4OZHA

S16 protein complex
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
181
structure length
181
Chain Sequence
IVADHVASYGVNLYQSYGPSGQYTHEFDGDEQFYVDLGRKETVWCLPVLRQFRFDPQFALTNIAVLKHNLNSLIKRSNSTAATNEVPEVTVFSKSPVTLGQPNILICLVDNIFPPVVNITWLSNGHSVTEGVSETSFLSKSDHSFFKISYLTLLPSAEESYDCKVEHWGLDKPLLKHWEPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title T-cell receptor recognition of HLA-DQ2-gliadin complexes associated with celiac disease.
pubmed doi rcsb
molecule keywords HLA class II histocompatibility antigen, DQ alpha 1 chain
molecule tags Immune system
source organism Homo sapiens
total genus 40
structure length 181
sequence length 181
chains with identical sequence C
ec nomenclature
pdb deposition date 2014-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00993 MHC_II_alpha Class II histocompatibility antigen, alpha domain
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ozhA02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 4ozhA01
4BZ1H 1YDPB 4CDHA 3QNXB 1F2XK 3QIWD 2V2XA 4M61B 4YHZL 5FYJE 2K7QA 3MLTA 2VABA 3MREB 4NPYB 3RVUC 2HT4D 3MV9D 2BNRE 3OKEB 3VFMB 3T77A 1F11A 4N8PA 1X5AA 5CJ8A 4JN2A 2HFFA 2WBKA 2ZUWA 4NN5C 5EUOE 4U3XA 3C8DA 3LSOA 1CDIA 1CDGA 4D0CB 1FYTE 1NGZB 1DVFD 4MDJB 3LRSA 2YRZA 5FK9B 2AI0H 2IFFH 3HI1A 4JFXA 3ME0A 3RPIA 4EVNA 4NQDA 3CX5K 4OQ1A 2A1WH 2Y5TB 2XFXA 2AK4A 5JR1H 4L5FL 5IIEB 4TTDC 2CLRB 2YD5A 1WWWX 4JRXD 5FOBA 5L8JB 4M3JA 1FPTH 5EB9A 4HMCA 4NCC2 4LIQE 4NC1E 1AQDA 4MB3A 3TA3C 5JW3H 5FUCE 1FGVL 1AKJA 1TCRA 1WQVT 1ZGLB 4OV5A 5I73B 4P4KD 3MRJA 3T1WA 1A7BA 3EO9H 3X14B 4R4NC 3HKFA 3R0MA 3L6FB 1BIHA 3NFSL 3H9ZA 4RX4A 1I1AD 5KSUB 2OL3L 5D7JC 3CZJA 5J11C 2CLVA 3QIUD 4WFGE 1LO2H 4YEEA 1N6VA 4W6WB 1ACYH 5I18L 3GK8H 4MNGE 1IQDA 5JMOC 5CWSA 4Y5YB 4DAGL 3QFJA 4LSVH 5CGTA 1N8ZB 1MHEB 3U6RA 3L3HB 5I66B 3ARUA 1A7PH 4J3VA 3WL9A 1I7UA 1EEZA 1OAUH 2EDFA 1AC6A 3BPOB 5GS0D 3DI3B 3FB6A 3LDBC 4XBEH 1UJ3C 4FQCL 4LOUD 1AC0A 3S3PA 2HH0H 1DBBL 4JO4H 3MZTA 3EHBC 2D7QA 43C9B 3TZVC 1B90A 2GYSA 4OF6A 3I6LE 5CJ5A 1A2YA 1I9RL 2BSSB 2HJKA 4JDTH 5GS3A 1S9YB 5HYEA 1T1YA 3L5HA 5TQ0L 4GBXD 5JOEA 4DOHB 4LP5A 1CS6A 3HMXL 5GSVA 3ZYJA 4PJHB 4K8RD 4M48L 2GJ6A 4UB0H 2P42B 3HPJB 4NQSA 5JOFA 5DVLA 5DJXA 1XR8B 2IMMA 3SBWA 5IB2B 1HHHA 1TETH 3NIDF 4E42A 1RD6A 4NGHL 2KZ1B 1DQMH 2EE2A 2YD2A 4JFZL 3AB0C 4EJ1C 1CFTA 2BVEA 3JV5A 3X3GH 4JPKL 4XNZB 3LQMA 3CFEB 3IF1A 5L6YH 1CXKA 1DN0A 4FXGB 8CGTA 4KKCC 3OGOE 5I1CH 1JHKL 4UV4H 5E5UB 2XOTA 3ULUD 4Z77A 3UTSB 5F93C 2N7AA 4AMKH 3UJJH 1A7RL 3B4NA 4NNPL 3RA7L 5I1GL 1QZ1A 3E8UH 5I8KH 5HYSB 4JFHE 1T22A 4PJDF 5IEHB 1EHLH 2YK1H 3OKMB 5MERA 1FORL 2IH1B 4NRYA 4I8DA 1MREL 3X3FL 5A40E 2X9XA 3MTRA 3VMOA 3H42H 5F89B 2AV1B 2Z93A 4NQEE 4UIMB 4YXKL 2YPKA 4G8EB 3ROOB 3DUSB 2DQIL 3BQUC 4YNYB 5DJ2B 4PGBB 1A4KB 4J4PC 2DMKA 3LKRA 3ARBA 1DBML 3NIGF 3O8XA 3QUMH 5CILH 1S7TB 3CFDB 5E00B 4MAYA 4JJHA 4ZQKB 2IPTL 1I7TA 1KN2H 5F9OL 1U2HA 3TBYB 2FD6H 4UT6L 2H41A 5LBSL 5CGYD 3QYCA 3WIIL 3EYFB 2HVJB 3MROB 1L9NA 1NCAH 4KXZI 4RWYL 4N0CD 1OTUC 4HMEA 1DQTA 3QWQB 3VXMA 2ADIA 2F19L 3O2VL 4Y16D 3N1PC 3IS0X 1BEYL 2R2CA 4ZPTA 4Q0XL 3RY4A 3M17B 4P99A 3EFFA 5A2LH 4BJLA 2OR9H 2GW5A 3DHMA 2YEZB 3MJ8B 4N9OB 2R2HA 2NY5H 4Y1AD 1CDHA 4QEGA 2DKUA 1YN6A 3FMGH 2EYSA 3NBNA 4PJAA 5K9OB 2FH8A 3L3DB 1R3KA 1AD0B 1N5YL 2UV3A 1IGJA 3LH2H 3H9HA 5DD5H 1RU9L 4FQLH 4ZNCD 1VCAA 1MIML 1UWEL 2RFXA 4X4YA 4QRRE 4ZFFA 1PZ5B 4G6FD 4LSDA 4HUVA 2GAZB 2BC4B 4GAYA 4NCC1 4P48A 3D25B 3KPSB 1I3RA 2VLKA 3WD5H 5IHZB 3LD8B 2CIKB 5FUOL 4G6MH 3SKOA 3UBXB 1U8KB 1MFEL 4JFEA 1JZ2A 2JCCA 3DBXB 4UILL 4Z76A 5IW6B 3F12B 3O6FA 4UQ3A 2LABA 1R5VA 2J8UE 4BZ2L 3ECBA 2NY7L 1JGUL 3EKCA 3D9AL 5F7UA 1WWCA 1RK1A 1OP9A 4UTBH 1HZHH 5D5MF 3QEQB 4NM8L 2MJWA 4ALAL 2A6DA 5CEXB 3SDXB 3DXAB 3EOTH 4GRLC 3INUL 2EDEA 3F62A 1YUHB 3GMMA 4PJ7B 3QFDA 4PV8A 15C8L 2XWTA 4PUBH 3BIKB 3THML 4QY8A 1LE9A 1KBGL 4ZYKB 2WZPD 1YY9C 3IDNA 4OGYL 3GSXA 1D5XB 3P4LA 1VFUA 4ETYA 4IOIB 1JMXA 5E24E 1DBKL 5FKAB 5HGGS 3TPKA 5EC2A 4BQ6A 3GBML 1SEBA 4TTGA 3SDXE 3VXSD 3ULUL 3WLBB 1HSBA 1IGMH 3NCBB 3RPKA 1U93A 1HKLH 1J18A 3LPWA 3OPZH 1MH5A 2V9QA 3T4YB 1QRNE 5E08L 3EYQC 1NMBL 3FFCE 2ZJSL 3M07A 3HRPA 5IBUG 1KTDB 2OMBA 1AH1A 3NH7H 1ROWA 4NO2B 3Q3GA 4Y2DA 3IVKB 1IQWL 2ED7A 3GMNB 4PLKD 5KBNC 4PJ9B 3F7RA 5C0BD 1F3JB 4JHWL 4BK4A 4IDLA 4HK3J 4PPTA 5J12C 2JK5B 3BGMB 3KPOB 1IEAA 2RAMA 4P23D 4PG2A 3FFDA 5IKCB 2OK0L 2YPLA 1I1YA 1BOGB 1LD9B 1U3HB 4ELKA 4H0HB 1MIEH 2W60A 4P5TB 3FO2A 3QULA 4OZGB 3SDDC 4B50A 1OGAA 1JNHA 3NTCL 4ODUA 4L4VD 4S1RL 2GT9A 3C8KA 1AP2A 4MWFA 4CNIB 1E4XL 5GRJH 5HDOA 3CFJA 4QXGH 1U58B 4C56A 5IHUH 5IB3B 1A3QA 3LZFL 5DRZB 4ZSOB 3D2UA 3NZ8B 1KJ3H 1TNNA 3MODH 1CT8B 3FQTA 3TO4B 1IC5L 3H2WA 1K3IA 3PV6B 3RWGB 3VD9A 4HUUA 1JHTA 4QCIA 1G6RH 2VWEE 1S7RB 3T2QA 4J3TA 5ID1B 1T83A 4Y7MA 2GUOB 2FJFB 1CFQB 3BKYL 1OM3H 4JZJB 1Z6JT 4XTRC 4TNWK 2XV6B 3REWA 2X4UA 4CN4A 4LQFL 1FO0B 4MD5A 5BXFA 3OR7A 2XRAH 1UADC 4FQXA 4R9HA 1OP5H 3CLEL 2E7HA 5EA0L 4BYHA 4HPYH 1JNNH 1ADQH 1CFVL 3KYNB 3BISA 4HUNB 4HKBB 4I18B 3RNKB 3SDCC 3MYJB 3WXVH 1I9IL 3W5MA 4GG6E 4UI2A 3O6KL 3WMSA 2NW2B 4K3DL 3RVXC 5AZEH 4K9EC 5ACMA 3BYYA 4EOWL 3KWWB 1QSED 3STZB 2F74A 2F53A 2W07A 3WIHL 2OSLB 3OTTA 4GO6B 3QIBA 4LPXA 3L3JA 5FF6A 3S96B 4QWWC 2KH2B 4IIQC 2XZQL 3OGCB 1PJ9A 1W0YT 4QRTB 3ZTJH 2X1XR 1YMMA 5T1LD 3S37X 1KELL 5CKAA 1XZ0B 2KUTA 4HGWB 2GTWB 4MQTB 3BWAA 4NNXA 5DTFB 4PJGF 3W82A 3TBWA 3RWJA 5DO2C 5F9AC 1UXSA 1WV7T 1U41A 4QKXB 2YD1A 2AVGA 1GCFA 4Y4FB 5D2LA 3JV4A 5FB8A 2QKIB 5DRNA 1Q9KA 2BP3A 5D7IF 2X70A 1D9KD 2OL3B 4K7PL 5I76B 4P2OC 2ADJA 2BNUB 1HH9A 3WFHB 4JHAH 3OV6A 1TJGH 2AKRB 3MLWH 3R8QA 4F80A 3QQ3B 4YIQA 4CADA 12E8L 1PX4A 2FX8H 4KGJA 4PJ5A 4N0UA 1S5IL 3VJ6A 5GISH 1B3JA 5DMGC 1S9VA 4RQQA 1QLEH 3V6FA 4UT7L 3HTLX 4NHCH 2ITDA 3LKNA 1G7JA 5ISZA 5INCA 3QRGH 3TC9A 2ZSWA 2BCKA 4YHOL 1U42A 3TBTA 2EH7H 1ZVYA 2XIDA 3BMWA 3ESVF 2EYRB 4OLZL 2PW1B 1A4JA 2APXA 1G6RA 2HWZL 3DO3A 3MLZL 3MRIA 4TQEL 5EDXA 4JE4B 2MOVA 2C3VB 4KHXL 2K7PA 3D39D 4PJFF 3TJHC 2VLJE 3NABL 5HGBB 1K8IB 1INQA 4K71B 1DL7L 4KI5D 2VIRB 4G7VL 1RIHH 4OLVH 4Q97A 3QI9B 2CIIB 2EXWD 5DJDB 5HVHB 1MI5D 4O9HH 1ADQA 4HK0B 3RKDC 4ODWB 4OZIF 2AEIT 5D1XB 5D7KD 1MRCL 2FJGA 1RZKL 1DQJA 2P45B 2V17L 4Q9RH 3ARYA 2VR9A 1QUNA 1SHMA 3FT4B 5CEYB 4F58H 1I1FB 5HYJE 3PDOA 3TM6A 1NFIA 3MRLB 4M3KB 5LCVH 5EU7C 3RDTC 3WLWC 1A5FH 3DYMA 5ESAA 3T3PF 5AUMB 2DBLH 4Q2ZB 3D87B 2IPUK 5E1AA 3RZWA 4P3DA 5EN2B 1KT2B 1UYWL 3FO1A 5B4MD 4GG8A 4LSRH 5E8DL 3S34L 2Q8BH 1MFBH 1VEOA 3MLYH 3B2UC 1KJMA 5F96L 4RMQA 4BQCA 1T6VN 2DQEH 4U6XB 1D5IL 1BVKA 4LRNL 2X42A 1MWAB 1DUYB 3V95A 3E2HC 3GSUA 2ED8A 4G8GB 4OZ4A 1FAIL 4LEXH 1NCBL 4X7DC 2VDNH 5D72H 1JZ7A 4MA3A 5FGBA 5ICYA 3IXAA 4NKMB 3NN8B 3Q1SH 3NIGE 3ROLA 1F6FB 4UDUA 3BVNA 5GRYA 3HNSH 3C2AH 3OXSA 3SY0A 4APQD 3FRUB 4WWKA 5C0IB 4XVUD 1S3KH 4G8GE 3V8CA 3RX5A 4OFDA 1EGJH 1M7XA 4Y19A 5CHNA 1BQSA 5H35A 1UZ8B 2LVCA 5E2UH 4LP4A 5GPRA 2VAAA 4GW4A 4KRPD 5F70A 3MRNA 4CW1B 3B3IA 5JPNA 1VGEL 2VLRA 5ETUB 4D3CH 4G9FB 4IJ3B 1NDGA 4JM2F 5D1QB 1CXEA 1X44A 1CVRA 5J1AB 2NXYB 2NY0C 2VITB 2CKBL 1GHFH 1KB5H 1CN4A 2ICES 1BBJA 3IJHA 1P9MA 3CFBA 4DZ8B 4QF1A 1YEKL 4XC1L 1HCVA 4CJ0A 1KJ2H 1JV5A 1MUJB 5GS1C 1AJ7L 4NJAH 5D5MB 4JN1L 2W1NA 2Z91A 1I4FB 3QBTB 3GO1H 3NCCB 4NZTH 4O58L 4X6CE 2H3NA 1MLBB 4MJ4A 1OQOA 3FRPG 3R0NA 3PABA 4WTZA 1CBVH 3VFSB 1EAPB 4QHKI 1H8OA 3DROA 5A2FA 2HTLD 5DQ9B 3G6AB 1JN6A 4NQDD 4X7SH 3DNKA 2VN7A 3BO8A 3MLSH 5DD1H 4Z7NF 1AXSB 1A6PA 4JO3L 4KMTH 3DYPA 4J7RA 4MXVF 3ZDZE 4XT1C 4MJ5B 3P4MB 1D6EA 1LEIB 5KSBB 4RCAA 5EH1A 5BV7L 2FJHA 5EU5A 4AIXA 1UJTA 1PZUB 4GOSA 4U1JA 4NZUH 4OZHF 3WDIA 1UZ6E 4PB0H 4LPTA 1ETZA 3MJGX 4M02A 1IZJA 2IF7A 3ZYZA 1OP5K 3DV6A 1ZGLM 3UBXG 1A9BB 2I07A 5EORH 2M8XA 4ODVL 1S8DB 3FN0L 3I3BA 2RCSH 4M00A 5J13B 5KSBE 2ESVE 2F54B 2O61B 4TN9A 4LLQA 3QFJD 1FCGA 2W65A 4J6RH 4XHQA 5ILTL 2C3XA 4F15B 2X89A 2VDKL 4XXCA 4XPGL 1KEML 4WY7H 5E4IA 4BH8B 1SBSL 1H8NA 3GI8H 2OJZL 5CD3B 4PP1C 4KK6D 4Y4KD 4M6AA 3GSRB 1UM6L 2X4SA 4KVCL 4UDTB 1EGJA 4O51A 4YHPA 3IDUA 5C2UB 1J86A 5CP3H 1BVZA 3OJDA 2E7LC 2YPVL 3VWKB 1KCVL 4YGVA 1NJ9B 3JUZA 5EOCL 4PJBF 3ULUE 1YEJL 1GJIA 1HHKA 2VE6A 2YC1B 1RK0A 3JXAA 3R1GH 3L3KA 3LMJL 4D0DA 1UQSB 2AERT 5TQ2H 5DWUH 3B2VL 5C09A 1XGPA 2XYCA 5C08A 1LVEA 2RIKA 1F00I 1G9EA 2R0WH 3HS0A 4JG0H 1H8SA 1QFPA 3BRDA 2XA8L 2GJ6D 3WNOA 1KJ2A 1A3LL 5I15L 3EGSB 1JK8A 2NY1B 5C07B 1CG9A 5LAXA 2MHAA 4Z7UF 4TVSa 2CLZA 4JPVH 1ZVSB 2AQ2A 3C6LB 5TDPB 5JORB 4DEPC 4HKXB 2JTDA 4CAGA 5FYLH 2W0LA 4Z0XB 1JGDA 1LDSA 1RMFH 4MXQC 3OL2A 4OF0A 3QCUH 4MQXC 1GXEA 1U8OA 4XMPH 4PLOB 5C6TH 1I8KB 4WHTA 1H3XA 2YSSA 4LASH 2YHGA 1J1PH 3U0WL 3MR9A 5AYUL 3DX8A 4E41B 4JGUA 4A2LA 4N8CH 3PWVB 1ZOXA 5CZXC 2GKIA 1IILE 4QRPB 4HIJB 3LHPH 4Y1AE 3JWDL 1QEWB 2X09A 3PQYA 5KSAB 3ESUF 4PTTB 5J3HC 4M93C 3MZGB 5CSGA 2FEDC 1Q94A 2XA3A 4ZD3L 3QUZB 4OCWL 3GI9H 3GKWH 1QNZL 3BN9D 4XH2A 3SO3B 3QPQD 4UV7L 1EHNA 3KS0J 1FV1A 2DKMA 2FSEB 4PJGB 1JPGB 3EOAB 1REIA 2MPAH 2I9TB 3RFZC 3C5ZB 4MAYD 2L0DA 3IDYB 3WO4C 3HUJE 4KZEL 1U6AH 3UZEA 4JM4L 5IVXA 1NLDH 2HTKC 5D7IB 4TUKL 3FT3B 4CVXA 4AJ0A 5EU3A 4PRHB 1JPTL 1FVCA 4CMHB 1EMTL 2NY3D 5CP3A 1OD7A 4XPAH 3QUYC 2F5AL 4F37F 3D18A 5F1IA 4PGEA 1VKXB 3O8XC 3RKPA 3U2SB 1BJMA 5MI0B 3SOBH 1V7ML 4MVBC 4X7TA 5F6HJ 1FJ1B 3UTZB 5L8KB 2DD8H 4R4FL 5DR5H 3RTQB 4UT9H 5DHVB 3MRRB 4XXDB 3BPCB 5I16B 4ZFGH 1TQBC 4FHBD 4NRXA 3U30C 4LCWD 5MEQB 4HJJH 1R5IB 5I1AA 5K33A 2XY2A 3HE6B 2OR7A 4GAJL 3HZKB 3RVVD 4R7DB 2R29L 1KN4H 4LVNC 4V1DB 3NPZB 1UC6A 1EFQA 2VLKD 5SX5H 4PJFB 4QRQA 1UH3A 5K93A 1H5BA 1BD2B 2QTEA 2AJYH 3LPGA 3EO1B 3U4EA 4HWUA 1FLRH 3CPLB 3N85H 4MXWL 5C0AA 1PX3A 2X4TB 4CU6A 3O0RH 3O6FD 3VXSE 2X4OA 4GAGL 5L2JA 4KJWD 5HHNA 4JAMB 3TN0C 4S0SD 1JE6A 4OZIB 4R2GB 1NBZA 2F5BL 4YX2L 2XI9A 1E4JA 2V5TA 4WFFD 2GFBB 3M45A 2ORBL 3NAAL 4JPIA 3BIAX 4OLYH 2ZUVA 3MGTA 4LVOB 1YEHH 4HHAB 1RZJH 4U1GC 4JLRB 4PGCB 3KPRA 4LPWA 3QXTA 1QLFA 1N5AA 3MBXL 3SGJC 5GSRB 4R90L 3ARPA 4HIHB 1CD0A 2NY2B 4N90D 1CK0H 1S7SA 5EO9A 1TFHA 3C87A 1OWRM 1C5BH 4PJIA 1CFNA 3HG1D 3B43A 1KEGL 3MLXH 4GMSL 1T5XA 4F2MB 3QDGB 3V9FA 2CRIA 4L3EB 5JR1L 5MHSE 2DWEB 4HG4J 1VPOH 3T3PE 3U1SH 1Q9OA 2WINB 3H3KA 3TIEA 3U9UB 5GGRA 4AL8H 4U4BA 4K94H 1WVZA 2ZWLT 3I02B 5DYOA 1YEEL 5I1DB 4HWBA 4WHYH 4Y2DD 1HOCB 2DQHH 1T89A 3QDGE 1RV6X 1QTYT 5L0QC 3HE7A 3GIZH 4LK4A 4M1DL 5EZOH 4PRNA 1Y6MR 1DN2A 3DUHA 1EXUB 3Q6GH 1LO2L 3UJTH 1U92B 1PW3A 3DX7A 3VD5A 1DLHA 5D93C 2OTPA 1UM4L 4S1QH 3QQNA 2C1OB 4PRPA 3H9SA 1NMAH 2PTTB 1BFOA 5T1KD 1FH5L 3S36X 4I0PC 4JM2B 1T0NA 4Z78A 5EPMA 4BUHA 4OZFA 1DQQB 1Q72H 1WEJH 3JV6B 4P9HC 3FTGB 4C56D 4QHLB 2WWKT 2PXYD 3U46A 3D2UD 1KIPA 1MPAH 4WHDA 1AXTH 3E1F1 2R39A 3KNBA 3U9PL 1AGFB 4QNPE 4F9PA 5ESQA 3IDGA 3LKSA 5JHLH 2W9DH 4PG2C 2NXZB 1QRKA 4XP5L 1QSEE 4JO4L 4GXVL 4GS7B 1P7QB 1CGWA 2P43B 3CCHA 3TWCL 4KROD 3S4SA 4OKVA 2FGZA 1NCCH 4UUJB 4A2MA 4DN4H 1J1XL 3EYSH 5E8NA 1WCBA 3WN5B 4PJ8A 5DJYA 3U7AA 1IAIM 4CKVX 5SWQB 1YQVL 5JQ6H 2AJUL 3GRWH 3V4UH 1T1XB 1RJZA 4RA3A 1TETL 2Q7YB 5DMKB 2OZ4H 3D3VA 3QHTC 5D1ZB 2E5EA 6FABH 2YMXH 2YD3A 5HBBA 1FL5B 4XBPA 1DQML 1P1ZA 4I4WB 4MCZA 4XCCH 4BELD 4X8XA 5BRZB 5L6YL 3UYOD 5E8PB 5SWZD 3VG0H 1CDBA 5I1CL 4Z7WA 5AWNH 4AH2B 3S7GA 4R4BB 3QJFB 1UVQA 4HEME 1EHXA 2NYYD 4OZHB 4B7IA 1J7VR 4JRYD 2X05A 3I3EA 4Z7NE 4NFCA 1F97A 2YK1L 4JFDB 3IFPA 4XP4L 1KLGA 1E4WH 4MXVE 3EYVA 1YECL 1F4YL 3EYUH 1R24B 3QQ4B 1GZQA 3H42L 1N6UA 2C7UA 4P2RE 3OR6A 2YA2A 1EV2E 3IJSA 5BV7B 3MBEB 5KANI 1HHIA 1QO3B 5E7FA 2X40A 3S5LB 2CDEB 7FABH 1FZJB 1FFOB 43CAB 3AY4A 5B39A 4RIRB 4JR9H 3QUML 3B5TA 1KIQA 5CILL 1FBIH 1XGUA 2HKHL 2MKLC 4G8FA 4K7PY 1FG9C 3VH8A 1N59A 2A73B 4X7CC 2FD6L 3O6ML 1S7XB 2A6JB 2XKUA 3QXDA 4MZ3A 1ZLSL 4PJBB 1CFBA 4LPYA 1NCAL 1UEMA 1TJHH 4TULH 5IP4A 3MFFA 4PJ5D 4R4ND 3QPXH 3U4BH 1R0AH 1QR1B 4JQVA 4ZAKB 3ARGC 1I8IB 3PGCA 4PRBB 5D7JD 1OSPL 1FZOA 3WNMA 5ISZD 1HDMB 2OR9L 4MX7B 5IG7B 1GOFA 4ZUSB 5KZCB 3QNYB 1K2DA 5DI8B 3PL6B 1LWRA 2JIXA 1S5HA 2E6JA 3E6FA 1TIUA 2I9LA 1W72A 3FN3A 5HGDB 5HGHB 4Z0BH 1BBDH 1OD9A 4OD3H 4Z7UB 1M1SA 3LH2L 1FZMB 1A1NA 5F97E 2FL5B 2X4QA 2BJMH 3L5XL 2XXCB 3I75B 5GGSY 4YAQA 2AQ1A 5HHPB 1MJUH 3BXNA 4H5SB 4I5BA 3UYRL 4H8WC 1TZHB 3CDCA 1M7DB 1YJDC 2H6PB 4YHYC 3OKOA 1I8MB 2FX9H 4ZUUB 2OZ4A 3WD5L 2WUBH 2EDRA 4CN1A 1MCKA 4NUJB 4XX1G 4NO0B 5EBLA 3BZFA 4S1DD 3AXLB 2FR4B 1MFDL 1RZFL 2GEEA 3ZE2E 3TZVD 4GLRH 1H0DB 3KPMB 4XC3H 5IEKA 5L88H 3IU4H 5SX5K 5F1NB 5AD0B 1Z9OA 3TT3L 2VDRL 4PS4L 3DIFA 5CSBA 1OAXH 3V5KB 4O2EB 1EBPA 4J1UB 2RB8A 4C54A 1VADA 2NLJB 3IFOB 4JY5H 1OAYH 1Y6NR 1PDKA 2FYYA 4KDTC 4OGAC 1HI6B 4DKEH 1UB5A 2CRMA 3K80A 5FDWB 3FB5B 4ETQB 2WBJB 5C0RL 4Y0GA 3D6GA 5HPOA 2R69H 2X4PA 3SGEH 4XMKH 5I73C 4HFUH 3TPUA 3HR5B 1S7WB 1Q9LB 3ARSA 5J9PA 1HKLL 1YYMH 5E4EB 3OPZL 4XVSH 2HT2C 4LKCA 2IADA 2VLME 1KXQE 4U6HA 3GJEA 4WWKD 1RIVH 3NH7L 3SCMB 3C60B 4M4PA 3PV7A 3QCVH 2WWMC 4JFQB 2KQNA 4Y5YC 3MLRL 2XZCH 4YHLH 1K5NA 5DSCB 3MV8B 1BZ7A 1IZKA 2YUWA 4N8VA 3RWCA 4WV1A 3QWOA 3DMMA 4WIQA 5T1DL 5B38G 4LSPL 1N3NB 2C1PB 3MCKA 4G5ZL 3BPOC 2EDXA 3V7AE 2R0KH 3RWDB 4X80H 5M95B 3FB8B 2AJZB 3O11B 1P4IL 2YUVA 5EBMA 1JTOA 4MA8L 2O5XH 3B9KB 5CLTA 1IM9D 3FOLB 5GRJL 2FCBA 3DUUB 5D7SH 3EW3B 1A9EA 3ALXA 1PSKH 4OLUL 4W6XB 4IHOA 4KK5C 2EIDA 4XNXL 5I1KH 1KJ3L 4L4TD 2DM7A 1HQRA 5IVZA 5LGJB 5CP7A 5EO1B 3P11L 5J1SC 5D2NA 2LE9A 4N5ED 2D7TH 3Q0HA 1ORQB 1LP9F 4FG6C 1A1OA 3GUTB 1P9MC 3I6KA 3DGGB 4QHNB 4Z18A 3VRIA 2HJFB 3D0LA 1NEZB 3IXTB 1B4JH 1RI8A 2QQNH 3CSYA 3FONA 4OF7A 4OCNC 4P9HH 3DX6A 4HPYL 1ZMYA 2CKNA 2J6EL 1CDJA 2SEBB 1AO7B 3OWEA 3N50A 2IH3B 5C9KA 5MEOB 5DJ6A 3NFNB 4YGAB 1HNGA 4M6ML 4NP4H 1MCOH 3FQNA 4JFFD 4PLJC 2FLRT 1RZGA 2PNDA 3TBVA 3BP7A 5EIQA 3ILPA 1SMOA 3H6JA 3P77A 1AO7E 2XKSA 2VNCA 4GRLD 2E7BA 2X89D 1FL6A 2X4NA 4DFHA 5C9JB 3IFNH 4HKJA 4OSUL 1FNSH 4ISVA 4OQTL 5DD6A 5L8LB 1UCBH 2RR3A 3OMZA 3BKCL 1A7QH 4PV9B 5DJZB 2VH5L 2JJTA 1JF5A 5IV2B 4PRDB 2EYTA 4BH7B 4U1HA 3JSSA 3TNNB 5K9KB 4CUCA 1MVUA 1T0PB 3F5WB 3B6SA 3QCTH 5CJBA 1MCQA 4KMLB 5C09D 1DANU 1JTTA 3EYQD 1FFRA 1J8HB 4HZLA 3TVMB 4GAFB 4XGZB 3RHWK 1MY7A 5GISL 3MJ7A 3JWNC 4L29A 4R96A 5GGUA 3K4AA 3GB7B 5C7XL 1DE4B 2VDQL 5DA4A 1QLEL 2A77L 4ODSL 4LLYB 3EOBA 3A6CL 1ZANL 3VXRA 4WCYH 4H20H 3BH8A 2EH7L 3K2MC 3O2DA 2VUYA 1RZIA 4P5KB 5KVEH 5FCSH 5JXEC 1AGBA 5ICZB 3GSOA 1LO5A 3NCYP 3RAJH 1WC7A 1DBJL 1N2RB 3LD8C 4Q9QH 2YZ8A 1IFHH 4OFKA 4HD9A 1U8NB 4X98B 3MCG1 4YR6A 3RJQB 2Q8AH 4JDZA 2P5WA 1EFXB 1MF2H 4FZ8H 3PDGA 4XCNB 1JNJA 4KFZC 4AG4L 1OPGH 3O4LA 3RWHB 5B21A 3CXDL 4YXHH 3LEVL 3PQYD 4Q9RL 4HIIA 4F58L 3GSWB 2ILLA 5AAMA 2P8PB 3QQ9C 1MCPH 3L5WB 3H7BB 3QAZB 3OXRB 4PJEE 4HS3B 5F7HA 4X8JB 5FYJH 1B2WH 3QUXA 3KXFB 4LCWE 3RGHA 3WKNA 4ERSH 5E2WL 1K6QH 3O4OB 1Q0YH 1NUDA 1N6QH 4QTIH 4H8WH 1YJDH 2Q8BL 1MFBL 3GGWA 3KYOA 5C0GA 3MLYL 1YC8A 3HB3C 2UWEA 2F9BT 3QG7H 5I1JL 3KGRA 5JNYA 2B2XL 3SE3C 4DN3L 4HG4K 4AEIH 4XPHL 3SKNA 2D2OA 1TCMA 4R6UA 3KLAA 4Y8AA 4OJFL 3NIFF 4GLRI 5C0CE 4ZXBB 2VXVH 3PWLA 4FQQA 4Y4HA 2KBGA 3MOBH 4DKAA 4LIQH 4PJ9C 2V2TB 3IAQA 4QWWD 2O93L 3CVHH 5HYIA 3ARFA 1B88A 1NCUA 4OM1L 5FHBH 2WM0A 1II4E 2C3GA 3W81A 1HWGB 4PJXA 1HINL 4F3FB 4NN7B 4CVZA 5HJ3B 4MDIA 3PWJA 2IBZY 4P5TC 3VFUA 2VZSA 2GJZB 4G8IA 4LHUD 3HG1E 5F9JA 4WGVB 5JZ7C 2PO6B 3MO1B 3SGEI 4CN6A 1QFUH 1OT1A 4ZO6A 5KVFH 2YXFA 4D3CL 3S5LG 5FYLD 4HFWA 4J12A 1YC7A 2R1WA 3HAEG 2DAVA 5BS0A 4KK9C 1KPUA 1J9CT 5TE4H 1A64A 3TO4C 4XPBH 4RSVA 2XWJB 2VLLB 5JOPD 1KB5L 1XH3A 3RGVB 1VFAB 1ZGLP 1F8TH 3P40A 1UT9A 4X99A 5DMGD 4Z7VA 1GOGA 3KPRD 1FYHB 5FM5O 1FFNA 4YJZL 5J56B 1JWMA 2ICWJ 1H5BC 3PGDA 1CXFA 1NCWH 3EIFA 5D7LB 3WIFA 3GJFA 5GRUL 1X5HA 4ZUWB 3RI5K 3ZE0E 1G9MC 4QTHB 1IVLA 1JRHH 2KKQA 3TNMA 4IRJB 2E7MA 1ED3A 5DD1L 2ARJQ 2Z31A 2BNRA 4MJ2A 1WFTA 4A6YA 3ZKXB 1YPZF 3KYMA 3L7EB 4I18C 4NKIH 5BQ7A 5K9JL 3OSKA 1JGEA 4X9GA 1FDLH 1F90H 1HIML 4XWGH 5MEPA 2AABL 1RUKH 4L3CA 4HEPG 1FYTA 2A9MH 4OCMC 2WIMA 4EN3A 2CPCA 2VXSH 3ZSSA 1WICA 3VI3F 4KV5E 5JLZB 1NKRA 5TE7H 1WISA 2OJEA 2ICEB 3SPVA 1B6UA 4I2XE 1L6ZA 2FO1A 1P4BL 2FBJH 2ADGA 2W9EH 3BUYB 1V7NL 1ZT7A 3WLWD 1CE1H 4O2CA 5IF0A 1G7HB 2RCSL 1Z5LB 3ULSA 4MS8D 7CGTA 1V05A 4B5EA 1ACZA 1OGTA 4U1KA 4RZCA 2FECI 4HWNA 1I7RB 3CVHA 1FZKA 1AFVL 4Y4FC 3O9WA 4EI5A 2IAMD 4KHTH 1JYXA 4WY7L 3B2UD 5I6XB 3GI8L 4WENB 1BPVA 2BRRH 2CK2A 5IW1B 1NDMB 4R0LB 5DEZA 3SKMB 3OKKA 3V5DA 3MYZA 5IGXH 3LB6C 4MNGA 5SWZE 2OX5A 2Y6SC 3L95A 4XVTH 1WZKA 4K9EL 4WFHD 4WUKL 1YEGH 1QFWH 1MSPA 5TQ2L 5DWUL 4MD0A 4DW2H 3VE0A 1DSFL 5EU6B 5T1MB 4D9QD 4KTDH 3GNML 3HI6L 4WDIB 2Z8SA 4DGVL 4GKSA 2Z92A 3QSKB 1HXMB 5IK3A 1XIWA 1YY8A 4K7FB 4GUPB 3FN9A 1NPUA 1HSAA 1LP9B 3OAYH 3D3VD 3V7AG 4YO0A 4U1MB 2H32A 4K71C 5HHOA 4LEOB 1CWVA 4FQHB 4KJYA 1XF5B 2F58H 5C0DB 5FYLL 3SJVB 2NY0D 1MAMH 3QG6B 3GM0A 5T3XL 2UYLA 4MNQB 4H1LA 5D1XC 1YN7B 2YBRB 1EHAA 3MRQB 4R3SB 1IJ9A 4JQXA 4XCYA 1MY5A 2NX5D 4DQOH 1MCLA 1ITCA 4QRSA 4LKXB 5F8QC 5EC1B 3OF6A 4P4KB 4XMLL 4WWID 4C83A 3D0VB 3TFKC 3FQUB 1QLRA 4N8CL 1U8JA 1P6FA 4C4KT 3SJVE 4TRPL 2OP4H 2UZIH 4U1NB 2B8OT 3T0EB 5B8CA 1UJ3B 1X7QB 3GKWL 3VW3L 3QH3B 3BZ4B 2QSCH 1C12A 3N9GH 1VA9A 1A7OH 4IMKA 4HAGA 3DJ9A 1OSZA 3KPPA 1I1RA 2AJVL 4M62H 2X44D 3T2PA 4RFEA 3I50H 4NQEA 4XPTL 1NLDL 4LSSH 4HDIB 4H26B 5FO9A 1JTPA 3T08A 4AIZB 4Z8FL 2DWDB 4OCSH 4BSWA 5T5NF 2B7DT 3FO0L 5B3JE 1NEZG 5FGCB 4M5YL 4WHCA 1JL8A 3VD7A 1CTOA 5E6IA 4XPAL 3BE1L 1CD1B 2DTSA 1XR9A 3QDMD 4GSDL 5J4MA 3K7UA 4HX1B 2V5MA 1R5WA 2P5EE 3BZEB 4EBQL 1ZVHA 1CCZA 4WU7A 1HYSC 3AREC 1DDHA 2AQ3A 1SM3H 2DD8L 2JIXD 1PQZA 1T7WA 5L2KB 1IGYA 1KXTB 4LF3B 4GBXB 3SQOL 1U8PB 4DTGH 4OIIH 3TEUA 1HHGA 1IAOB 2BERA 1D5ZB 4HJJL 1GSMA 3JWOH 2VKWA 1ZLWH 1W2KT 1AIFB 3PWPB 4PP1D 4M1CC 1S7TA 5IMLB 1XF4A 4IJ3C 5D1QC 1P7KA 5L9DL 2NXYC 1OAZL 3HNTH 4OCYH 4HJGB 4HXAH 2AJYL 3PHOA 3FOMA 4R7NA 2IFGA 2VZ1A 1ZTXH 3O0RL 5TDNB 2M2DA 5IQ9B 4JVWA 2ARJA 4KI5F 3V0AC 2A74A 5GGTH 3QEUB 1I8LA 3VGFA 3QZWA 4QRRA 2Q86B 1J87A 2YEZA 4F7CB 4OLYL 4GJTB 4HIEB 3VXTB 3KPQB 2K3TA 5MENE 1G7QA 4TUJA 5A2IH 3KHQA 4R26H 3QEHB 4YDVB 4FTVA 1K4DA 2J8UA 1FG2A 4MHHG 2P4AB 2CO7B 5J8OA 1J0KA 1EIBA 1C5BL 4LGSB 4OGXL 2BC4A 4PRID 3RJDA 5KG9B 1QKZH 4XHJD 3F7VA 1WIPA 5ERWB 2H8PA 5IHZA 1YMHB 3DO7A 1WT5A 5J0BA 4RNRA 4EZMA 3FB7A 4FQIH 4FNLH 4FQ1H 2ZOLB 3VWJB 3UAJC 5I0DA 3U7WH 3WNLA 1GGBH 4EXKA 4AT6B 1MFAL 1I85C 2CK0H 1MRFH 3MXWL 4IRSB 1IAIH 4X5LA 3IDJA 4L8BB 1CXLA 1P4LA 2QQLH 3G5YB 4LRIA 2BY1A 4PY7B 1NGQL 4HS8H 4L4TE 5J13C 2Z8WC 4LCCA 3WJJA 2ZP0T 4PGDB 3GSVA 1FO0H 3PHQA 3GIZL 1AXIB 1A6UH 4WJ5A 2FEDD 4JZOA 3BP4B 5EOTB 3BUTA 4PREA 4MYWB 1ZWIA 3DMMD 4N0FA 1QRNA 4YHZH 5FO8B 1JRHI 5IR1A 2FEEI 3FFCA 3V5HB 4UNTA 2FH6A 1QBAA 4EDXB 4EDWL 4S1QL 4OT1H 3VA2C 1NMAL 4QOKD 2H2PC 3G6JF 1BQLH 3VWKC 5EUKB 3MMEA 4P3CL 3OKDB 3D85D 3DVNA 3MUGA 3BEWA 3BEVA 3F7QA 1X6LA 2ICWA 4ZO7A 5JW4Q 4OM0H 4MLSA 1INDL 5KN5B 3QUYD 1AXTL 1ONQA 4L5FH 4G43A 4JFFE 1FL3B 5JHLL 4MJID 2DLFL 3VXUE 3R06B 2DM4A 4D9RD 4YH6A 1FGVH 2NY1C 3OHXA 2R0ZH 2CXKA 2EH8L 4JY6A 1BIIA 3G08B 2A6KA 3EJZC 3TO2A 2WP3T 4XVJL 3EYSL 4O2FB 3C6LC 4PP2B 2OL3H 5JUEH 5I9QB 1QSFD 5IT2L 3E6HB 2W0PA 2VDML 1U95B 3GRWL 3V4UL 2YMXL 5I18H 1YPZB 3MRFA 4XCEB 4DAGH 4EUPH 2AGJL 2ZZUT 4L9LB 5ACZA 5I74B 4Y88A 1IGCH 4L8CB 3HZMA 5IOPB 1CFSA 1QFWI 1RHFA 2C3WA 4FFVD 5DRZA 4U6VL 3OAYK 3SDYH 1SJHB 3PWUB 3MA7B 3ZT6A 3V4VL 2K9UA 5KSAC 3QDJE 1M71B 2A0LD 1ZHNA 4CMMA 3FQXA 3HR6A 3QUZC 1JPFA 4FQCH 4RFOL 5HI5D 2YA1A 1CFQA 3ELAT 3SO3C 3QJHA 4OCXL 5C92A 1W0WA 3RUGE 4DZBA 4GG6A 1GH7A 1J05A 4IMLB 3C5ZC 3IDYC 4DGYL 1I9RH 2EDTA 1PG7L 4LLMA 3QISA 3BP5B 3VI3E 3RZCA 2NZ9C 4JFPA 1TITA 3D48R 7FABL 4AENA 3MXVH 1XF2A 5HY9B 5IB5B 3P73A 4QRUB 4P23B 4HW6A 3EDKA 3NCMA 3HMXH 2BZDA 3VDAA 4MQ7B 4M48H 3L9RB 4PFEA 3PUCA 4N5UA 2BMKB 1CGVA 3VD4A 3KYNA 4CMHC 1SEQH 3HI5L 5DJ0A 1RIUH 1NAMB 2Z35A 4JFZH 1MQ8A 3QWRA 3ZO0A 4JPKH 1F42A 3STZA 3RWIB 4DVBB 3CH1A 5MI0C 3QPXL 3RTQC 4XBGA 4W4OA 3S96A 3T04D 1JHKH 1CLCA 2HRLA 4LVHB 2OMNA 1QPXA 2CUMA 3RIFK 3VXRD 1MJJB 5K59E 4L8SA 1A7RH 3RA7H 4MMXC 5C6WH 5I1GH 3CD4A 2PF6A 4C59B 4KPHL 1JF1B 3BD5A 5EIIA 3HE6C 4LLUA 1SYSA 4NCDA 4WNQA 4HWEL 2HMID 5ENWB 4JY4B 3S88L 1FORH 1INEL 4Z0BL 2BVQA 5EG6C 3UBXI 1A8JH 1MREH 3LN5A 3GMRA 5HHMB 4OI8A 3HC0A 5FA4A 3MJ6A 2DQIH 5ID0A 4RMSA 3W9DA 1WZMA 2EC9U 5I76A 5CLWA 4KJQD 1G0DA 2X2YA 4D94A 4LLDB 4MNHA 2FX9L 5IB4A 3RX7A 1G7LB 4I9WD 5CSZB 4NQCB 1RUAL 3QQ3A 4NRZA 2BNQE 4F33A 2IPTH 4EUPA 1ZLWK 5TE6L 5F9OH 5HHME 1C16B 4LVOC 1TTUA 5F8RC 3WHXB 5LBSH 4GRWE 3WIIH 2VLJA 4P46A 4RWYH 3IU4L 2F19H 1EX0A 3O2VH 1FFPA 4YC2B 3UDWA 2NY2C 3QUXD 1BEYH 1HXYA 3A6BL 4D0BA 5T33H 4XB8A 1KPRB 1VACB 2BSTA 1CU4H 2WANA 5GGQL 3HCVB 3UPAA 4QT5A 3EYOB 5T1LB 4K7PX 4OFVA 1BLNA 1OAYL 1H15B 5AZ2L 1N7MH 5HYJA 2ICWI 3VXQA 1N5YH 4WW1B 2IEPA 4HBQA 1BVLA 2GK0B 1I9EA 3PIQA 2R4SL 3MCLH 2R69L 5FYLE 1MIMH 3QI9A 3GBNH 1QFHA 3HMXA 1UWEH 5F7WC 2OTWB 5T3XE 1CICA 4Y4HD 4C58B 4ODHL 2KDGA 3SGKC 2NY4C 5HDQL 4MCYB 3HPLA 4DFIA 4XPFH 1DP0A 3ARFD 3IJYB 1CF8L 3DVIA 2APBA 4TNWF 1MFEH 2H26B 1FSKB 4UILH 1NLBL 3W0WD 3NZHH 3ES6B 1N26A 1RIVL 4N1EA 3BKML 5F3HA 3DRQB 1RJYA 1UXWB 3MJ9H 1G0YR 3QCVL 2DTML 3MUY1 4PJAF 3ZYOA 2NY7H 4YPJA 1JGUH 4U0RB 3D9AH 5LXGL 5B22A 3SDAA 4G80B 4CU7A 4ALAH 5J6GB 2CJUH 1VGKA 1NC4B 2AV7A 5CZVH 3QIWA 4ZUTA 1J0JA 4JM2C 5ALBL 2AEQL 3MV9A 3INUH 1U2CA 1FNGB 2EO9A 5ESVB 1XGQA 2B0SH 3BPNB 2D7PA 3THMH 3N1MC 1KBGH 3D39B 4WUUD 4V2CB 4OGYH 4X80L 4YK4B 5FHAL 5IESL 5M7QA 2NXZC 4I77L 3G5XB 2RBLA 1IAII 1KPVB 1E27B 1DVFA 4NKMA 2JCCF 2O5XL 2HG5B 4GS7C 1DBKH 3S3SA 1AY1L 4Q6IB 3NVQA 5D7SL 3GBMH 3ARGD 1IL1B 1PSKL 3UTTB 3TYFA 5I1KL 1UGNA 4YHKL 4HS6A 4IOFC 3TBSA 2X9YA 3CU1A 1WF5A 1KCRL 1NBVH 3LQZA 3WN5C 4G9DB 4JRXA 5EU7E 5M94B 4XP6L 3KJ4C 5E08H 4KWUA 1BQHA 1Y18A 3E2HB 1QVOB 2QADC 3V6ZA 3U0TB 4NQXA 5FYJD 3D69B 5KS9E 1IQWH 1F02I 3CH8A 3MRHA 4XNMB 2FO4A 3MRPB 2BHUA 4JHWH 3OKLA 1I1AA 1PY9A 3FT2B 1B4JL 2ZOKA 4FFZL 3I3DA 3QIUA 4X6CA 4KKLD 1NUNB 4UINL 4WO4B 3ZDXF 2OK0H 4EN3D 1OARL 3F7YA 1KB9K 3PE9A 2X7LB 4HGKC 2HLFD 5K9QG 2DYPB 3H0TB 1DTUA 2Z4QB 3NCJL 5E95B 4WFHE 2VSCA 1MCOL 3L1OL 3MPCA 2RHEA 3NTCH 4S1RH 4HV8B 3STLB 5DRWA 5IW3A 2V7NA 3QA3A 4AEFA 1YNTB 3LZFH 3MBEC 3AS1A 4OLWL 2IGFL 5DQ9A 4APQB 3ARQA 3UTOA 1S7QB 2R2EA 1HEZB 1YEDA 1OW0A 5GS1B 4WFGD 4NJ9L 5CBAA 2VQUA 3BKYH 5ADOL 2BVPA 3G6JB 1XF3A 5D4QA 5KSBA 2ESVA 3HLAB 4ZUVB 1P2CA 1IKNC 1KGCE 4LQFH 4Y5XB 1T4KB 3GSNA 2Y72A 1OTSC 1E6OL 3UTPE 4NO3A 4ZOBA 3CX5J 4IS6A 2NX5E 3MLUL 3G04A 5FDYA 2HJLA 2VXTL 1CFVH 1CQKA 2V2XB 5E2TH 1K4CA 3PL6C 1FNAA 3MLTB 1I9IH 1XIWD 4NFDA 4ZMAT 3IYLW 2WWMD 3KDMA 3T77B 1F11B 4GKZA 3O6KH 4M8QA 4K3DH 4JN2B 1O5DT 2HFFB 2B1HH 3NGBB 2ZKHL 2WBWB 3LSOB 4H20L 3I6LD 1D5MA 2CO6B 5C0ND 5DQJA 1IAKA 3HI1B 4JFXB 4HULB 3RPIB 4EVNB 2X4RA 4NQDB 5GRZA 2XFXB 2AK4B 3ZKQD 3KYAA 4FFYH 1A6AB 1U36A 1A1MA 2ZCKL 2YZ1A 4MSWA 4U1IA 3IFLL 5FOBB 2Q8AL 1IMHC 4LAJH 1AQDB 4J3XA 3S35X 1AKJB 1TCRB 5DHVH 3OF6D 4KK5D 3MRJB 1RHHA 2XPGA 2FHBA 4TSCL 4D8PA 1ZHLA 1L4IA 4YDLB 2I60L 2FWOA 4HF5L 5LGKA 1OPGL 1BZ9A 3MACL 2AK4E 3SQBA 5I0ZA 2YD8A 2CLVB 3DI2B 3CDGA 12E8H 1Q9WA 2IQAA 4Y16A 1B2WL 2IANE 1IQDB 3C5SA 1ZVSA 5CWSB 2WBJC 4UT7H 1K6QL 3QFJB 1Q0YL 3U6RB 4NKOA 4H8WL 5CEZL 4YHOH 3ARDA 2ZUSA 5FUZL 1T7ZA 3U82B 4Y1AA 5D2LF 1AD9A 2BY3A 5EOCJ 5CKGA 4OLZH 3QHZL 1T20A 2P46B 2HWZH 3QG7L 5FV1L 1I7UB 1EEZB 4LCIL 5I8OH 3W5NA 4HUWA 1SQ2N 5E4EC 4KHXH 1R6VA 3FB6B 5E9DE 4XZUA 1TXKA 2XN9E 5F71A 4PLJD 2MCG1 2Q76A 3QEGL 5JO5A 3HUJA 3SCMC 1DL7H 1NMCC 3C60C 2EDKA 4IMKC 4LBEA 4G7VH 2YWZA 4P2QE 4I3SL 3B5HA 1A2YB 2HJKB 3ALWA 4P0DA 4M6OH 5B38A 2JJSA 4IRZH 1T1YB 4HIXL 1MRCH 3BWUC 1RZKH 5IFHL 5GSVB 1IC4L 2GJ6B 4ZPVA 4KQ4L 4G42A 4JRWA 4NQSB 4MA1C 5JOFB 1IRAY 5DJXB 4TSAL 5ANME 1HHHB 4NM4L 4E42B 3WIHA 1OQXA 5E6IC 1Z9LA 1CFTB 3T4AA 1E4KC 3IF1B 3B9KC 2R1XA 1DN0B 1UYWH 3MNWA 1UM5L 5E8DH 3S34H 1MCFA 1F3DJ 3P3YA 4K3HA 1U91A 4Z77B 1JJUA 3ZHLA 4M5ZH 1D5IH 4LRNH 1PKQE 1T22B 1F8TL 2CR6A 1YEIL 3WDJA 1FAIH 2AS5M 2AAVA 1NCBH 5MERB 4NRYB 4UIKL 1PYWA 3VXSA 3LRHA 2Z93B 3VRJA 3VXPA 2YPKB 1FNFA 3UC0L 3RL2A 4L1HA 4NDMA 5JXED 2HAZA 2R1YA 4Y5VC 3LKRB 3ARBB 5I1HH 3O8XB 5EZLA 1ZK9A 2DL2A 1IT9L 2BDNL 2O5ZL 1UKSA 4QOKE 4MAYB 5C0BA 3T0AA 4F8QA 3JTSA 4NQVA 5HYQA 1F90L 1GRWA 1CL7L 2A9ML 8FABA 3VXMB 2ADIB 2R23A 3QEQD 1VGEH 4X9HA 5E99L 1R3JA 4ZPTB 4MJIE 5GGSA 3IDMA 3DXAD 2VDLL 3G6DL 2R9HC 3EFFB 2CKBH 5F88A 4CVWA 3QQ9D 2R2HB 3A0OA 5DEFA 2IBZX 3P4NB 3QO1A 3RU8L 2APWA 1WT5C 1YEKH 1IARB 1QRND 1YN6B 2EYSB 4L4VA 4PJAB 4XC1H 3WFBL 1KIUA 1S9WA 4J3UA 2ZG3A 1R3KB 5E5RB 4LLVA 5EZJA 1IGJB 4JN1H 1GZPB 3H9HB 4OGZA 1GAFL 1XAUA 1QSFE 2Y4SA 5E5MA 2RFXB 4O58H 4X4YB 3AM8A 5ITFA 4KHTL 2C4FT 1A3RL 3HB3D 4ZFFB 1DR9A 2FHCA 3WJJC 4GAYB 2QHLA 1I3RB 2VLKB 2WINA 3WFCL 4LHQB 1QA9A 5BOPA 2ZUXA 2MQ3A 5E7BA 3SKOB 4JFEB 4LCUA 1LK2A 2JCCB 4JO3H 4Z76B 4UQ3B 5I1DA 2AXGA 4G6AD 5A2JH 4ODBD 1R5VB 1YEGL 1EJ6A 4DK6A 3ECBB 2ZSVA 4PJ9D 3ULVC 1E4XI 1OLLA 4DW2L 1RAMA 1RK1B 5BV7H 2E9IA 2Y36H 4Z7QF 2ERJC 3HAEH 2VQ1A 2DKSA 4ELME 4KUCD 4OFYA 2A6DB 4K2UH 2PYEB 5GZOC 4O00A 1U3HD 1A14L 3KPTA 1ORSA 4JFEE 3GMMB 3QFDB 4PV8B 3N06B 2XWTB 4P5TD 1LE9B 4QY8B 1QSEA 4ODVH 3WEXA 3IDNB 3GSXB 1H3WM 3DVFA 4BQ9A 5ELIA 3UP1A 2XG4A 5GRVL 4I1NB 5L0QB 3B9AA 3F58L 3WS3A 4HC1L 5EC2B 2ADFL 1SEBB 4XPGH 1KEMH 2PYEE 4NSKB 1CXHA 4F9LA 2OJZH 6CGTA 3BP6A 5GIRA 2Y06H 1NBQA 1U93B 2MQ0A 5E0QA 4YXLH 1UM6H 5CJXC 4Q58C 1MH5B 2OLDA 1C1EH 1Q8MA 4WW2A 4QYOA 1FE8L 2X1PA 4WFED 4LMQE 3RBGA 1HCFX 3QAZC 5EOCH 2NNAA 3Q3GB 1D9KA 1U8QB 3LQAC 3MNZA 1GPOL 4Y2DB 5SX4I 4HK3N 4AYFA 3LMJH 3ZDXE 3B2VH 3GHEL 3J8F7 3BJ91 3O4OC 2UZIL 1H3PL 2CKBA 1O7SA 3T3ME 1IEAB 3E3QC 5DK0A 3P0GB 1TLKA 1DQLL 3VFVA 3FFDB 2QSCL 2XA8H 1VEPA 2YPLB 4GW1A 1I1YB 1CI5A 4ELKB 5A1AA 1A3LH 5I15H 4F7MA 5IVOA 1C5CL 4K55A 2PTUA 1FVEA 3MRKA 5DS8A 2W60B 2KPNA 2X1WL 3FO2B 3QULB 3I50L 4P2RA 3D1MC 3QWRD 1OGAB 3P9MA 3GMQA 1JNHB 4ODUB 4ZXBC 2PR4L 3O3DA 4I3RH 3S9DB 2GT9B 3C8KB 2DLTA 1AP2B 4MWFB 3F6LA 3CFJB 4C56B 5HVWA 3CNKA 4JZNA 2BVYA 3D2UB 3FQTB 1ZA6A 5DLML 4X4XA 4HUUB 5GGVL 5IQ7L 2XT1B 1BFTA 4NN7C 4QCIB 3FAWA 2L4OA 5JHDE 1KLUA 3U0WH 2IBGA 4POZD 3U0PA 5AYUH 3S5LA 1QO3A 2A2QT 3EJYD 1ZLVH 1S9KC 1MI5A 3GKZA 2VZ3A 3OJVC 3HAEA 4WEMB 4X5WA 3WXWL 3T8XA 1C08A 4Y4FD 4OIIL 3REWB 4DTGL 2X4UB 2PO6C 2X1QA 4GMTL 5BVPL 3S37L 4MD5B 1HH6A 3P9LA 5BXFB 3I6GA 2JB5L 3OR7B 4FQXB 3SN6N 1QNZH 4OCYL 4L8SC 3PWNA 4ZTPH 2DQCL 4RWHA 2Y6SD 3LKPA 3RGVC 3KLSA 3RP1A 4KZEH 4JM4H 1WBYA 1MCEA 5TDOA 1A6VL 3BKJL 4HAFA 3AGVA 5LQBL 2LV4A 2F74B 2F53B 3PG2A 1EZVY 2JJWA 1HDMA 4YBQC 3QIBB 3L3JB 5FF6B 3VCLA 1JPTH 3DETC 5IHBA 4IOSD 1EMTH 3QDAA 4DKDC 1YMMB 2F5AH 5TPWH 4IRJC 5IROC 3BWAB 3BH9A 5HYJD 4NNXB 1V7MH 1EEYA 4R4FH 3TBWB 3RWJB 2P8MB 5DUMH 5BCAA 3NACL 3ZKXC 3LPFA 5SV4A 2P47B 1UXSB 1XGYL 3V0VA 3U79A 5BW7C 1TZHA 2DLEA 3FQRA 4P46C 4U6YA 5D2LB 5FB8B 2Y9RT 3JV4B 3QI9D 2J7LA 5DRNB 5IVXF 1Q9KB 2P24A 4X83A 2X70B 3A6OA 4GAJH 3KYKL 2ADJB 1CICD 2J8OA 4WUUE 4EEEA 5D1XD 2R29H 4FNLL 4JFOA 2AK1L 1M05A 4N0RA 5KVGL 4HT1L 1MRFL 2DQFA 4YIQB 4CADB 4UQ2B 1V3LA 4MXWH 3V6BR 3O3BA 4PJ5B 1T1WA 4N0UB 1WUNT 3VJ6B 4WU5A 2LTQC 4GAGH 3MV7B 1PEZA 1S9VB 4RQQB 5DK2A 3T2NH 4J3WA 3V6FB 1Z9SA 4P57B 2ITDB 3LKNB 1G7JB 1FO0L 5ISZB 5INCB 2DQGL 2F5BH 4YX2H 2ZSWB 2X10A 2BCKB 3SDAD 1G9ML 2ORBH 3TBTB 2OYPA 2XZAL 3NAAH 4PJCE 1S9XA 2MQCA 5I6XC 1A4JB 1G6RB 3MRIB 1F13A 4R0LC 5FKPA 3MBXH 4R90H 4G8GD 3MV7E 4OT1L 4KKNA 4ORZC 3X11A 2VZUA 3P0VH 1BQLL 1INQB 4F7EA 2PCPA 1W8NA 1E28A 3GHBL 3W11C 1KEGH 4GMSH 5HXMA 1NBYA 2P8LA 3U36A 4OM0L 1BJ8A 1YNKH 2FJGB 1MCHA 1DQJB 3OG4B 4HCRA 1T3FA 2HT4C 3KLDA 1OB1A 4U2YA 3PDOB 1NFIB 1JYWA 2M26A 1U8MA 4NZJA 4LGRB 4KUZL 2R0ZL 1YEEH 5ESAB 2VAJA 5KAQF 1ZSDA 5E1AB 3KPLB 4P3DB 3MRDA 1VEMA 1V3MA 3FO1B 5JUEL 4GG8B 4M1CD 1HILA 4I0KA 4BSVA 1UWGL 4M1DH 3RWEA 2C1PA 4PJIF 5HDLA 2NXYD 5JW5A 4JEGB 1KJMB 1VFMA 4AZ8A 1BVKB 2OTUA 4J3OC 5DJ8A 1UM4H 3OJMB 3GSUB 4OZ4B 1G9NC 3L3OA 4JGJA 1IGCL 4MA3B 2MTPA 2VL5A 1FH5H 4P4KC 5ICYB 3IXAB 2JJUA 2VC2H 3SDYL 2J4WL 4Y4KA 1NC2A 1P53A 1RY7B 2ZUQB 1WAAA 3ROLB 5EO1A 5E2VL 4UDUB 3TYGL 1AR2A 3BVNB 3T0EC 3U9PH 2LFGA 5DHXB 5IFAL 3OXSB 3SY0B 5C2BL 4WWKB 3QXAA 4QHKJ 2V9TA 4XP5H 4GXVH 4QHNA 3TWCH 2V9RA 5J06A 4Y19B 5CHNB 5D8JL 3G9VA 5H35B 4LLAA 2XTJB 4P2CG 1X5KA 2DICA 3MXVL 1J1XH 5JIKA 2ESVD 2VAAB 4GW4B 3MRNB 1HE7A 3B3IB 3I85A 5JPNB 2VLRB 1X5GA 2NR6D 1YQVH 5A16A 1LNUA 3JUYA 2AJUH 4RISL 5F3BA 5GS0C 1FIGH 1SEQL 3IETA 3ZKND 1RIUL 4LOUC 1BBJB 3IJHB 2VXUL 3CFBB 4QF1B 1VESA 2FIKA 1K8DA 4PGJA 1JV5B 1VFOA 3CZFA 4DOHE 5HHQA 4BQ8A 4YZFF 2EDLA 4NO5A 2Z91B 4PJHE 2VLRE 4GBXC 3CSGA 4Y8DC 1JZ8A 2Q3ZA 4K8RC 1LEKA 3PABB 3DROB 4XP4H 3UZQA 1MWAL 1YECH 1JN6B 5SV3A 1F4YH 3BO8B 5GJSL 1BGXL 1PY4A 4MB5A 2ZG2A 5E03A 1YNLL 3UTSE 3EFDH 3F5WA 3QDHA 2EKSA 3BN3B 3GMOA 2QL1A 1D6EB 3HC4H 5IJKA 1G0XA 2VUOA 2FJHB 4Z7WF 4PB9H 2JB6A 5EU5B 5E1HB 3EBAA 1IGTA 1ZLVK 4DGIL 2EEAA 4U1JB 2MCPH 2HKHH 3QO0A 1ETZB 3RRQA 3KJ6L 3O6MH 3DV6B 1ZLSH 3V52L 5IM7A 3CDFA 2I07B 4JPWL 1QQDA 5I75B 4F37K 3WKML 5F1OB 5T33L 3C6LD 3O41A 3Q5TA 1XCTA 1KOAA 1CU4L 1OSPH 2QLVB 3ARDD 3KAAA 1QBLH 1G7MA 2JKXA 3LEXA 1N7ML 2ZCLL 2X4SB 3OG6B 2EDWA 2D9QB 4O51B 4YHPB 3VFNA 3VWJC 4PJEA 5JW4R 5CGYC 4IRSC 5HI3C 3MCLL 2NTFA 4LCWA 3DSFL 3OJDB 4N0CC 3GBNL 3L5XH 4YGVB 2WSKA 1T1ZB 1HHKB 2VE6B 1RK0B 4U1LA 3L3KB 3UYRH 4D0DB 5I1EL 5CUSL 5C09B 1XGPB 5C08B 3TH4T 4LHJB 4XPFL 3CIQA 3HS0B 5GZND 3AAZA 2Q87A 3NZHL 1MFDH 1RZFH 1KJ2B 2BY0A 4KRNA 3MJ9L 3TCLA 1JK8B 1G84A 3C5ZD 1CG9B 5C0CA 5C0FA 5LAXB 2NZ9D 2MHAB 3NA9L 2VTFA 2W92A 2CLZB 5F7EH 4O4YL 1L0QA 3TT3H 5T5FL 2VDRH 2Q6WA 2UY7A 4PS4H 2DQTL 2CJUL 1J0YA 1AQKH 3KPSE 5CZVL 2PN5A 1DUZA 1QG3A 4ZFOA 3SE4C 5TFSL 2GI7A 4PRHD 5LWYL 2B0SL 5DZLA 4U3HA 1JGDB 4HWZA 1MAJA 1R3HA 4X4ME 3ZT5A 1U8OB 5C0RH 4WHTB 5DVNA 3QEQE 1B6DA 3RTQD 2YSSB 2G5RA 3HG1A 4W68A 1NL0L 4FFWD 1M6OA 3MR9B 3RY6A 3DX8B 2WUCL 3DPBA 3DXAE 3FO9A 3QUMA 2XNAB 1LE5A 4PJ7E 2FGWL 3PQYB 4S1SL 3PF2A 5JDSA 1NBVL 1CYGA 1KYOJ 5I9QC 1Q94B 5HJ3A 1KENL 2V7HA 2DDQL 5DGQA 4V1DD 4JREB 2BY2A 4XH2B 2I27N 1BJ1J 5GHWL 1BD2D 1FV1B 2GJZA 4ONGL 4X7EC 3MLRH 1OP3H 3WJLC 4K3EL 5C0JA 2NY6B 4L9LC 5I74C 5IVXB 4F57L 3AS2A 3Q6FA 2O5YH 3NA4A 4CVXB 2HFEB 4R2GD 5JA9A 4YWGH 5EU3B 5T1DH 1QHPA 3WSQH 4LSPH 5CBEA 1FVCB 4G5ZH 1GC1C 1PGRB 3BDBA 2IPKA 3D18B 4PGEB 5F1IB 5MHSD 5EOQL 5T1KA 1P4IH 3JVGA 4MA8H 3CSBA 5BMFL 4X7TB 2NY2D 2XQYK 4OLUH 4P5MA 2PXYA 4XNXH 4X6FA 5DMIL 2YUZA 4P23C 3AU1A 5I1AB 3QDGD 4L3ED 1I3VA 2H9GA 4KK8D 3P11H 5BVJA 2HP4A 4I2XA 4OZGE 1NGYA 5TF1L 1CLZH 1WGOA 5C0EA 4QRQB 5LJYH 2WWKO 1H5BB 4PTUA 4X9IA 4FQ2L 3U4EB 3K1KC 4NYLA 5IWLC 5FYKU 5C0AB 1S7UA 4MHHI 5F7DA 3FCTA 4RGNB 3B8SA 4ZSOE 2X4OB 3E0GA 5L2JB 2BVOA 5HHNB 1Z3GL 4L4JA 1NCDH 2VKXA 4LVHC 2D03H 1NBZB 2J6EH 4WFEE 2W38A 4JPIB 4BUGA 1CD8A 2YRLA 4OFYD 4YE4L 1HYRC 3MGTB 5E2TL 5HTSA 4WI6A 4HUXA 4M6MH 5IB1A 3KPRB 5SWZA 4OBRA 1QLFB 1N5AB 3BDYL 3DV4A 4OB5H 1CDYA 1ZHKA 4MJ6A 3DTXA 2B1HL 1HHJA 2C3HA 1RUPL 5DEGA 1T21A 3TH2T 1S7SB 4P59L 2YOCA 5DUPL 1IEBA 4N0YL 4JRYA 4I13B 1F45A 3EDDA 4OIBA 5EO9B 3HZYA 4PBWD 3JTTA 4JM2D 4PJIB 1CFNB 3IGAA 1WBXA 3EUUA 5EIVA 1H3TA 5FIEA 1T5XB 1T2QL 3C6SA 3T2OA 4OSUH 4YHIA 4OQTH 4FFYL 4YUEH 2NXZD 4OLEA 5IMMA 3WS6A 1Z9MA 1Q9OB 2EIZB 3BKCH 2BX5A 3TIEB 3CXHK 5GGRB 2VH5H 3S36L 1GVIA 1OT2A 5DYOB 1IAMA 5E70A 1ES0A 1T7XA 2V5RA 3F6IA 4YC2C 4ZOAA 1RJLA 2CDGA 1AHWC 3HE7B 2Z8VC 3CX2A 5INDA 4K7FA 1IKFL 4PRNB 1Q0XL 2QEJA 4YBHA 3TA3A 3ARRA 1HQ4A 4PYGA 4Z6AT 2XWBA 1CGXA 1PKOA 1E6JH 5HHXH 5D1ZD 3VFOA 1L0YA 4KC3B 3LS4L 3DX7B 3MUJA 5C7XH 3MOAL 1DLHB 1F6AA 1P5UA 3VXNA 2VDQH 3AFLA 3IU3A 4LEOA 2A77H 4LPUA 4ODSH 5D7JA 4FABL 4PRPB 3H9SB 1ZT4A 3A6CH 1EAJA 1ZANH 4WI9A 2RQ8A 4P2RD 1BFOB 2D31A 3SJVA 4YHNA 3UJIL 3VG9B 2DQDL 1T0NB 5F21B 4Z78B 1OAQH 3BI9X 5L7XH 2AXJA 4OZFB 5I8OL 2B4CC 1DBJH 2CGRL 5CS7A 1A7NL 1KIPB 3U46B 1A0QL 4JFDD 3KNBB 3RQ3A 5FM4A 5ESQB 3IDGB 1FSKC 4C55A 4PRPE 4JHZA 5A2KH 3D5OF 1WLHA 2E7CA 3CCHB 4U0RC 3S4SB 4OKVB 1G1CA 2OQJA 4M6OL 4IRZL 1NKOA 3NIDE 5E8NB 4AG4H 3CXDH 3LEVH 1WCBB 4GQPH 4PJDB 4MD4A 4PJ8B 4NKDA 5DJYB 5HHVL 4HH9A 2W0FA 2FBOJ 3VI4F 2QR0A 3TZVA 4ENEC 1RJZB 4QHMA 3BPNC 4XRCB 4H88L 2DLGA 4LNRA 3D3VB 2P5EA 2YRPA 3LKQA 4XBPB 4LSUL 4YK4C 5HDBF 1AE6H 4GQ9L 1P1ZB 5DK3A 4MCZB 1RZ7H 5CINH 5E2WH 4KI5C 1ZE3C 1T2JA 4N1HB 4QHUA 2GCYA 4Q6IC 4Z7WB 4ZAKD 1MCBA 4PJDE 2ATKA 5CD5C 1BJ1H 1PD6A 4S2SA 1UVQB 4XAWH 2AJ3A 4M5ZL 4HGMA 5I1JH 2B2XH 3VRLF 1KJVA 3MUHL 4DN3H 1MCJA 3HA0A 3PL6D 4XPHH 2DMBA 5JMRA 2HT3D 3IFPB 5HGAA 1KLGB 4OJFH 3EYVB 4Z95L 3RL1A 3N1QC 1GZQB 2PUQT 2C7UB 3OR6B 3IJSB 4QXTA 4I3GA 1FNEA 1EUUA 3H7LA 3VA6A 1HHIB 1MELA 1EPFA 3K3QA 4OM1H 5B39B 3BSZL 5I1HL 1HINH 4WO4C 2EDQA 3FQWA 1KIQB 4LLWA 5HYSG 4WTZG 1XGUB 5MENA 3AREB 2UWEF 4NO0D 4G8FB 3BQUA 3VH8B 1N59B 4J4PA 4R8WL 4JQIL 3QXDB 2GSIA 4TUOA 1JGLH 3MFFB 2VDPH 4YDIL 3RIAK 2WLYA 2OM5A 4E0RA 4TPRH 5DMJB 2EDYA 1OP3K 3PGCB 4IDJL 2Y7QA 1FZOB 3WFEL 2EZ0D 3AVEA 1AR1C 2FATL 4APQC 1K2DB 4XVUC 5IBLD 1PAMA 4PJXF 4H25A 3BAEL 2J3SA 1IM9A 2JIXB 1S5HB 3E6FB 3KG5A 2I9LB 5KVMC 1W72B 2VLMD 1NSNL 1XCQA 4I48A 1A1NB 2L7UA 3T0WA 4G9FE 1EVTC 4L4TA 2BXYA 1P84K 3K2UL 3VFRA 4YAQB 4Y5XC 2QSTA 4I5BB 5GRUH 4X6EA 3OKOB 3FJTA 1I7ZA 4ZS6C 4AT6A 1RJCA 1M7IB 4L8BA 4U6TA 5D5ME 5EBLB 2C5DC 3BZFB 3SCMD 5K9JH 1HIMH 3T1FB 3WO3B 2MMXA 2AABH 4Z7VF 4M7LL 5IEKB 1NGXA 2HN7A 1MJ7L 3NGBC 2Y36L 2FZ3A 4HKZA 3DIFB 4PR5A 4K2UL 4U05A 1DBAL 3V2AR 1J0IA 1X5ZA 2HTLC 1VADB 2DJ4A 4RAVA 4JFFA 1P4BH 2ZCHL 1G7IA 2FYYB 5E8OA 1V7NH 5TJWK 3VXUA 5DFVC 25C8L 1NAMH 1UB5B 1BAFL 5MP6L 1BX2A 2BK8A 1Y6KR 3C8HA 5GS2H 2IALA 2X4PB 4E5XA 1AFVH 4GRLA 3O45A 1ODAA 3TPUB 3M1BA 1FN4A 2G9HA 4DJMA 1WSST 4YDLC 1NC2D 2Y06L 5J9PB 2J88H 4YXLL 4MLIA 3KR3L 4OKDA 1C1EL 4HBCH 4LKCB 1RUQH 2IADB 4NZDA 4LAQH 1FLTX 3G5VA 4U6HB 2F54E 5LGHH 2ZUTA 3GJEB 4RAUA 4K9EH 4CGTA 4WUKH 4XWOD 4GRWH 5DHYA 4WRLA 1DSFH 3TP4A 2XICA 3ILQD 3GNMH 1K5NB 3DARA 3HI6H 4HPOL 1JGVL 3G5ZA 4XX1E 1KB5A 1BZ7B 2BOBA 4N8VB 3RWCB 4WV1B 3DMMB 4HUMB 4DGVH 1ZAGA 3QDJA 3L7FA 1AO7D 4HZAA 4BKLA 3MCKB 5I30L 5IHLB 4JO1L 3GM8A 2R2BA 5DZNA 3RUGA 5EBMB 4I3RL 1NFDA 1WWBX 4NIKB 3M8OL 4XP9H 2ENYA 2UVEA 1WFOA 1A9EB 5JXAL 4IHOB 2DQUL 5TGBA 5BZWA 5T3XH 1HQRB 3MNVA 3EO0A 5IVZB 3SDDA 5K9QI 4JKWA 4UOJA 1LO4L 1VSCA 5C07E 5CP7B 1AGEA 5D2NB 5J6HA 4NOBA 3BMVA 5BJTA 3SBWC 1MCRA 3VFWA 3OX8B 4XMLH 3DURA 1A1OB 5H8DA 2H2SC 3I6KB 1TENA 3VRIB 4RRPA 4TRPH 1EO5A 5CJQL 4F7TA 3D0LB 1F4WH 3CSYB 3FONB 3DX6B 3VW3H 1WFUA 3PJSA 3A67L 4CRPA 3PHSA 1J8HD 5FFLA 4ZTPL 3TVMD 4FA8A 2I5YL 5ICXA 5DJ6B 3CLFH 4E41E 5LVEA 3EZ8A 3O2WL 1I9JL 1TVBA 2AJVH 2VR5A 3FQNB 5AG8A 4QRPE 4XPTH 5D9SA 5C8JA 1RZGB 4Z8FH 5HI4D 3TBVB 1MJJA 3BP7B 3VFGH 3ILPB 1XGRA 3FO0H 4M5YH 1J0ZA 5E8EA 3P77B 5J7CC 1Z2KA 3CU7A 3SDCA 4PJGE 1KYOK 3BE1H 4BK5A 5SWSB 1FL6B 2E6QA 5IJKC 3ARBC 5TPWL 2BNQA 4GSDH 2X4NB 3LS5H 5H94A 4BFIA 4O02L 1L9MA 1B0GA 4HKJB 4ISVB 4EBQH 5DD6B 3RNQA 4NUGL 1T5WA 5D7IE 3HRZA 4MAYC 5DUML 3LEYH 3IDIB 4IIQA 4NHUA 5F6IB 4XNQA 5KAQG 1BWWA 1EFXD 4KRMB 4PRHE 2EYTB 3SQOH 2FLBT 4U1HB 4DCQA 3SKUD 3MV01 1MVUB 3B6SB 3SHSA 5SWSE 2E8ZA 1OTTC 4KU1A 4Y89A 5L9DH 2NY3C 2R4RL 1OAZH 2B20A 1RSFA 4HZLB 4LHUA 1MCSA 2YN5A 3P4OA 2G2RA 3MJ7B 4P2OA 4L29B 4R96B 5GGUB 1WITA 4JCLA 5DGRA 3T2NL 1J88A 3I9GL 5C0CD 5DT1L 1A6WL 3EOBB 3VXRB 4X9FA 3BH8B 3TH3T 1QP1A 4PGZA 4V1DE 1ZEAH 5IMOA 4ESKA 4PJFE 3RVVC 1RZIB 1BD2E 1AGBB 4FXKA 4NBYB 4NT6A 3GSOB 5FYKL 1LO5B 2GK0A 1WC7B 2B39A 2GTZA 2CDFA 2X6MA 2XG5A 2YD6A 1LK3H 3VFPA 3P0VL 4FQJL 4XNYL 4TNVF 4YR6B 3O6FC 2NW3A 4JDZB 4OZIE 1JCKA 4PD4K 2P5WB 1JUFA 5BO1L 3MA9L 4OGXH 3BHBA 3SE9L 1JI1A 2E27H 3RWFA 2YKLL 3VI4E 1MLCA 1NGPL 1X4XA 1N4XL 2GHWB 1YNKL 4ZDHA 3MLVH 4ONHA 3O4LB 4OZFG 2L7JA 4RBPH 4HIIB 2DF3A 2IQ9L 1MFAH 1GGIL 3MXWH 1ZV5A 3LY6A 5DUBA 2Y07H 1NGQH 1FIEA 2J8UF 2N4IA 4WGWB 4L3EE 3S4SG 2NY4B 1FNGA 4BM7A 3GGWB 3KYOB 5C0GB 3RDTA 3LN9A 2UWEB 2IMNA 1TVDA 1UENA 3N0PB 5JNYB 4P2YA 1ND0A 3C08L 4EDWH 3SKNB 5IBTH 3C09B 5KS9A 3KLAB 3GSQA 1T66D 2WMPA 3ORJA 3VGHA 3ULVL 4KZDL 2IAMA 3DSNA 5T3ZH 4P3CH 2VC2L 4Y2DC 4FQQB 4Y4HB 5D7LD 5FO7A 3EDFA 3T0XA 4ZOCA 4LQ1A 1CDCA 1A21A 4YDKL 1INDH 1HK6A 5FECA 3ARFB 4V2BA 2NY5C 1JZ5A 3J7HA 2DLFH 3S8WA 4CVZB 3TESA 4YPGA 4MDIB 3PWJB 1F58L 5IVNA 4OCRL 3VFUB 2EH8H 3ULVF 1EDQA 4G8IB 5F9JB 4C57C 3DECA 5CMAA 4XVJH 1T0MA 1R3LB 2XQBL 4CDGC 2HVKA 3PGFL 3KJ4B 5IT2H 4HFWB 1SBBA 1J5OL 1UKQA 2R1WB 2P7TA 2VDMH 5BS0B 1SJEA 2QADB 1FIGL 1KPUB 3AUVA 5B39G 3REVA 5I8CA 1T7VA 1XH3B 3MV11 4ZFZA 3CVIL 4X5XA 3TIDA 1NANH 4JDVB 4RGOL 1JWSA 3VH8G 2KQMA 2AGJH 3LQAL 3SGDH 4X99B 2P49B 4U7SA 4Z7VB 5FCUL 4DWHA 1T83C 3BRGC 1FFNB 3UTQA 1JWMB 4K23L 3PGDB 4U6VH 3C5JA 1RFDL 3ZHKA 1VFBA 3WIFB 1FQ9C 5BS0E 5EU4A 4QLRA 3WE6A 3GJFB 3V4VH 2ID5A 1PG7W 4KUCF 2NX5A 2APFA 2YD9A 3VMNA 3RVUD 4AEHH 4FQXC 4P4RA 3HZVA 4D2NA 5D6CA 4RFOH 1NEUA 3TNMB 1EH9A 2ATPA 1IGIL 2GSGA 1ED3B 4MA7L 3UXFA 1JF6A 5BRZE 2Z31B 4OCXH 1KG0A 2BNRB 1KTLA 4AM0A 3Q5YA 3H3PL 4A6YB 1XGTB 3KYMB 4DGYH 5BQ7B 5DD3L 1PG7H 1RZ8A 1JGEB 3EFDL 1CDUA 1TPXB 4OZHE 5MEPB 4L3CB 1FAKT 1FYTB 3HC4L 1TZIA 1TVHA 4PB9L 4EN3B 2VISA 4JFDE 3QIBC 2NYYC 4TTDD 1VERA 2MCPL 4C4KO 4JANA 1FCCA 3O3EA 2OJEB 3SPVB 3HI5H 3LIZL 32C2A 3TA3D 2ADGB 1FGNH 4GKOA 1ZT7B 3OJ2C 1EEQA 4O2CB 5IF0B 1T03L 1F4AA 3ULSB 3WS6C 1OGTB 2NPLX 4U1KB 4RZCB 4GG6F 1A6ZB 3CVHB 4XAKE 1FZKB 4Q7DA 2A6IA 2PW2A 4BQBA 3O9WB 4EI5B 5GJTH 4KPHH 3SJVD 3QDMA 1QBLL 3HNVL 4FS0A 4ODTL 1A6AA 3K4ZA 4MNQD 4HWEH 1TJIL 3S88H 4PJBE 3LAFA 1INEH 2ARWA 1E0OB 4LCYA 4AEEA 5I17A 4OD2A 3OKKB 3V5DB 1CTNA 4JKMA 2IANA 3I2CL 1WFNA 4MNGB 3L95B 4ODXA 4OUUA 1JPSL 4OUOA 4Q74A 1U8LA 5TH2A 3GRWA 4MD0B 3FAXA 5DURB 3VE0B 3W2DH 1ZT1A 1NGWA 3T0ED 1BWMA 1RUAH 4X6BA 2YN3A 4YEFA 2YD7A 3P30H 4GKSB 2Z92B 4Z7UE 2E7LA 1LO3L 5E9DA 4RA0C 5TE6H 1C5DA 2XN9A 5IK3B 5ADPH 1EEUA 1XIWB 1YY8B 35C8L 3EHBD 1HSAB 5DJAA 2P5ED 2VO5A 1L6XA 2EE9A 5F7EL 4YO0B 1X5IA 3B8YA 4P2QA 3A6BH 2H32B 5HHOB 4YFLI 5H2BA 1AQKL 5KOMC 1F6LL 4JJ5A 4W4NA 5GGQH 2AXFA 4KJYB 2QHRL 2DM2A 3FKUS 5FAAA 4JFYA 1YQ2A 1GYAA 1MCNA 2HRPL 4CU8A 4N8VG 3OAUL 5AZ2H 3OKNA 3WNKA 1JZ4A 2UYLB 4H1LB 1S7VA 3GMPA 4WI8A 5ANMA 4S1DC 4XCYB 5E94A 2R4SH 4QRSB 4PRIA 4KKCD 1IM3A 5HHOE 3MUZ1 5L2KD 4C83B 2A38A 4OLXL 4G6KH 2BSRA 3TV3H 1O7VA 1QLRB 4HXBL 1U8JB 1FVDA 3AMLA 3BX7C 4ODHH 1IC7L 3DVGA 3PWPD 5HDQH 3AROA 2Y25A 4NKQB 2G5BA 1N64L 5B8CB 2E9BA 4FP8L 1CF8H 4X0KA 1UB6A 2EC8A 1LO0L 3Q5OA 1PKQA 1C12B 1T04A 1NLBH 4DK3A 3BKMH 1NMCB 4EI6A 5MEND 1OSZB 2DTMH 3GZKA 2ZNXA 3BQUD 3KPPB 5LXGH 4RBPK 4J4PD 4RFEB 4NQEB 4OTXL 2BSED 5FO9B 2O5YL 5FGBC 1JPST 4BSWB 1BECA 4YWGL 3WSQL 5ALBH 2AEQH 2ZUQC 4MA1B 3VFTA 1N0XL 4ORGB 3W39A 5E6IB 3SE8L 1CGSL 1JNLL 5FHAH 1XR9B 4QOKA 4X7FC 5IESH 2ZPKL 4I77H 4UMGA 4WWKC 1R5WB 1OTUD 1CE6A 4LSTL 3D85A 4WU7B 1DDHB 3MV8E 1AY1H 1PQZB 2HA1A 3T09A 1IGYB 1V8HA 1S78C 2XTJC 3ARTA 3QUYA 4YHKH 5JW4N 1HHGB 4EIZC 1KCRH 4MJIA 1SYVA 4XP6H 4XNUL 1XF4B 1P7KB 3VWJD 1CLZL 4IRSD 5HI3D 3PHOB 1G9NL 1LDPL 3FOMB 4JO2L 4R7NB 1I3GL 2JJVA 5HPMA 3LV3A 2ARJB 2Q7NA 1QSFA 4CVUA 4KJPC 2HLAA 4Y5VB 1Q1JH 2A74B 4FFZH 1NCDL 2D03L 3BIBX 4UINH 3QZWB 4QRRB 1OARH 3PNWA 3P4NA 3ZE1F 2WP3O 5I1LA 3IKCA 5F7KC 3NCJH 1IE5A 4QXWA 4DKFL 1CXIA 4N5EC 1G7QB 4YHML 3T0BA 1MQKH 5EBWA 3L1OH 4X9BA 4TUJB 1ZHBA 3TN0A 1GZPA 4OB5L 2BOCB 3VXUD 4FTVB 1K4DB 2XKNB 4LARH 2J8UB 1FG2B 3LKOA 3VXOA 3CFKA 1PVHA 1ZS8A 3OB0H 4NFBA 4OLWH 3CDYA 2IGFH 3C9NA 5FYKE 3CC5A 4ELMA 3F7VB 5GS0L 2H8PB 3SGJA 3H8NA 5H37G 3DO7B 4JKKA 4X6CF 3MRMA 3U7YL 1YY9D 4RNRB 3FB7B 5CIPH 4YUEL 3N1FC 1AGCA 1KCSL 3F7PC 4NJ9H 4FTVE 5ADOH 3LN4A 3WHE1 1NANI 3EDEA 4X6DF 3IDJB 3V6OA 1BFVL 4XB7A 3SGDI 1P4LB 1YZZA 1D5BA 5I75C 1DEEA 5I71B 4LCCB 1E6OH 3ZDZF 2V2WA 3K8LA 3GSVB 2PYEA 3UO1L 4GW5A 3PHQB 3GSNL 4K8RL 5I19H 4MB4A 3K8KA 3MLUH 1UCTA 4WJ5B 4GRMA 4JZOB 4XXCC 4N1CA 5JDJA 4JGMA 2VXTH 4PREB 4U1SA 1ZWIB 1E6JL 1RULL 1QRNB 1YYLL 1EJOL 4N0FB 3QDJD 5HHXL 5IR1B 1UZ6F 2YS4A 3FFCB 2HKFH 5JPMA 5EO0A 2WIIA 2E6PA 5GQBA 4PG9A 1A6TA 2ZKHH 2ERJB 2FIRT 1FNHA 4NSKA 3MMEB 5KSBF 1SMAA 3NCFB 5IJVA 3DVNB 2CRZA 3MUGB 1J8HE 1OAQL 1UG9A 1NQBA 2PTVA 2RJMA 5L7XL 3BEWB 1MHHB 3BEVB 1NAKL 5LKNA 2ICWB 3QHFL 3IDXH 1ONQB 1YEFH 2Y1VA 4G43B 3ZKSD 1F4XH 3DX9A 3H3BC 3SDDD 3ULVE 1U8IA 4G3YL 2ZCKH 3MGAA 2ITCA 3IFLH 5DC4B 1U8QA 4WTXA 4I0PA 1G7PA 5FM5M 2NQCA 3OHXB 4N9GA 3BGAA 4JY6B 1BIIB 1KNOA 2A6KB 3ULUF 4TSCH 3TO2B 2I60H 4HF5H 2G60H 5GRWA 1ZA3A 3MACH 4WI2A 4PRAA 3MRBA 1W0VA 5CCKH 3UPCA 5FGRA 1AE6L 3MRFB 4XTRD 1RZ7L 5JHDA 1CGYA 5DRXA 3MRCA 5CINL 5GS2D 5ACZB 4GH7B 4OF8A 4D9LL 5CEZH 5KSVA 3HZMB 1CFSB 5FUZH 3VD3A 4LFHG 1MHCA 3QHZH 1UEYA 1EVUA 4XAWL 5CIPA 1T7YA 1B0WA 5IFJA 4MQSB 4LCIH 1QR4A 3GMLA 4UU9A 3SDCD 1ZHNB 1DCLA 3QXUA 3FQXB 4CMMB 5HVFB 1JPFB 4GKNA 3V4PH 3KXFE 4JREC 1Y0LA 3UX9B 2BNQD 3QEGH 3RVXD 3QJHB 3UPRA 5HHMD 2R0LL 4M03A 4M7ZC 1W0WB 4DZBB 4GG6B 3TJEH 4I3SH 1J05B 3E3QE 3MRGA 4LLMB 3RZCB 4JFPB 2NY6C 4S10A 5EFIA 2CUIA 4AENB 1NH6A 1XF2B 4JG1L 4HIXH 4NN6B 3BW9A 3P73B 3MGOA 4F7PA 2YR3A 5IFHH 1IC4H 3W0WA 4NQCD 4YFDB 4KQ4H 3CUPA 4L8DB 3ARVA 1J8KA 5KVDL 4TSAH 1EBAA 3GIVA 5DO2D 4NM4H 5F7MC 4S0TD 1WBZA 5DJ0B 2Z35B 2VN4A 3KPNB 1DZBA 1MCCA 2CSPA 1MJ8L 1JGLL 3CH1B 2FNBA 2VDPL 4P2OD 3HUJF 1UM5H 4XBGB 5DDHA 1BM3L 4TPRL 1V5JA 3T65A 3O3AA 5T3XD 2AP2A 3W9EA 4L8SB 4WUUA 2LQRA 3PXHA 3OBAA 5ALCL 5EIIB 4KMQA 1D6VL 4OAWA 4TYUA 4LLUB 1SYSB 3X12A 2HFGL 4WNQB 1YEIH 4AQOA 2CXGA 2MNUA 2P8MA 1U8HA 5DJCA 5I8EA 2BVQB 1QOKA 3ARGA 4UIKH 1RURH 3DRTA 3LN5B 1CR9L 2W59A 3GMRB 5IMKA 1NFKA 3NPSB 3QUKA 1FRGH