA 2XRZA 2IYWA 2JC3A 5E1OA 3HJUA 4YJ3F 4BDTA 5CB8A 2X0EA 1SELA 3ABQB 2Y9MB 3B89A 5H1YA 3U0VA 1MO6A 4BEBA 3ELUA 1Z0ZA 2H1LA 1IK4A 4HYEA 3BGSA 1C1XB 2WBLC 3A7EA 4ZVOA 2Q5OA 2W2QA 1XXHA 2AHOA 4CLDA 5A9SB 1Q0HA 1P5FA 1ISMA 4GT1A 4LDPA 1DC4A 2QKYA 3COWA 3W2HA 1V8ZA 1QR2A 4POAA 2C5SA 1BOOA 1PFWA 1T3LA 2R6JA 1JAZA 3OQHA 3PL1A 2CBXA 3KOMA 3ZWPA 3WNDA 2DLCX 4DQDA 4PAWA 1TJYA 3FUVA 3QU7A 4LFBB 4UVHA 2AK2A 5K7SA 4MAFA 1UBOS 1ZWKA 2F6RA 1BRMA 1OZ0A 1E0DA 1E4VA 2G5PA 2PRSA 3OEEA 4GD3Q 1S01A 5EE1A 1R0YA 5CAEB 3TZKA 1VCOA 1ORDA 1R0WA 2VXCA 3R6GA 3KZOA 5JNSA 4JD5A 2D00A 1SQSA 4BE7B 5KTRA 1N5DA 4FYPA 5K8LA 1KJJA 4FFNA 3ODPA 2BGUA 3ILVA 4F4FA 4JJEA 2VUIB 4AXXA 2R1TB 2REXB 1WIWA 221PA 2I7TA 2R1UA 2NU6A 3D3QA 2E5WA 3MUOA 4WXRA 4Y0VA 1DX4A 1YZFA 2IS2A 4MV7A 4UQLA 3TLGB 2VPTA 2PKCA 1RBYA 2ZAIA 3CCFA 1L1RA 5TE9A 1PGPA 1RWPA 3H5VA 1FFYA 1UDRA 4JI4B 1Z16A 4DZTA 1JFFB 3BHIA 3QVGB 3FYCA 5TF0A 3C70A 4OIFA 5CHEA 1ZNYA 3D6AA 8GPBA 4YTEA 1EVZA 4L51A 5G0UA 4B5KA 1KU6A 2XYGA 4TQAA 4ZQIA 3PHHA 4TMXA 5IJXA 3B1VA 2XAAA 1U9IA 1XNGA 5HA5A 2JHGA 2YY5A 1P19A 1VJRA 4B8YA 4YRMA 4A0RA 2IIPA 5I45A 4YS6A 3M4ZA 2F3RA 5KNCD 4U4AA 2ETXA 5SY9A 1QO7A 1FPMA 5F35A 3FAZA 1U9CA 5FI0B 4DBLE 3DE2X 5CH8A 4GWLA 5IN5A 3K70C 3QEJA 2IGTA 2RGGA 2AKYA 4R54A 2DPYA 1MZVA 2JPDA 1H2EA 2QIOA 4XQEA 4BNWA 4Q9DA 4D9MA 3KE9A 4DV1B 2O2HA 3B20A 3LO5A 3GEIA 3LQYA 4PYIA 1G8YA 3Q7EA 1XCPA 4NAHA 4CWAA 1RE0A 1Y80A 2BFEB 2G17A 3EF0A 1P7WA 1JDZA 1K98A 1UOOA 3EMDA 1TT7A 3GVHA 2QX8A 4QYIA 3NEJA 5SZJA 3WLNA 5BW4A 5IXSA 2H4YA 3AQ4A 2FPMA 4TZKA 5IT5A 1MW8X 1QKKA 1T26A 5JAHA 2JKZA 4BO5A 3PC3A 2B69A 1CFJA 5C34B 2ZZNA 2IZ1A 4GPAA 1PYOA 1OR8A 3BRSA 2JGAA 2ZBGA 5K3SA 3HA7A 2PX3A 4QYSA 1JB1A 5IVDA 2XBLA 1DQSA 1Q0PA 3UAGA 5HWSA 5EMLA 3KKMA 1JQKA 3ELWA 3EBLA 1Y5MA 4MUYA 4YI3A 1XLVA 4V1CI 2QN7A 4JXXA 3ZU5A 3KJFA 3ZXYA 3C6QA 2WJPA 1OGJA 2HX1A 2QYOA 3H2IA 3KXPA 5AVJA 3D1JA 4UD2A 4BN5A 4F1WA 2C96A 2YZMA 1P29A 3DL4A 3SYMA 1N1MA 2R79A 3N39C 1MG5A 2G70A 3PUJA 5ANRB 2JA2A 3RB8A 2LKCA 2BBWA 2WINI 1U3GA 4KWIA 3VUFA 2FJ0A 3C24A 2X86A 5CT6A 5SZKB 4ZI2A 1D8TA 2HLDD 4MR7B 4QC2A 1FXUA 3OFNA 2QRVA 5K1ZA 2GARA 2GEFA 2GYYA 3IPAA 2ODNA 4D92A 4HXFB 3L0SA 2YWBA 3BE8A 4JCOA 2GK6A 1KFCB 4KR0A 2VHXA 3KTOA 3ADCA 1X8XA 3C14C 1XEFA 4L7QA 5AKLA 4PBRA 1GNRA 2PS9A 3NS7A 2P9YA 1CZRA 3LVBA 1ZJZA 1GRVA 2FFBA 3H8JA 4PLHA 5H7XA 3ETDA 4TN1A 4E21A 2FUCA 2Y1XA 2OEPA 3AEQA 4RJTA 3LUPA 4BVKA 4QBHA 3SC2A 4BHTA 5K99A 3VVLA 4ACAA 3L7YA 3NIGB 5F9MA 1R3UA 2PQ0A 5TS2A 2Q0XA 4ZICA 2YXNA 3U9LA 3HJGA 4Q01A 3A4LA 4M1KA 5CLGA 3RQSA 4CKBB 5KJFA 1MJNA 3OIUA 1TLLA 3OEHD 4KQIA 3STHA 5LPNA 1FIUA 3N0WA 5DXJA 1RMYA 5AKEA 2NO0A 1C8BA 2H1HA 4KE9A 3NHMA 1LV8A 4DIEA 2CXOA 8ABPA 1EG2A 4DYHA 5FJIA 3SD7A 1DPFA 4D82A 4GPZA 2EX4A 2VK4A 3ESYA 1DXOA 2A9JA 2EZ9A 3P5BA 4GOXA 1E5LA 2VOEA 1XU7A 4KAFA 4WW0A 5F2EA 2ET6A 2GD0A 5YASA 4BVAA 4EY4A 2DB3A 1GZ3A 2CT8A 1UXGA 2UYGA 4ALLA 1TCVA 5G2OA 5DWQA 3K09A 4I5IA 4DM3A 7ADHA 5HP4A 5K3AA 1P4JA 1Y9DA 1EWRA 1VJ5A 4FWIB 3EXAA 4HOYA 3BSYA 5DNEA 5DM1A 4ODIA 1BVRA 4EAQA 4IFEA 5CXSA 4M7RA 4BNHA 1JIIA 2FW6A 2BMDA 4OXIA 2FRXA 2QI9C 1RADA 1J2EA 4BNNA 1N0IA 3U60B 1GKIA 4QEZA 5P21A 4R8SA 3ORYA 2OCAA 1IHXA 1TEXA 3I9LA 4DMRA 5ELLA 4EYQA 5AI5A 1XA4A 3IMGA 2BZ0A 4BASA 2E89A 3UAYA 3HXMA 1MOQA 3NKFA 5JXWA 4YJGB 1ULZA 2WJ4A 3RIEA 4IRUB 4FWTA 3IP8A 1PL0A 3DZIA 4ETIA 2I54A 2GZMA 1LQ2A 3H19A 2D1RA 1ECJA 4K2HA 2Q3EA 4HYYA 3ZTTA 1QORA 2B4TO 2HL6A 4X20A 3LV8A 1PR0A 3DGEC 2OBFA 1FDRA 1EHIA 1GG2A 2ECPA 1IG3A 5DGXA 5HKLA 1K3TA 1YXMA 3OPNA 1WB5A 3I6ZA 1BE1A 1QS0B 2R5WA 1PNRA 3C8MA 3T1NA 1FMFA 4UBKA 3TR6A 1ZVVA 2TRSB 1R6BX 2I34A 1LPMA 2TS1A 2Q3HA 3VZBA 3ZW7A 1EJ0A 3IIMA 1X19A 3FIJA 3ZBTA 1GNVA 2INGX 5EJ6A 3R6TA 1PDVA 4FNMA 4V3CA 3TR5A 1PT7A 3HZHA 1DHRA 4C7JA 2OD9A 1KPIA 8OHMA 3QE9Y 3OTWA 1SKYB 2CNKA 4HTFA 4HDKA 5ALFA 3EX7C 1YQQA 3CPSA 2LZ0A 1UAGA 5HIAA 4XGQA 3STYA 3GLFA 1RRKA 1ONBA 2IC5A 4H31A 3AESA 3SDBA 4E7OA 2YY6A 3A3OA 1ZSNA 2QTZA 1H2YA 3QI7A 4MW6A 2CVQA 5EMHA 5KKAA 3PQ6A 3EGEA 3OIFA 4DIOA 3IT0A 2ID7A 2Q8QA 1PLKA 3HUFA 4EITA 4QKQA 3NHLA 1T10A 2VDKB 1SWWA 2E4ZA 3VKWA 1U2SA 2AA3A 5FD8A 2DQYA 4NE7A 3N2GA 4PFKA 3MAGA 2C0PA 2H11A 2W8BA 1GARA 3BWDD 1P7ZA 4MGZR 2EJCA 2M9MA 5G40A 5EZYB 1SR8A 4OFXA 4Q47A 2Q0HA 1E2MA 1B0AA 1YDFA 5JR3A 5GZ1A 2FMKA 5AT1A 3PNOA 3N2LA 3SIXA 1QK4A 2ERXA 2J6BA 4RVSA 2IEBA 1CEEA 3MJSA 1SM4A 1R5BA 1XF9A 4MW7A 5AW3A 3ZHRA 1F2TB 2GTHA 4GPTA 4J6EA 3JWPA 5KTTA 4FKBA 4Y0AA 3IVCA 2VKQA 5H3HA 5HCNA 3SBDA 4RLSA 4CR8A 4U1RA 2G08A 2J3JA 2PY6A 1CQXA 3NIBA 3RU2A 3VPDA 3DQPA 2NZ2A 2GZRA 3OWOA 1DBQA 3OEED 2FEPA 3A3PA 4YRLA 3A6ZA 1KO1A 2YIMA 3H86A 4E3ZA 4POOA 2G1UA 3E7FA 2CJYA 4UAJA 1LS1A 1PJ2A 3PXGA 1JEAA 4IXTA 3MERA 4H1HA 4Z9XA 4N6OA 3PHGA 2JCGA 4YDRA 3R8CA 4KXUA 2FH5B 1L5KA 4TMTA 4DVJA 2J09A 4KH0A 5GIPE 3F6YA 3GAMA 2A58A 2FNAA 3ZWVA 3S81A 3PD0A 3EFBA 4HF7A 4KRXA 5G4KB 2NO1A 2YINC 4IXNA 1SK8A 4GICA 2EX0A 1NBMD 3MW8A 4BYGA 2OV8A 1NI4A 3IDZA 3QTLA 5B2FA 2ZGVA 1VM6A 3NJ8A 2X0KA 3B1JA 1AKWA 4UCQA 1F8GA 5D3MB 4NZNA 1D6NA 4PLCA 5FXMA 3BFPA 4ZJZA 1V8PA 5DLQC 1U9IC 1ZEMA 4URFA 1T1EA 3RT9A 1UK8A 1IAQA 3I04A 1J0AA 3PBKA 4ZCLA 2WA2A 1JGTA 3KIPA 3GPCA 1IXZA 1ZM3A 5D3ZA 5LZ8A 3WQRA 1SVKA 3S28A 4F2PA 3C2QA 1AC5A 3HKBA 4CM5A 2C7RA 4JI2B 4R7GA 1MTZA 2PUAA 1JG6A 1FLNA 1NIJA 2P8SA 4HY3A 5JYCA 2I66A 4MYRA 2L82A 1B7GO 3IEXA 3UB3A 4ZTZB 3VPCA 5IJ0B 3QLJA 1X7YA 2R11A 3N86A 2NVBA 3M0EA 1P74A 3JD2A 4REMA 1P1BA 3SLRA 2XGGA 4TRNA 3W34A 5K01A 4HDSA 2WABA 3HXPA 4WT7A 4ALIA 1NBEA 4RWEA 4JA0A 3ANXA 3SE7A 5CTJA 1GV0A 1JV2B 1FJHA 2L69A 2NSYA 2GYUA 1KMHA 2JFQA 1J0XO 4ATNA 3HB9A 1SBQA 2AXPA 4WMLA 4FFBB 5DLEA 4ZU6X 2IHBA 3DVQX 2CD7A 4UQPA 5FI1B 2DC1A 3CUVA 4DE5A 2GK3A 2YZKA 3FGNA 3SE0A 4LJ5A 2NU7B 1X13A 2FR8A 3NJ4A 4DSAA 4XWGA 1T9HA 3T38A 1B6TA 4UPEA 3MBKA 4HZIA 5EXTA 1PJSA 1JG2A 3UGJA 3QELA 4IPTA 3Q9SA 3DZDA 4QQKA 1E77A 1E89A 4S1WA 2BFBB 5BYJA 3WLRA 4E5NA 1LV7A 1S02A 3O2NA 1VJ1A 3P96A 4N0DA 3TO5A 3KPWA 3WMWA 5EJ2A 1T9GS 3ZNOA 2F3UA 1N9ZA 3SOPA 3AEYA 1A5TA 1HQDA 2EFHB 1F0PA 1I3LA 4BO6A 1EE1A 5IDWA 4QDZA 4MYHA 5ALYA 5EUCA 1Q17A 3I6BA 4TLAA 3DWFA 4HMPA 1XDBA 2GJAA 3WRYC 5FOSA 5JS6A 5B3JA 1JI3A 1MGOA 1VFNA 3MYRA 1PYGA 2XDYA 4LQCA 2JANA 3S2EA 4CM9A 4Y2UA 4ZZIA 4Q3CA 2AOVA 2Y92A 4GW3A 5EIBD 4FX5A 5EMMA 3GRCA 4ARUA 4EY5A 1FA9A 4JH0A 1XVUA 3HVKA 4WY2A 4EYOA 2NTNA 1JR2A 2R9VA 5K6TA 3LNTA 2D3TA 4GVPA 3HLTA 2ZVDA 2FP3A 3JWEA 1V5WA 2CLEB 4I4TA 5B5SA 1Y4AE 3WYAA 1XWWA 1XZEA 5P8WA 4EK9A 3T1HB 5I4KA 5MF6A 2GCPA 3LDUA 3BTSA 3G0IA 1RKBA 2Q2NA 3B82A 3K6SA 3EXEB 3SGLA 2VAWA 4DDKA 2X9QA 1I3KA 2WJIA 5DW3A 3NXSA 4MICA 2R7AA 1NVFA 4ZVLA 3V6MA 2HA7A 1YUNA 1HT1E 3I2IA 4NJOA 4MVJA 2GAIA 4LN1A 1UKAA 2O5RA 5DTEA 3TZQA 4MVYA 1B2RA 1IPEA 2B37A 3GJ6A 4GHWA 4HVLA 3VAZA 1CUWA 3CF0A 3QVMA 2DFKB 3DMFA 5B53A 3R3YA 3S4YA 4BB5A 4B3JA 1Y8ZA 1XLUA 2PL5A 2Q28A 5EZQA 2GQ0A 3HDVA 3QVKA 2NVWA 1H42A 5KYXA 4C0JA 2CEAA 2FWJA 4XUCA 2HF7A 2Q3CA 3LWNA 2CB9A 2P3LA 3NCHA 4ZPXA 1YFJA 3FH0A 2QJWA 3AIOA 2JIDA 1DG3A 4IINA 2OCBA 2AMJA 1IY2A 4E4RA 2GEKA 2GJ9A 2BONA 1E3EA 1JDUA 1F0KA 2VPIA 3PFWO 4ON9A 3VSCA 5FWXB 4AQ7A 4EW6A 1LCIA 2IUUA 4WV3A 3EOZA 3VDNB 1U3WA 4XTCS 2DTEA 4MMYB 3ZWOA 3BBPA 1MA3A 3T4XA 5KVCA 3UUEA 3N8DA 1Q14A 3KU4A 5AKJA 3WA7A 2ODAA 3TRJA 4NMMA 4UASA 3KP1A 2LKDA 2OC4A 3SQLA 4WZBE 1KRHA 4G97A 1WVMA 4OP1A 1GR0A 4RDIA 3LK6A 5KCMA 5LNK6 1I5OA 1Z6YA 4U5XA 4EPRA 3CKKA 2WAYA 5CD1A 1PUXA 1OIXA 2J6IA 3K4QA 2HPHA 1P0QA 2V9ZA 3L0YA 4YMLA 1SZJG 3DWIA 4ND3A 5LU8A 5L3SA 2VDPB 1T8WA 2DBZA 3I83A 4TT3D 5CVUA 3DL0A 3KQPA 4PFSA 3M89A 4WECA 3SU8A 3PENA 4M8LA 1ZGHA 5E6RB 4JFAA 1ZITA 3KTDA 4AZVA 4BB9A 2EHJA 2GAJA 3KXIA 3LYHA 1OASA 2NO5A 5IJ9A 3WKEA 2OBNA 3MGBA 2AOTA 2JVIA 4JXJA 4CM4A 4DABA 1QVRA 3RK0A 1Q44A 3OD1A 1QYRA 1NYRA 1SC9A 3IB6A 2CXSA 3MAJA 1Y3AA 3NEPX 4L0MA 4RH0A 3TXYA 4GPEA 4CLEA 2B1QA 1GKYA 1Z5ZA 2QM7A 3AIIA 3C3WA 2QAGC 5FF9A 4HMQA 4K9SA 2CFIA 4TL6A 2JGKA 4MDEA 1KKLA 5MFPA 2H00A 4JS0A 3FWPA 5B37A 1RLJA 3ZQ6A 2ADMA 4DCJA 3D8TA 2XTNA 4BV9A 3IQIX 3UV6A 3NNNA 1W34A 4RTQA 2C98A 2QXYA 3IMEA 5CH3A 4KVFA 4AZWA 4YFVA 2PGJA 4TXJA 2O8BA 3PPVA 1MRSA 3DFMA 1G21E 4DIUA 1AO0A 2HMYB 1OB2A 5T3UA 3ZDXB 3LUHA 1AGPA 4LGMA 3ICWA 4KP7A 4UHBA 5BN3A 1QBGA 2O2XA 2C4WA 1YWGO 1UEIA 1R8JA 3I28A 4PICA 1NMXA 4R9NA 8ATCA 2QI9F 2XB6A 3FCUB 3GN2A 2II6A 2FXVA 3TB4A 1MJGM 3AVUA 4E2YA 1W0JA 3E23A 3IKVA 1AGRA 2EZTA 2L0XA 1DIAA 2YV1A 4RD3A 1P1JA 1PJ4A 2HJRA 4MCJA 1P3JA 3C39A 5EZ5A 3WI7A 3HKDB 3OKCA 1M7HA 3Q40A 4IDGA 1RQ7A 4BLTA 1J0DA 1P9NA 4HWOA 2OHVA 2CHQA 2R3SA 1QQTA 4P3XA 1EFVA 3VC7A 4XQ0A 2EDAA 3IQEA 3U3MA 4D8YA 4BBPA 5KOYA 4OLJA 5A3QA 4LHZA 1RI3A 1XB2A 2FF7A 2HPVA 1VG1A 3HLYA 4P7BA 1EFKA 3THOA 3O8RA 2OAEA 4TL9A 1GUDA 4I1SA 4KCGA 5F3DA 4O4LB 4JT9A 5E95A 1LQUA 3ZY6A 2FXIA 3ZQKA 1V5GA 4Y2QA 1GD1O 3E9CA 5JYBA 2JBHA 2YS7A 3ANMA 3IEUA 1IJFA 1UPTA 5EFZA 4CIVA 3KFXA 4WHMA 3AR9A 1XL0A 3KEMA 3MUNA 4E70A 1OQAA 2O2JA 2PZJA 1IB6A 2OCDA 4WADA 1A3CA 4J1NA 3GMSA 4J16A 1YS4A 1D5WA 1GWNA 4MQEA 1OGIA 2JGDA 5AVUA 1LPBB 2YJ3A 3GUZA 3JQPA 1U04A 4D41A 4IWNA 1N2IA 2GO1A 1L9XA 1RLIA 1W75A 3R7NA 2XB4A 3IRUA 5JAZA 1K9SA 3QP9A 3W6ZA 1GZ6A 1NVVR 3QOWA 4ZAYA 5HF9A 2B94A 3NU1A 4OHZA 4B40A 5AHOA 2G5CA 4F2GA 1JI0A 1U2GC 1KEEA 1DEXA 2X8WA 2JLQA 1EYZA 1IH8A 1WUIS 4D8WA 2I76A 4KN9S 5C53B 3FRIA 2WWVD 3GHHA 1O9HA 1TUBB 2Q2VA 2Z3ZA 4GYJA 2FE1A 4JP2A 3UH1A 4N5DA 3NGLA 5HJ2A 1JEYA 3DBOB 4OSPA 1ZL0A 3MTBA 4DRYA 4G41A 1TD1A 1GTVA 1VKRA 1S2NA 3GLHA 4CMJA 1KYVA 5IULC 3CPHA 1OYWA 1R3DA 1OX5A 4XB1A 1J1IA 1V3QE 1JHVA 3CZQA 4IFIA 5JSQA 4A36A 4RESA 4XX0B 5F3RA 1DDGA 3FLMA 5ALJA 3IP1A 5TPZA 2IOFA 5JE8A 1GZ4A 1Y37A 2BKEA 3ICPA 3TCNA 3CRMA 5HMLA 1HSOA 3W05A 3FVTA 4C14A 2ECQA 3H1EA 4HQRA 1KEUA 3UENA 4ZVMA 1GLGA 3F9IA 4P3NA 5BN1A 3AERA 1W581 2QMEA 5CGQB 4KQMA 3FUTA 3G6KA 2WFMA 5HUQA 3JXEA 1XGKA 3PD7A 4BO3A 1DWPA 1QXSA 3EDMA 3ROFA 1HTWA 2XITA 2ZJ8A 2OXCA 1NAHA 2VPZA 3TD6A 2C4NA 2XCSB 1L4FA 1YVEI 3TD9A 3IGFA 3EVDA 3WL5A 1X8LA 2QAGB 2Q62A 2GEUA 4QRHA 1PJ3A 1YZNA 1PEKE 2OP0A 4QJ4A 1TQ2A 4E2XA 1K2WA 2IXDA 4C6RA 2LE0A 1DLIA 1FBNA 5DYWA 3KPJA 5C5EA 2BF4A 1KQOA 1EK0A 4II3A 1EWVA 1JBKA 1QK5A 3LVFO 5EYPA 3JR7A 1SUEA 1DELA 1XCBA 5HBRA 4JLOA 1TX4B 2R96A 3WGNA 2X77A 3QPUA 3UFBA 1KO5A 2PIAA 4C4AA 4OXXA 1GIAA 4MEJA 4QUIA 1X87A 2ZB2A 1QZTA 2BHSA 3FTCA 3DHWC 3ZHSA 5A9SA 3SKXA 4KQ6A 3W4KA 1PQYA 1LQTA 2AI3A 4URYR 1SQ5A 2F90A 2N3ZA 3QH4A 3CUTA 4GMDA 3UK6A 4F84A 5CDUA 2A1IA 1IRIA 2E4AA 4NU0A 3PNQA 1TJ5A 3GVPA 3UGKA 3NNDA 2WKPA 5KYTA 2FN8A 1YQWA 1CJVC 3D6UA 3O4GA 4XD7A 3ETJA 3TLJA 1X2EA 4NH0A 3ZD6A 5AW4A 3O8BA 3KALA 4ZFNA 2C59A 3I9MA 4M9ZA 3T61A 2VUSA 2BKXA 2ASVA 2VNSA 4LV5B 4EUFA 2O0MA 1I7QB 2IPXA 1HETA 3HPQA 1YIOA 1MIOA 1ZC3A 1BN6A 1ZSYA 1NKTA 2B8EA 2EBHX 2MT9A 3L2OB 3T5BA 1RZ3A 2O23A 2EATA 4E1BA 1DJPA 3K8OE 2BV3A 2Q4BA 2I1VB 3I9KA 1KI8A 2J7PA 4GMFA 3TW6A 1TCCA 4NX2A 4JL5A 2O0KA 3KJQA 4I4IA 4Q5IA 3ZBPA 2FPIA 1EIZA 3BYZA 4S3MA 4OI0A 2DBYA 1GL6A 1GAQA 2QZZA 3EVGA 1JPJA 4EW1A 1LC0A 4LSZA 3RTDA 2ZUUA 5JPDA 3U44B 1PS8A 2KS6A 1YHZA 4RO0A 4WJZA 3RGWS 1GUZA 1I4TD 1EB8A 4QLAA 4PYJA 4Y9RA 3ZHUA 5KYWB 4I3FA 4ZRDA 4KTVE 4L8LA 4ZI7B 1WLYA 1RHQA 1M2GA 2NSDA 3MS4A 4CIAA 1T0HB 3F2IA 3CWCA 1I01A 1M6YA 2XOEA 1U1EA 4Y2XA 2JKYA 3HBJA 3K16A 2C9DA 5EJGA 4DRZA 1FTWA 3CLTD 2QSYA 5AYVA 3VR1A 4XVUA 2EBWA 5JLJA 5JCOC 3A2NA 3P9YA 1MJHA 1Z4QA 3UQZA 2W2OA 2VDVE 1XWIA 2ADOA 2QQFA 4DPMA 1OVGA 1WZCA 1MHPA 3B38A 4JL8A 3GJZA 1V3TA 4CKZA 4D99A 1JMYA 4MV9A 3O6VA 4XRGA 4Z3KA 4UEQA 2FQWA 1A2QA 1LPOA 3K96A 3QK7A 4E11A 5FBVB 1APBA 2W0MA 4EUHA 2W2TA 1ZJJA 2EG9A 2F64A 3BX1A 3KK0A 3L6UA 4OO3A 2CV0A 4HX2A 3T3IA 4C0WA 2W00A 2GYVA 3P9RA 2ATVA 2GO7A 4LX0A 3D6HA 2VSFA 1JHUA 4Q9AA 3TOSA 4AN0A 4OREX 2XPCA 1TL7C 3F2VA 1Z88A 4C22A 1PRYA 3VOSA 4LE0A 3H9GA 4W8OA 1C9MA 1E98A 4JLPA 5DB4A 1V2GA 1WXQA 3VSEA 1BCRA 1QCDA 4KU4A 4H7HA 2ZSKA 2CLHB 5JAOA 1VHJA 4JQYA 5C80A 3DPUA 2VHWA 4AU1A 3HRKA 4UDXX 2V98A 4FYVA 1ZH0A 4YWHA 5G0WA 3RLFA 1LK0A 3AL3A 5HW0A 3E5HA 5LD2C 3DW3X 2X22A 1FQKA 1T3TA 2Z43A 4OMFG 5DYGA 3GT0A 5AH0A 4F71A 3RIMA 1UWCA 1YZHA 4Q9HA 3GIDA 2A0FA 4KITB 2BTQA 3FHTA 3RAGA 3I64A 3MMXA 5LQAA 3THYA 1K88A 3KZKA 3RUFA 1DQRA 1TYDE 4M0KA 5EE0A 3PX7A 1GOTA 1UINA 5JCPA 1F17A 1TVCA 4QGSA 4A0SA 3RYFB 4FMDF 1E2HA 5DNCA 1OXSC 4RPIA 5A5VA 1L4MA 3ZIDA 4FHDA 4PLFA 2V4ZA 2JFXA 4O4JA 4TWIA 3FTEA 2WHEA 3NUGA 4H27A 6ADHA 1H6DA 2ZWAA 1P72A 1GXSB 1Q5PA 3ZD7A 3RKUA 1GUBA 1IMJA 2ZIGA 4F86A 2YL2A 4W5NA 1EAMA 3CRZA 4HQOA 1E7RA 4E4TA 1DKQA 1TJ3A 4QTYA 4FJ1A 1PWEA 2HREA 1L5SA 4FYMA 4RH1A 2JLXA 3MWKA 1ZR2A 1DV2A 3PRKE 5C31A 1ZD1A 3WWOA 2JBAB 2QM8A 1FPQA 3VO1A 4CI0B 5TMPA 1NFFA 2OGZA 3GJ0A 3H1GA 2X2PA 4V3BA 1QGUA 2GVZC 3KNZA 3QF4A 4Q1AA 1CUZA 3EFOA 4NZMA 4UHKA 5B2EA 1Y6GA 1F60A 1M2EA 4KX3A 5EIOA 4B4WA 4GOND 5ITZA 3RVDA 2XHZA 2PUFA 1Q22A 1T2EA 1VSVA 2A1TS 4OVKA 4N5LA 4Y8VA 4B33A 2JHPA 3AUTA 4B3XA 1CUIA 1A98A 4BVEA 4PSAA 2QRVB 3EDRA 2Z58A 1R2QA 4H17A 1GRRA 4J9VA 4L5IA 2BFFB 3N3AC 4R2XA 1E18A 5D7NA 3VMMA 1S2GA 5LBIA 3T3DA 1X1BA 4AD8A 5ALIA 4CIXA 2WE8A 4KR2A 2NZUG 1H3EA 2ZYSA 4IICA 4X63A 3N8IA 4XVRA 5AW5A 5LWHA 4JI0B 2PYIA 1A0OA 2UVQA 3Q9UA 2EFEB 5EKXA 5FI5A 3RS4A 1RBMA 5DBHX 5CJ2A 2A5LA 5T67A 4C29A 4Z4EA 1E3SA 1P5JA 4HFMA 2IYPA 1HT2E 2DBQA 1LX6A 1EUDA 1F2UB 2ASEA 1XK7A 2WZCA 1TYBE 3GLKA 1HK7A 1KJIA 4MCAA 2MCFA 3EA5A 1Y98A 4KSYA 4BZQA 1ZWLA 3H7IA 3LCRA 3X1YA 4A26A 2WWGA 3DOFA 4D4LA 3EXFA 3U0BA 2V1XA 4KE7A 1LZLA 3DONA 3VPHA 5LQNA 1QLWA 3I4FA 4BNMA 4UARA 3R7FA 2WWTA 5I48A 3OQNA 1NW5A 1C50A 4FN5A 4UZEA 4WX2B 4NARA 2JNWA 5AK3A 2XGOA 2RGNC 3IJPA 2ZU6A 3WB1A 5AQ1A 1KWKA 4L8GA 4QODA 1M8FA 2DJ5A 3KKKA 3UCXA 3N0TA 4KUGA 4UXHA 2VH1A 3FNIA 1PHPA 2FMXA 5FHQA 3UMCA 5HZHA 1JJBA 3RK4A 2OG2A 4HDAA 4YRTA 3F6CA 3W9UA 1ZONA 5FOXA 3UY4A 2NTVA 2H1WA 3EGWA 4LDZA 3L0PA 4REQB 4C05A 3RODA 4NG5A 4H3SA 1Z4IA 1OKKD 1QFSA 3I6IA 3GG2A 2HHJA 3HS3A 3A2LA 1QO0D 1XLTC 4JLUA 4Y1GA 2IQ5A 1XRNA 3KOUA 4MQLA 4CTOA 2HIMA 2C4MA 5CK4A 5K3DA 3I76A 2CB0A 4XIFA 2VHYA 1KIMA 2HMSA 2AR9A 1S4MA 4YMHA 2PFKA 3WGIA 1X86B 3GJ3A 1E94E 4LDRA 4TM8A 1XRMA 1NN5A 3FYUA 3O8QB 1ZAYA 2GZDA 4L4SA 4OHCA 3DKRA 2XUDA 1Q3TA 4HWTA 1YCFA 3OLVA 4IJWA 4LJ7A 3L49A 2O7VA 4MR8A 1WCWA 4B35A 5HRUA 4KVZA 1YZGA 1U8UA 3G8AA 1NXTA 4EJSB 4J4TA 2VG8A 4C7BA 4GSYA 3QFTA 4L6IA 4WASA 3WMGA 4QDJA 1NW6A 1Q7CA 3TNFA 1WMDA 10MHA 3ICOA 5GAJA 2F9MA 4S2EA 4HH3C 4RHXA 4J7UA 1UR5A 2VI5A 2H2GA 4QPNA 3ADBA 3LC0A 4WLOA 2IEDA 1BU8A 1KJYA 4JC0A 2X4DA 3W9SA 4ENTA 5I4BA 5ILOA 4DSUA