4P1CH

Crystal structure of the toluene 4-monooxygenase hydroxylase-ferredoxin c7s, c84a, c85a variant electron-transfer complex
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
111
structure length
111
Chain Sequence
SFEKISSLDDIWVGEMETFETSDGTEVLIVNSEEHGVKAYQAMCPHQEILLSEGSYEGGVITCRAHLWTFNDGTGHGINPDDAALAEYPVEVKGDDIYVSTKGILPNKAHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for biomolecular recognition in overlapping binding sites in a diiron enzyme system.
pubmed doi rcsb
source organism Pseudomonas mendocina
molecule tags Oxidoreductase
molecule keywords Toluene-4-monooxygenase system protein A
total genus 25
structure length 111
sequence length 111
chains with identical sequence I
ec nomenclature
pdb deposition date 2014-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF00355 Rieske Rieske [2Fe-2S] domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 4p1cH00
5AEWA 2DE5D 4NBAD 2BMQA 2E75D 4NBDD 2NVGA 4HM6A 2NVEA 3GZXA 1Q90C 4NBCD 1NU1E 4HM0A 4P1CH 1FQTA 2FYNC 3L71E 4QUPA 2HMOA 4PD4E 3C0DA 4HM5A 2YFIA 1EZVE 3GL2A 2XR8A 4QDDA 2QJPC 3L72E 3GCEA 4H0LD 4HM2A 3TGUE 5KLIC 1ULIA 1KB9E 2D2CD 2HMNA 3GOBA 1SJGA 1WQLA 4PV1D 2GBWA 2NUMA 4HJLA 2QJKC 1NYKA 5KLVE 1O7HA 3GTEA 4HM1A 4QDFA 2XRXA 4NBED 3EN1A 2NVFA 4EMJB 1G8KB 1VCKA 5KKZC 1PPJE 3AZCA 2YVJB 3H1KE 1G8JB 2BCCE 2CKFA 4AIVA 1NTKE 3VMHD 3CXHE 3GTSA 3GZYA 4OGQD 2A06E 4HKVA 1EG9A 2NWFA 1O7WA 2HMJA 2Q3WA 3L74E 1O7PA 4H13D 4H44D 5AEUA 3CX5E 5HL4A 2YIUC 2XSOA 2QPZA 1O7MA 2I7FA 1O7NA 1UUVA 3H1IE 4HM3A 2B1XA 1O7GA 3VCPA 3VMID 2ZT9D 3FOUA 2HMKA 3VCAA 1ZRTE 2E76D 2IBZE 2YFJA 4AAYB 1RFSA 2NUKA 2QJYC 2E4PA 4NB9D 1NDOA 1L0LE 2GBXA 2HMLA 3VMGD 3DQYA 4QURA 1UUWA 2JO6A 1SQQE 2JZAA 4U3FE 3GKEA 1P84E 1NTZE 2DE7D 1VM9A 2XSHA 1BE3E 3L70E 4HM7A 1SQXE 2B24A 1VF5D 1JM1A 1KYOE 3CWBE 3H1LE 1ULJA 4QCKA 3L73E 3N0QA 4QDCA 3D89A 4QDFB 3GB4A 1BCCE 4NBFD 4QUQA 4HM4A 1L0NE 3BCCE 2ZYLA 2DE6D 1PP9E 4NBBD 3L75E 5CXMA 2YFLA 2BMOA 3EQQA 4NBHD 4P1BH 3H1JE 4NB8D 1SQVE 2E4QA 3GL0A 2HMMA 1SQPE 1NTME 1RIEA 3H1HE 4NBGD 2E74D 1SQBE 4HM8A 5BOKA 2BMRA 2FYUE
chains in the Genus database with same CATH superfamily
5AEWA 2DE5D 4NBAD 2BMQA 2E75D 4NBDD 2NVGA 4HM6A 2NVEA 3GZXA 1Q90C 4NBCD 1NU1E 4HM0A 4P1CH 1FQTA 2FYNC 3L71E 4QUPA 2HMOA 4PD4E 3C0DA 4HM5A 2YFIA 1EZVE 3GL2A 2XR8A 4QDDA 2QJPC 3L72E 3GCEA 4H0LD 4HM2A 3TGUE 5KLIC 1ULIA 1KB9E 2D2CD 2HMNA 3GOBA 1SJGA 1WQLA 4PV1D 2GBWA 2NUMA 4HJLA 2QJKC 1NYKA 5KLVE 1O7HA 3GTEA 4HM1A 4QDFA 2XRXA 4NBED 3EN1A 2NVFA 4EMJB 1G8KB 1VCKA 5KKZC 1PPJE 3AZCA 2YVJB 3H1KE 1G8JB 2BCCE 2CKFA 4AIVA 1NTKE 3VMHD 3CXHE 3GTSA 3GZYA 4OGQD 2A06E 4HKVA 1EG9A 2NWFA 1O7WA 2HMJA 2Q3WA 3L74E 1O7PA 4H13D 4H44D 5AEUA 3CX5E 5HL4A 2YIUC 2XSOA 2QPZA 1O7MA 2I7FA 1O7NA 1UUVA 3H1IE 4HM3A 2B1XA 1O7GA 3VCPA 3VMID 2ZT9D 3FOUA 2HMKA 3VCAA 1ZRTE 2E76D 2IBZE 2YFJA 4AAYB 1RFSA 2NUKA 2QJYC 2E4PA 4NB9D 1NDOA 1L0LE 2GBXA 2HMLA 3VMGD 3DQYA 4QURA 1UUWA 2JO6A 1SQQE 2JZAA 4U3FE 3GKEA 1P84E 1NTZE 2DE7D 1VM9A 2XSHA 1BE3E 3L70E 4HM7A 1SQXE 2B24A 1VF5D 1JM1A 1KYOE 3CWBE 3H1LE 1ULJA 4QCKA 3L73E 3N0QA 4QDCA 3D89A 4QDFB 3GB4A 1BCCE 4NBFD 4QUQA 4HM4A 1L0NE 3BCCE 2ZYLA 2DE6D 1PP9E 4NBBD 3L75E 5CXMA 2YFLA 2BMOA 3EQQA 4NBHD 4P1BH 3H1JE 4NB8D 1SQVE 2E4QA 3GL0A 2HMMA 1SQPE 1NTME 1RIEA 3H1HE 4NBGD 2E74D 1SQBE 4HM8A 5BOKA 2BMRA 2FYUE
chains in the Genus database with same CATH topology
5AEWA 2DE5D 4NBAD 2BMQA 2E75D 4NBDD 2NVGA 4HM6A 2NVEA 3GZXA 1Q90C 4NBCD 1NU1E 4HM0A 4P1CH 1FQTA 2FYNC 3L71E 4QUPA 2HMOA 4PD4E 3C0DA 4HM5A 2YFIA 1EZVE 3GL2A 2XR8A 4QDDA 2QJPC 3L72E 3GCEA 4H0LD 4HM2A 3TGUE 5KLIC 1ULIA 1KB9E 2D2CD 2HMNA 3GOBA 1SJGA 1WQLA 4PV1D 2GBWA 2NUMA 4HJLA 2QJKC 1NYKA 5KLVE 1O7HA 3GTEA 4HM1A 4QDFA 2XRXA 4NBED 3EN1A 2NVFA 4EMJB 1G8KB 1VCKA 5KKZC 1PPJE 3AZCA 2YVJB 3H1KE 1G8JB 2BCCE 2CKFA 4AIVA 1NTKE 3VMHD 3CXHE 3GTSA 3GZYA 4OGQD 2A06E 4HKVA 1EG9A 2NWFA 1O7WA 2HMJA 2Q3WA 3L74E 1O7PA 4H13D 4H44D 5AEUA 3CX5E 5HL4A 2YIUC 2XSOA 2QPZA 1O7MA 2I7FA 1O7NA 1UUVA 3H1IE 4HM3A 2B1XA 1O7GA 3VCPA 3VMID 2ZT9D 3FOUA 2HMKA 3VCAA 1ZRTE 2E76D 2IBZE 2YFJA 4AAYB 1RFSA 2NUKA 2QJYC 2E4PA 4NB9D 1NDOA 1L0LE 2GBXA 2HMLA 3VMGD 3DQYA 4QURA 1UUWA 2JO6A 1SQQE 2JZAA 4U3FE 3GKEA 1P84E 1NTZE 2DE7D 1VM9A 2XSHA 1BE3E 3L70E 4HM7A 1SQXE 2B24A 1VF5D 1JM1A 1KYOE 3CWBE 3H1LE 1ULJA 4QCKA 3L73E 3N0QA 4QDCA 3D89A 4QDFB 3GB4A 1BCCE 4NBFD 4QUQA 4HM4A 1L0NE 3BCCE 2ZYLA 2DE6D 1PP9E 4NBBD 3L75E 5CXMA 2YFLA 2BMOA 3EQQA 4NBHD 4P1BH 3H1JE 4NB8D 1SQVE 2E4QA 3GL0A 2HMMA 1SQPE 1NTME 1RIEA 3H1HE 4NBGD 2E74D 1SQBE 4HM8A 5BOKA 2BMRA 2FYUE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AEW A;  2DE5 D;  4NBA D;  2BMQ A;  2E75 D;  4NBD D;  2NVG A;  4HM6 A;  2NVE A;  3GZX A;  1Q90 C;  4NBC D;  1NU1 E;  4HM0 A;  4P1C H;  1FQT A;  2FYN C;  3L71 E;  4QUP A;  2HMO A;  4PD4 E;  3C0D A;  4HM5 A;  2YFI A;  1EZV E;  3GL2 A;  2XR8 A;  4QDD A;  2QJP C;  3L72 E;  3GCE A;  4H0L D;  4HM2 A;  3TGU E;  5KLI C;  1ULI A;  1KB9 E;  2D2C D;  2HMN A;  3GOB A;  1SJG A;  1WQL A;  4PV1 D;  2GBW A;  2NUM A;  4HJL A;  2QJK C;  1NYK A;  5KLV E;  1O7H A;  3GTE A;  4HM1 A;  4QDF A;  2XRX A;  4NBE D;  3EN1 A;  2NVF A;  4EMJ B;  1G8K B;  1VCK A;  5KKZ C;  1PPJ E;  3AZC A;  2YVJ B;  3H1K E;  1G8J B;  2BCC E;  2CKF A;  4AIV A;  1NTK E;  3VMH D;  3CXH E;  3GTS A;  3GZY A;  4OGQ D;  2A06 E;  4HKV A;  1EG9 A;  2NWF A;  1O7W A;  2HMJ A;  2Q3W A;  3L74 E;  1O7P A;  4H13 D;  4H44 D;  5AEU A;  3CX5 E;  5HL4 A;  2YIU C;  2XSO A;  2QPZ A;  1O7M A;  2I7F A;  1O7N A;  1UUV A;  3H1I E;  4HM3 A;  2B1X A;  1O7G A;  3VCP A;  3VMI D;  2ZT9 D;  3FOU A;  2HMK A;  3VCA A;  1ZRT E;  2E76 D;  2IBZ E;  2YFJ A;  4AAY B;  1RFS A;  2NUK A;  2QJY C;  2E4P A;  4NB9 D;  1NDO A;  1L0L E;  2GBX A;  2HML A;  3VMG D;  3DQY A;  4QUR A;  1UUW A;  2JO6 A;  1SQQ E;  2JZA A;  4U3F E;  3GKE A;  1P84 E;  1NTZ E;  2DE7 D;  1VM9 A;  2XSH A;  1BE3 E;  3L70 E;  4HM7 A;  1SQX E;  2B24 A;  1VF5 D;  1JM1 A;  1KYO E;  3CWB E;  3H1L E;  1ULJ A;  4QCK A;  3L73 E;  3N0Q A;  4QDC A;  3D89 A;  4QDF B;  3GB4 A;  1BCC E;  4NBF D;  4QUQ A;  4HM4 A;  1L0N E;  3BCC E;  2ZYL A;  2DE6 D;  1PP9 E;  4NBB D;  3L75 E;  5CXM A;  2YFL A;  2BMO A;  3EQQ A;  4NBH D;  4P1B H;  3H1J E;  4NB8 D;  1SQV E;  2E4Q A;  3GL0 A;  2HMM A;  1SQP E;  1NTM E;  1RIE A;  3H1H E;  4NBG D;  2E74 D;  1SQB E;  4HM8 A;  5BOK A;  2BMR A;  2FYU E; 
#chains in the Genus database with same CATH topology
 5AEW A;  2DE5 D;  4NBA D;  2BMQ A;  2E75 D;  4NBD D;  2NVG A;  4HM6 A;  2NVE A;  3GZX A;  1Q90 C;  4NBC D;  1NU1 E;  4HM0 A;  4P1C H;  1FQT A;  2FYN C;  3L71 E;  4QUP A;  2HMO A;  4PD4 E;  3C0D A;  4HM5 A;  2YFI A;  1EZV E;  3GL2 A;  2XR8 A;  4QDD A;  2QJP C;  3L72 E;  3GCE A;  4H0L D;  4HM2 A;  3TGU E;  5KLI C;  1ULI A;  1KB9 E;  2D2C D;  2HMN A;  3GOB A;  1SJG A;  1WQL A;  4PV1 D;  2GBW A;  2NUM A;  4HJL A;  2QJK C;  1NYK A;  5KLV E;  1O7H A;  3GTE A;  4HM1 A;  4QDF A;  2XRX A;  4NBE D;  3EN1 A;  2NVF A;  4EMJ B;  1G8K B;  1VCK A;  5KKZ C;  1PPJ E;  3AZC A;  2YVJ B;  3H1K E;  1G8J B;  2BCC E;  2CKF A;  4AIV A;  1NTK E;  3VMH D;  3CXH E;  3GTS A;  3GZY A;  4OGQ D;  2A06 E;  4HKV A;  1EG9 A;  2NWF A;  1O7W A;  2HMJ A;  2Q3W A;  3L74 E;  1O7P A;  4H13 D;  4H44 D;  5AEU A;  3CX5 E;  5HL4 A;  2YIU C;  2XSO A;  2QPZ A;  1O7M A;  2I7F A;  1O7N A;  1UUV A;  3H1I E;  4HM3 A;  2B1X A;  1O7G A;  3VCP A;  3VMI D;  2ZT9 D;  3FOU A;  2HMK A;  3VCA A;  1ZRT E;  2E76 D;  2IBZ E;  2YFJ A;  4AAY B;  1RFS A;  2NUK A;  2QJY C;  2E4P A;  4NB9 D;  1NDO A;  1L0L E;  2GBX A;  2HML A;  3VMG D;  3DQY A;  4QUR A;  1UUW A;  2JO6 A;  1SQQ E;  2JZA A;  4U3F E;  3GKE A;  1P84 E;  1NTZ E;  2DE7 D;  1VM9 A;  2XSH A;  1BE3 E;  3L70 E;  4HM7 A;  1SQX E;  2B24 A;  1VF5 D;  1JM1 A;  1KYO E;  3CWB E;  3H1L E;  1ULJ A;  4QCK A;  3L73 E;  3N0Q A;  4QDC A;  3D89 A;  4QDF B;  3GB4 A;  1BCC E;  4NBF D;  4QUQ A;  4HM4 A;  1L0N E;  3BCC E;  2ZYL A;  2DE6 D;  1PP9 E;  4NBB D;  3L75 E;  5CXM A;  2YFL A;  2BMO A;  3EQQ A;  4NBH D;  4P1B H;  3H1J E;  4NB8 D;  1SQV E;  2E4Q A;  3GL0 A;  2HMM A;  1SQP E;  1NTM E;  1RIE A;  3H1H E;  4NBG D;  2E74 D;  1SQB E;  4HM8 A;  5BOK A;  2BMR A;  2FYU E; 
#chains in the Genus database with same CATH homology
 5AEW A;  2DE5 D;  4NBA D;  2BMQ A;  2E75 D;  4NBD D;  2NVG A;  4HM6 A;  2NVE A;  3GZX A;  1Q90 C;  4NBC D;  1NU1 E;  4HM0 A;  4P1C H;  1FQT A;  2FYN C;  3L71 E;  4QUP A;  2HMO A;  4PD4 E;  3C0D A;  4HM5 A;  2YFI A;  1EZV E;  3GL2 A;  2XR8 A;  4QDD A;  2QJP C;  3L72 E;  3GCE A;  4H0L D;  4HM2 A;  3TGU E;  5KLI C;  1ULI A;  1KB9 E;  2D2C D;  2HMN A;  3GOB A;  1SJG A;  1WQL A;  4PV1 D;  2GBW A;  2NUM A;  4HJL A;  2QJK C;  1NYK A;  5KLV E;  1O7H A;  3GTE A;  4HM1 A;  4QDF A;  2XRX A;  4NBE D;  3EN1 A;  2NVF A;  4EMJ B;  1G8K B;  1VCK A;  5KKZ C;  1PPJ E;  3AZC A;  2YVJ B;  3H1K E;  1G8J B;  2BCC E;  2CKF A;  4AIV A;  1NTK E;  3VMH D;  3CXH E;  3GTS A;  3GZY A;  4OGQ D;  2A06 E;  4HKV A;  1EG9 A;  2NWF A;  1O7W A;  2HMJ A;  2Q3W A;  3L74 E;  1O7P A;  4H13 D;  4H44 D;  5AEU A;  3CX5 E;  5HL4 A;  2YIU C;  2XSO A;  2QPZ A;  1O7M A;  2I7F A;  1O7N A;  1UUV A;  3H1I E;  4HM3 A;  2B1X A;  1O7G A;  3VCP A;  3VMI D;  2ZT9 D;  3FOU A;  2HMK A;  3VCA A;  1ZRT E;  2E76 D;  2IBZ E;  2YFJ A;  4AAY B;  1RFS A;  2NUK A;  2QJY C;  2E4P A;  4NB9 D;  1NDO A;  1L0L E;  2GBX A;  2HML A;  3VMG D;  3DQY A;  4QUR A;  1UUW A;  2JO6 A;  1SQQ E;  2JZA A;  4U3F E;  3GKE A;  1P84 E;  1NTZ E;  2DE7 D;  1VM9 A;  2XSH A;  1BE3 E;  3L70 E;  4HM7 A;  1SQX E;  2B24 A;  1VF5 D;  1JM1 A;  1KYO E;  3CWB E;  3H1L E;  1ULJ A;  4QCK A;  3L73 E;  3N0Q A;  4QDC A;  3D89 A;  4QDF B;  3GB4 A;  1BCC E;  4NBF D;  4QUQ A;  4HM4 A;  1L0N E;  3BCC E;  2ZYL A;  2DE6 D;  1PP9 E;  4NBB D;  3L75 E;  5CXM A;  2YFL A;  2BMO A;  3EQQ A;  4NBH D;  4P1B H;  3H1J E;  4NB8 D;  1SQV E;  2E4Q A;  3GL0 A;  2HMM A;  1SQP E;  1NTM E;  1RIE A;  3H1H E;  4NBG D;  2E74 D;  1SQB E;  4HM8 A;  5BOK A;  2BMR A;  2FYU E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...