4P2OA

Crystal structure of the 2b4 tcr in complex with 2a/i-ek
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
180
structure length
175
Chain Sequence
IKEEHTIIQAEFYLLPDKRGEFMFDFDGDEIFHVDIEKSETIWRLEEFAKFASFEAQGALANIAVDKANLDVMKERSANVAPEVTVLSRSPVNLGEPNILICFIDKFSPPVVNVTWLRNGRPVTEGVSETVFLPRDDHLFRKFHYLTFLPSTDDFYDCEVDHWGLEEPLRKHWEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Deconstructing the Peptide-MHC Specificity of T Cell Recognition.
pubmed doi rcsb
molecule keywords H-2 class II histocompatibility antigen, E-K alpha chain
molecule tags Immune system
source organism Mus musculus
total genus 33
structure length 175
sequence length 180
ec nomenclature
pdb deposition date 2014-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00993 MHC_II_alpha Class II histocompatibility antigen, alpha domain
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4p2oA02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 4p2oA01
1FE8H 1MI5A 5D9SB 2X4NA 4KTDL 3DROA 1IT9L 4H5SB 7FABL 1MIML 4UT6H 4PJAF 1EMTL 4FFYH 1OSZA 5DMIH 5DDHB 2BVQB 2N56A 4DVRL 3I9GL 3NGBB 1AY1L 2L0DA 4Q2ZB 5CEZD 4Q6IA 3THMH 3MC0A 2JJUA 4PLNC 4JVWA 3QEQD 1J0ZA 4KKNA 4YBQD 5FM8A 2NZ9C 3RGVC 3SDAC 2X4UA 4Y7MA 4D8PA 5J13C 3PHSA 4X6BA 5C9JA 3QUZD 1BBJB 2VLME 4LCIL 1GGCL 1TJGL 4XP1H 2BVPA 5CP3A 3UX9B 4U6YB 5CWSB 1XGQA 4WFGD 4K7FB 5JPMB 3L95A 2AW2A 1UXSB 2X4QB 2R1WA 4HKZB 3ULVE 2X4OA 5SWQB 3GIVB 3BEWA 5DLMH 3CDYA 2CDEB 1FAIH 4M7KH 1K4CA 4IMLA 1XF2B 4M1CD 3BKYH 1AR1C 5FDWA 3U0PB 3C08L 2YD9A 1C5DA 3VD7A 4IHOA 5C09B 5F7WC 4JFQA 4AJ0A 5D7JD 3X3GL 2C4FT 4NQUA 1E27B 4FNLL 4UB0H 1DBKL 3DETD 1YNKL 4NZDA 3RVTC 3TBSA 3MRNA 4NRXB 2BOCA 2R69H 4NHUB 4I0PD 2CDFB 3LN5A 4GRLD 1R5IB 4YWGH 2VITB 1HZHL 2HT2C 4P3WA 1K8DB 1MFAL 3EDFA 3NCBB 4XH2A 1LEIA 1I9JL 4KZEH 5BVPL 3MV8B 2OTUA 1CZ8L 2P8MA 3KS0J 4OCMC 4Y19D 4Q97A 2XA3A 3GBNH 4OLXH 2EC8A 4MAYB 3G5ZA 1P9MA 3DV6A 3QUXA 1SJEB 1MCCA 1L4IA 2GTZB 4V2CB 4RGMB 1CG9B 3VRLE 3JUZA 5ISZB 2D7TL 4HG4J 1P9MC 3JV0A 5DJ0A 4XVTL 3TO2A 1A22B 1F3DJ 1OF2B 1CLZH 3V4PH 2HFFB 1CI5A 1S78D 5MP6L 3PWVB 4U3CA 1FC2D 1BVLA 32C2B 5CZXD 2Q7YB 2WLZA 4WW2B 5E94A 3LS4L 4H25A 1V5JA 3BH8A 3GSVB 4NKMB 1BQLL 4R4FH 4JJ5A 4NQED 4NOBA 5GRUL 2VLJB 2YD8A 4OCRH 4LEXH 1VACA 2HVJB 4QXUH 1AC0A 3HI5L 4K2UL 4DOHE 3C09C 1G7QA 3E2HC 5TFSL 3IFOB 1VFAB 1EHAA 1A64A 1FNLA 1V3LA 1HWHB 2C1PB 3RUGB 2EYTA 2ICWB 4OLZL 1KPRB 3FQNA 4O58L 1WT5C 3IJHA 4PBXA 3ROOA 2IPKB 4XVJL 4HLJA 4G8GE 4ZS6D 2AK4E 3RVWC 2X1OA 3MUGA 5IV2A 1LE5B 1F42A 3GKZA 4FFVD 5HHOA 3IFLH 2ZPKL 3IJSA 1BJ1J 3TP4A 1SEBB 1U8OA 3WNPA 2BOBA 1IC5L 5GS1B 2WWMD 3SQOH 1BPVA 3REWA 1S5HB 3RVVD 2FD6H 5E9DD 5IVXB 5J12B 5E6IA 3QXDB 4TSAH 3CZFA 5F96L 2VWEE 3H3BC 2I07A 3ULUH 4N0UA 3IETB 4DEPB 5GRZA 3QNXB 1MF2H 2A83B 4ZSOA 3C5SA 3SE8H 5CAYB 1A8JH 1NC4B 3QPQC 1NMCB 3SJVD 3SPVA 1HEZB 1KLUB 3N1MC 3P3YA 1IGTB 2ESVE 5BO1L 3SDCB 3SDYH 3W0WB 4MX7B 1S7QA 3SN6N 4D0CA 1KFAH 2XWBA 4EUPH 3DUUB 1IAIM 5I74C 1MAML 3BP4B 1NCUA 3HUJA 4FG6C 4R0LC 4M6ML 2JELL 5T1MA 1CE1H 1A6PA 5F44A 3AFLA 1T7YA 4NKOB 4MNQD 5A2IH 1FFOB 3G6JA 1NMBL 1CIDA 4H20H 4UT7L 3VMOA 2NY6D 5EO0B 3T77B 3FTGB 1D5MA 2E7BA 3H8NA 4G9FA 1BZ7A 3D3VB 4J1UA 5B3NA 3DTXB 2IQAB 4YGVA 2VLRE 2VDNH 1HH9B 2Y5EA 3MRCA 4G7YL 1CFNB 1BIIB 2JJTC 1NCAL 4K9EL 1VFBB 4FQ1H 3WFEH 4PJHF 3QO1A 3TBVA 5HHVL 3K4DA 4KQ4H 4WUKL 2ZUSA 4KUZH 4LNRA 4AYFA 2Y06L 1CFVL 4YDKL 3ROLA 1Q0YL 5I16A 5D1ZD 2B5IB 5FYLH 3BD5A 5I1JL 2EZ0C 4J4PC 2MWCA 1M05A 2YWZA 4RWHA 2CPCA 3MLSH 2GAZA 4NYLA 4X6DA 5IHZB 1SY6A 3MNVA 2WUBL 4XHJD 3FO1A 4HV8A 1YEFH 3QXAB 1K5NB 1UT9A 3RWJA 3INUH 2CIKA 3D39D 1JPSH 1UYWH 2NXZD 3FB8A 2J6EH 5DJYB 2HMIC 1KN4L 2VXQH 4NQXA 4WTXA 1CFSA 1IILE 3ULUD 1AO7A 4LSDA 1S7WB 4K8RL 1FFPB 3BQUC 5EOTB 1PG7W 3BP6B 2ATPB 5FOJA 4HJGA 4UTBH 4LHUD 3T0EC 3DIFA 1HDMA 1LK2A 1S7TB 1TZIA 4WEUD 5TQ2H 3EYQC 1KENH 4I3GA 3OKYA 1AGCA 3O45B 5ANMA 1FGNL 3V8CA 3HN3A 5L2KB 1T1YB 5DD3H 1YMMA 3V5DB 3WS3A 2QR0B 1X5HA 1RZFL 4M61A 3O6LL 5IJVB 1NH6A 3HC0B 4Y16D 2F8VA 4M93C 4RISL 3K8KA 1A7NH 3KXFA 1RIUL 3SY0B 4JKPL 5E1AA 4HFUL 1CQKA 5EFIB 4PJXE 3BJ91 4JFDE 4LVHB 3G5YA 2P44B 3ARBA 1KCSH 4ZQKB 43C9B 5HYEA 5HVGB 2HKFL 2W0KA 3B9EA 3H3PL 3CMOL 3QBTB 4N1EA 1F13A 3JWOH 3MRQA 5C2BH 4X8JA 3T4AB 2DLIA 2WBJB 3QDGE 5I9QB 4MNHA 1JZ2A 1OVZA 3ZYJA 4XWOC 4NWTH 4OKVA 3RVXC 4GG6F 4YK4B 1F6LL 3VRLF 1U92B 3B2VL 3MJ9A 4PRAB 5F70A 3O0RL 3LKOA 1Z3GL 2J2ZA 1GOGA 2BNQD 3VGDA 3FMGL 1HHIB 1M6OA 2BHZA 1YNLL 5MI0C 5FYLD 4BH8A 4GG8B 4X7EC 1F4AA 2YR3A 3QXUA 3AREA 3LDBC 3LB6D 3B9DA 1P53A 3K8MA 1IM9A 1F58L 1QVOA 3W81A 3OSKA 1IGML 4Z0BH 2O5YH 2BRRL 3K8LA 4GXVH 4RNRA 4FABH 5C08E 4O2CB 2ITDA 1B2WL 1GOFA 2CKBA 1B6UA 3EO9H 4PPTA 4KGJA 1HSAB 4YFEA 3CVHB 1GL4B 4XPBH 5FFLA 4LOUD 3P9LB 2X42A 2NCMA 4LCCA 5SX4I 5D2NB 3OAYK 6FABH 3BE1H 4KAQH 4F7CA 2LU4A 2ADFH 1KEGH 3VU2A 4WDIA 3DXAD 5KSBB 1QPPA 1T4KA 3NZ8A 1RUPL 4HKXA 1OD7A 4EKXA 3UZVB 2C3WA 4PB0L 2Z0BA 1E0OB 5FK9B 5C0EA 1DFBH 2A0LD 2VXUH 3NAAL 1EO8H 4F2MB 3VD9A 2X44D 2R1YB 4Z7UB 1JRHI 1MCQA 4UBDC 5FCSH 2VZ3A 2ZCLH 4UILH 3QIUD 2DQTL 5FO7A 4R26H 4KK9C 2ARJA 1AGFB 2CIIA 1DQTA 4NPYB 5D7JB 5DD1L 5SWSE 3PL6A 5KVFH 4PGBB 4LRIA 1F90L 2E6JA 1MFDL 1S9XB 2R9HC 1KPUB 5FUCC 4RAVA 1R3LB 4I0PB 4OTXH 2FR4A 4RQQB 3FHAA 3CX2A 4JRXB 4FFZL 4RGNE 5HHPA 4RIRB 3U36B 4YFDB 2UVFA 4PJFE 3QCTH 2VDQH 2GK0B 5I18L 1DUYA 4UTAL 3FB7B 1DBBH 3GGWA 3HG1D 3W9DA 5MEQB 1PY4A 1YEGH 3IDXH 3B83A 1KCRH 1RJLB 1NJ9A 2DDQH 3W39B 1BM3L 4PS4L 3QIBD 5DEZA 1N7MH 4CMMB 5I6XC 3T1FB 4PY8J 2V7NB 3OXSB 5CUSH 1I9EA 3VI3E 4TUKL 5C0JB 1A6AB 3GSXA 1IQDB 1QFUL 1HYRC 3QEUA 4PG2A 2O61A 2XZCL 3NA9H 1YEKL 3KPRE 4FQPA 3RX8A 4HMEA 4UU9B 4I77L 4UOW0 4V1DD 5F9OH 4NQEB 2ADIB 4P3DA 5EPMA 1TQCB 1KGCE 4YHPB 1YUHA 1L7TH 4M1DL 5MENB 1K4DB 5ECJE 5MERB 5HJ3B 5BRZA 1VFUA 1P7QB 1KLGB 1XCTA 5KVGH 2H32H 1J8HA 4LKCA 4EBQL 1G7PA 1IJ9A 1A2YA 1FDLH 2X70B 3TCLA 5DMJB 1G7IB 5IW1A 4ELMF 1WFOA 2B2XH 2NXYC 2W91A 4N9OB 4ZUUA 2DIBA 1OM3L 5FYKH 3WUZA 2IADA 1RUQH 1VFOA 4R3SA 2AJYL 4NM4H 5DK2B 5EBMA 2Y7QA 2B0SL 4HHAA 2VZOA 5JOPD 5KZCD 4XC3L 4OZIA 1YEDB 3FZUC 3GMLA 3MRGA 4HD9A 1ZHNB 1MPAH 5E9DB 2VMFA 3BP7A 5JQ6H 5DFVD 2YUWA 3EYSH 5IMLB 5KJRH 1CDIA 2OCFD 3C87A 3MYJA 3WJJA 1EO7A 5C0DA 3JTSA 5GGVY 4P2OA 4KH2A 2VDOH 3C2AH 5CFHA 1QLEH 3SJVB 3WJLC 3WJJC 3MTRA 5J9PA 3I85A 3RNQB 2UZXB 2HH0L 2J4WL 1F02I 2HJKA 3JVGC 3U1SL 1MAKA 4JM2C 5KS9E 4U1LA 3E0GA 5HDQH 4X6CF 3QDMA 3N1FC 3V0VA 3D5OF 5D1QC 4PJXF 4NO2A 1HQRA 1RU9L 4O02L 3GRWL 3O6FD 1F4HA 5CHNB 5HHME 3MLZH 2CUIA 1WF5A 4ZD3H 4MNGB 4N5EC 3MX0A 2HTKC 3BZFB 4XBEL 5DJZB 3HZKA 2Y6SD 1AKJD 4IM8A 4ZFOL 5A2JH 4KK6D 2VKWA 5DJDB 3Q0HA 5D93C 1FNGB 1ZWIB 1C08A 2Z8RA 4IJ3C 1VGEL 4XCNA 1A3RL 3AS1A 2JB6B 1G7HB 4PGZA 5IM7A 3SDDA 5DHVB 3EO1B 3WUWA 4FRWA 2MSPA 1MRCL 4O00A 3T0BA 3QCVL 5I17B 3HS0B 4ZS7H 5IFHH 4YBLC 4PTTA 3I50L 2ZCKH 3IDGA 1R0AH 3D2UD 3VD5A 3T04D 5F1NA 3FQUA 4DCQB 3PJSB 5JW4M 3C6LA 2A6KB 2YBRB 4OSUL 5B4MD 5EC1A 3F7YB 3QB7C 3TVMC 5TF1H 1ORSA 5CBAA 4QHUB 2XIDA 2ZNXA 5EO9B 5FYKD 1GCFA 4QRQB 2DYPB 5D5MA 5KANG 2W0FA 3U30B 4RBPK 3D39B 5JO5B 2ICEA 3MUY1 2NXZB 1Y0LA 4JDVB 1YQVH 1A7PL 3U46A 4YX2H 3EOTL 4MCZA 1FVEA 2DQEH 5C07A 4AL8L 1ADQA 2A9NL 4J3OC 4LHUB 4ISVB 3BKCL 4BFBD 4HXAL 3V52L 1IE5A 2KQNA 3HHRB 4X4YA 3HC4H 4XCYA 3Q6GL 2RCSH 1M7DB 4JDZA 4IOFD 3PP4H 1ODAA 4X98B 4WI3A 4OZGE 3KYNB 1ZV5A 4LSSL 4LU5H 4EUPA 3UXFA 4RA3A 4WY7H 3WFBL 4Y16A 5FKPA 3TCXA 1OOAA 1QEWA 2EE3A 1EHLL 3VXTA 5HVFB 4X7FC 1N5YH 3CFEA 4MCYB 4J6RL 5DYOA 4K3JH 3WYRA 1BFVH 1MELA 4YEFA 3MRLA 4X5WB 3WUWG 3EIFA 3VXME 3GSNL 2OZ4L 5DK3A 2F53B 4BFEA 2YUVA 5EUKA 4P99A 4P9HL 5KSUA 1AHWB 2NY4D 4EN3C 3BSZL 5CJBA 1PSKH 1CXIA 3MACH 3MODL 5CMAB 5JZ7C 5H2BA 2PW2B 4OD3L 4IBLT 2IALA 4KRPB 4OFVA 4UNVA 1CE6B 2VXSH 3U7WH 3VRJA 2XQYK 1I8IB 5J57B 3DX6A 3KYAA 4OFYD 1OAKL 1QSFD 5LGJA 1KXTB 2IPTH 4S1SH 4BQ9A 4ZFFB 1PAMA 2I5YH 1EUTA 3KLSA 2EH8L 2XZQL 2BNQB 2RHEA 1B0RB 3ARSA 4WU5A 4I18B 4H0GA 1S5IH 3FB6A 3VXSD 2XPGB 2WAHA 2R2HB 4ORGA 5GIRB 3RL1B 3X11B 1UKSA 2W65A 4HXBH 3RNKB 2VLKB 1ORQB 3L9RA 4MJ6B 3WN5A 4QF1B 1G0XA 2QSCH 2VQ1A 2EDDA 5GJSL 5I30L 2YSSB 5D7IF 2IFFL 2LAAA 1I4FB 4AEIL 3P4OB 4NHCH 5FYJE 4Z8FH 4P23C 3AS3A 4ESKA 1JN6A 1UB6A 3UTPD 4TPRL 2Z31D 4CKVX 1J5OH 1J18A 1X5AA 2DQGH 3VGBA 3ARWA 4HAGA 1KB9J 1MFNA 1HHHA 3IFPA 4EUPG 3W5NA 3N9GL 2KBGA 3DXAA 2B4CH 4NDMA 4U1SB 1JCKA 5I66A 3W11C 1YNTB 5CZVL 1YJDL 3VG9C 2ED7A 2VDKL 3B9VA 4AM0B 4ODVH 3FT2A 4N1HB 4XPFL 1YN6B 3U9PL 1RIVH 4UNUA 4W6WB 2OL3B 5CGYC 5FIEA 3QQ4A 2OTWA 4P2QB 3RBSA 2DF3A 1CLOH 3F6LA 4WNQB 4EDWH 4IDJH 3GSUB 5EOQH 5BXFB 1V7MH 2X7LA 4O51A 2LU3A 3A6BH 1U3JA 5KS9F 2H41A 3QDHA 4FQQA 4FQJL 4XP5L 3T8XB 4PGDB 3VRIA 3ZYOA 3ZSTA 3MCLH 1DQDH 2PW1B 3MBEA 4XB7A 1I75A 3S4SB 3F12A 4PJDF 3SHSA 4GBXA 4JDTL 4NRYB 3W2DL 4LVNC 2H26A 3MBEC 1YPZB 1INDL 2O5XH 4BZ2L 1FG2A 2D31A 4I3RL 1FLTX 2KQMA 4E5XB 2GIYA 3HG1B 3I84A 4PRID 1CICC 3C8KA 5DQDH 4OQTA 1EEQA 4FP8L 5B8CC 5TDOB 3AU1A 4D9LL 3V7AE 1OGAB 1TDQA 3CFCH 4WEBL 3VFUA 2P5WB 1FZOB 1GGYA 2XTJD 3HZYA 3QIWD 3QEGH 3EOAB 1EAPB 5MEPB 5CJ5A 2RGSA 4LP4A 4ZTPL 5D1XD 1ZHBA 2DRUA 3IKCB 1AXSB 4MHHG 3Q5OA 4JAMB 3LD8C 1KJVA 3VGAC 2RJMA 2NW3B 4RDQF 3TNNA 3TA3D 1T7ZA 4WO4A 5E8DH 4M6OL 2BMKA 4U7SA 3QDJE 5I1DB 4V1DB 4XPAH 1JFQL 1S3KL 2BDNL 3ULSA 4HUMB 4KQ3L 2ZZUT 5SX4H 4BQ6A 1UWEH 3LKSB 1KEMH 3GM8A 3G9VA 5F89A 2VAAB 4ODUA 5DHYA 2EDWA 1CGVA 5JDSB 1Q9KB 5LXGH 25C8H 3GZKA 4TULH 3U7AA 5CILH 1KN2H 2AJZA 4NKIH 1FHGA 2EH7H 2YZ1A 1M71B 4XNXH 1QR1B 3HZVB 4TTGA 4NQVA 3MCKB 3IJYA 4KKLD 5IIEA 4I2XB 4JG0H 2BY3A 3BPOC 4CW1B 4OCWL 3EO0A 2H6PB 3ZKQD 2H1PL 5BV7H 3B2UD 5E8EA 1JRHH 3PQYA 2DI8A 3CXHK 4ZUSB 1MQKL 2P4AB 4DZBA 3C6SB 2AABL 1PX3A 5A43C 5AUMA 4XBGA 3TESA 4Y0GA 5CJOH 3V4UH 1G1CA 1JNLL 1AGDA 3IDIB 2YHGA 3OR6A 4OD1L 8FABA 3MLXL 3KPTA 1J1PL 4LSQH 1J1XL 2BVEA 2ZKHH 1C5CH 1RUAH 2WMPA 5TH2B 1BEYL 3RWFB 3OF6D 2J5LB 3O6FB 3LRHA 2ID5A 5I8EB 3MRDA 4R2GD 1KB5H 2WV3A 1A6WL 2AKRA 4KHTL 1A7OL 3O2VH 3VFSB 1AKJB 2NY7L 1JWSB 2J88H 2BZDA 4WFEE 4BFIB 1KTLA 1EFXD 4HZAA 4TNVK 4HUNB 4JHAH 3BD4A 3W9EA 2UWEB 1M7IB 4L4TA 5GGVL 5ITFB 1FFNB 4OD2B 2X4PB 2VDRH 5IJKC 2NY1C 1E4KC 4KHXH 1HH6A 1MIEL 1UJ3B 3MRRA 2BSED 2YKLL 3WS6A 3O8XD 5DC0A 1AC6A 1H3WM 1KC5H 3MJ7B 3QXVA 3LKRB 3D2UB 4PV9A 3N85H 3WXWH 5C0GB 5HPMA 4Q7DA 3AAZA 3WS6C 2H32B 1N59A 1XMWA 3EDKA 4WUUD 4DKEH 4PJ7A 1JPGA 4BSWA 1CF8L 1HXYB 4Q6YA 1JNJA 1U91A 3GBLA 5EZJA 4Z76B 2M8XA 3KYKH 5E1HB 1JTPA 2ZUXA 1D6EB 4XZUA 1A6TA 4ODTL 3WXVH 1J1OL 3MOQA 4OGAC 4QY8A 5IK3B 3UO1L 1H8NA 3LMJH 3VXRE 1JTOA 3MO1B 2PYEA 3BUYB 2HWZH 2FECI 5K9JH 1S7XB 5DTFB 1SEQL 4TVPE 2FLRT 2VERN 1WBZA 1GGTA 1CXKA 1P2CA 4YHNA 4QLRA 1JUFB 1J05A 4G6ML 1SY6L 3LEYL 5DUBB 1EXUB 3WV0A 1SBSL 2BERA 1MJ8L 4L9LA 2I26N 2E7CA 3HC3H 35C8H 5CD3B 5I1GL 3K4ZA 3D0VB 1RUKH 1U93B 5CLTA 3DMMA 3DBXA 1FZKA 3JZ7A 4HBCH 5IB4B 1MCFA 1UQSA 1WZKA 3PIQA 1ZTXL 3P73B 4P4KD 3SKJH 1DQJB 4DOHB 3H9SE 2W60A 4DVBB 1P5UA 5JHLL 3OB0K 3QNYA 2IAND 2XWTB 4JFEE 1YN7B 5BJTA 2RIKA 5CCKH 1EV2E 2VC2L 2KH2B 4R4BB 4Z78B 1I1AD 1XGYH 3BO8A 3HI6L 2B20A 4U2ZA 3QUYC 1PQZA 1ZHKA 4JKMA 1UXWB 2EDOA 5I8OH 1XF4B 3BRGC 3HA0A 3DVNB 5FO9A 2FH8A 4YXHL 5IMMB 1G9NL 3T0EE 4JB9L 1D5BB 1KIRB 4O4YH 4W4OC 4BK4A 4R6UA 5DS8B 3LRSA 4W81A 1ND0A 2E8ZA 5EBGA 2BCKB 2V2WA 3UTSA 4F7MA 1T22B 5IFJA 1I7UB 5LBSH 1NPUA 4CMHC 3EZJB 5D9SA 3FJTA 4LCWA 4H5SA 4DAGL 4MAUL 2AJUH 1CR9L 4I4WB 3OJVC 1U8JB 5DDHA 2AEQL 4D3CH 5DA0B 2FB4L 3E3QC 5A40E 3VXSB 1CS6A 2YXMA 4Q2ZA 3TYGH 4G6JL 3SDXE 2E7LA 5L2JB 4YJZL 1E6OH 3O6KH 2BRQA 2KUTA 4NJAL 3MJ9L 1CDHA 1YY8A 2E7LC 3FFDB 1MHPL 1YJDC 1YEJH 2XN9E 5IKCB 2Z31A 4HLZG 4U6YA 4RAHA 5CWSA 5JPMA 1ZE3C 1UXSA 3P30L 4KVNL 1ZLSH 4XP9L 3T2OA 2YPLA 3GSQB 1H5BC 3D85B 3GMQB 1NGZA 4YPJA 4OCXH 3AY4C 3ALXA 2VLRB 5AEAA 2DQHL 1KNOA 2BC4B 2CKBL 3T2PA 3CVHL 1ETZB 2NW2B 4OI7A 3O4OB 5FGSA 4ZMAT 1U36A 1Q1JL 4JGJA 2EDYA 3P4MB 2A1WL 1X6LA 1MUJB 1YECH 2XG4A 5I19H 4MDIA 4I5BB 2CLVA 1HE7A 2W9DH 3KLHD 1A6ZB 4FFWD 4E42B 4Y89A 1K8DA 1FBIH 5F1SA 5DEFB 43CAB 3OKEB 2FATH 1B3JA 3ET9F 1IL1B 4WENB 3O2WH 3HNSH 4MAYA 3MLUH 4PJ9A 2GTZA 2NY5L 1CG9A 5ISZA 5IT2L 4MAYC 1S9WA 4MB3A 4FQ2L 4KROB 3NH7H 5ICXA 2QLVB 4XTRD 1EUUA 2NR6C 4RGMC 3MXWH 5A3IC 1XEDA 3FB5A 2EYRA 2P8LB 4PRIB 5INCB 1W72H 32C2A 5E2WL 3HE6B 2Q7YA 1GC1L 2D7PA 3MUZ1 1BGXH 3JV5A 1CBVL 1JGEB 1X7QB 3MV01 1X4YA 1C5BH 1A3LH 2JTDA 3B9KA 2XTJB 3GSVA 5DMGD 5FUCE 4WW2C 3T08A 5DJCB 1A6VH 3QFJD 2VLJA 1S9YB 3QQNA 4ONHB 1G0DA 1VKXB 1M4KA 5F93C 3TA3B 4DN3H 1FE8L 2BHYA 4ETQB 3DUSB 5KSAD 4LIQH 3FFCD 3ESVF 1IGJB 4UT6L 3C5ZD 3HUJF 3OX8B 4FFYL 3DVGA 4AMKH 3BN9C 3QDAA 2ZCHH 2DL2A 2IMNA 2QADD 1FG9C 2B7DT 5ESAA 2EKSB 2QSVA 3G6JF 1SEBA 5GS1A 2DJ4A 1S5HA 5IVXA 3QI9D 3QXDA 5SWZA 5DF0A 3FO0H 5GS1C 5TE7H 3NCJH 5J12C 4P46D 4XP1L 1WC7A 4LAJH 3IETA 1ZA3B 2A83A 2UUDK 4OV6F 3BVNB 1UA6H 2IBBA 3IU3B 3G04B 1NC4A 4Z7VE 5SV4A 2EEBA 3WFCH 4AIZB 5FHBH 4DEPC 4NIKB 3LV3B 1HEZA 5F7DB 4CUCA 5T3ZH 1J12A 3LKNA 3SDCA 1NGQH 4IMKA 5DLML 3W0WA 5C08B 4U1MA 1NMCC 4M7KL 3VXUD 3BKYL 1FO0A 2NYYC 1IC4L 3SDCC 4XGZB 3DUUA 4Z7WE 2CO7B 3BP4A 2V9TA 5TQ0H 4RX4D 1A9BB 4JFXA 2X6MA 4PJCA 4HFWB 4UB0L 3ETBF 4DGYH 3OR7A 1QFWI 1MFBH 1EPFA 2BK8A 1F8TL 1YY9C 2R69L 3FTGA 5J1TC 1V3JA 4S10A 3OJMB 3QAZB 4HUUB 3MV7E 4MA3A 4ENEC 4R2GB 4YWGL 1OD9A 4P5TB 3VG0L 1NCWL 1YYLH 2WINB 1QRNE 3TEUA 1QSZA 1HKLH 5LKNA 1HH9A 4KZEL 1CFNA 5F9JB 1BIIA 1WBYA 3DHJA 2VKXA 5LGHL 3GBNL 1EFXB 1DN0A 5BW7C 4WCYL 4UINL 5I2IB 3DARA 4TTDC 1S9VA 4KUCF 3LH2H 5SWSB 1OGTA 3H7BA 1YMHB 2DD8H 4ZOCA 1CLZL 2P24B 3V4PL 1BD2D 2B5IC 1U8MA 3SDXF 1EEUA 4WUUA 1TZGH 2BJMH 4RGNB 5KOVC 2GHWB 1D9KA 4NQCE 3QXAA 3EJYC 1I1FB 4M7LT 2C3HA 1AJ7H 3AXLB 4PJFB 1T03H 4MD5A 1H15B 4R4FL 1AFVH 3RWHB 1O5DT 4OCRL 1A4KB 4LEXL 1D3CA 4QXUL 1X3DA 4XMKH 1RD6A 1T3FB 2ATKB 4HS6B 2HJFB 4WI4A 3E8UH 2FX9H 3GHBH 1DL7H 1P7KB 1S7TA 4JPIA 4X0KA 4CNIB 3IAGC 1CD1A 5T3ZD 2P49B 5GHWH 2IFGA 4LDOB 3IFLL 4QRRD 1IGYA 4QT5B 1DLHB 4L1DA 3O45A 3U6RB 1I7ZA 2VDMH 1BQUA 1VENA 4MJIA 2Q76B 4U1KB 3V5DA 2QR0A 4LLQA 2DQFA 2FD6L 2JCCF 4TSAL 1EJ6A 1R5VB 1YEEH 2CLZA 3K80A 4P4KA 5IMOB 1U8KB 5EFIA 3ULUL 4UOW1 4Y1AE 2OI9B 1MF2L 5D71L 2Y23A 3SGDI 3NIDF 3SE8L 4PTUA 4LPTA 4HUVB 2EDHA 2VISA 4ZQKA 1W0VB 43C9A 1I1AA 1MFEH 1ADQL 2IAMD 1T5XB 4N8CL 4Y4KD 2A74B 1JGUH 3BXNA 5ESVB 1ZVSB 5K59E 3SDYL 2WBJA 1CDUA 1T1ZB 1FLRH 2G9HA 3L6FA 4POZD 4TQEH 2FDBP 1KFAL 1JWUB 2WBJC 3CSYB 5I9QC 1U92A 5IG7B 4ZPTA 5SX5H 4LK4A 3ARFB 2AXFA 4W70A 4YK4C 1HHIA 5DEGB 4QOKE 4LHJB 1CE1L 4KK8C 4GG8A 2ICWJ 3L3IA 4HUXA 3L5IA 4ZAKB 1KCUH 5EWIH 2AJSH 4B0MM 1SYSB 4MA8H 3O41B 3C5JB 3GMNA 1MCOH 3MV9A 3DV4B 4GT7A 4KY1L 5I75B 4JFFE 2VDNL 1ZT7B 4O2CA 1YDPA 5F8QC 4JY5H 5JIKA 1Y6MR 1RFDH 1L0YA 4WU7A 4OLWH 3WFEL 5BS0E 3ZSSA 1MWAB 3ZHLA 3VGEA 3P9LA 4KUZL 2PTUA 5HHMB 3L5XH 5E8PA 4QRPE 4R7DB 5B38B 5F8RC 5FYLL 3EDDA 4XX1G 3DLQR 3L5HA 3HE7A 2CDGA 4JY6A 5D2NC 2H2SD 3LQAC 3FO2B 3MLSL 4F8TA 3QUZC 2KDGA 4HPYH 3X13B 2LQRA 4PB9H 1OAUH 3WDIA 2HT4D 1LO5A 2YUZA 1DJSA 4PRNA 4F37K 4PGCB 3PG2A 3ESUF 5ID1B 1YEFL 5FK9A 4TVSa 4RSVA 4R4ND 4CU6A 1E4XI 3CC5B 3INUL 2D0GA 4QXTB 1IBGH 1JPSL 5F7YC 1UYWL 3L3KA 3SBWC 2J6EL 5CIPB 3EYVB 2CRZA 2VXQL 4YR6A 2R1YA 3MLWH 3S98A 4M1CC 2P43B 1JYWA 2V5YA 4QHKJ 1N26A 1GGIL 3R06B 3VXOB 3VI4F 4FQIL 3CX5K 4UTBL 2E9IA 1KPUA 5ERWB 4HIHB 5EOCH 4OFPA 5D7JC 4QXGH 3L3HB 4RQQA 4HKBB 5TQ2L 2AJ3B 3DETC 4JRXA 4PJEF 1KENL 4FTVD 5TE4H 4CVXB 4RIRA 3U36A 4Z7WF 7FABH 4I0PC 5DD3L 3L3OB 2AV7B 2YK1H 4GRLC 1Z9MA 2COQA 5ILTH 3LCYA 4J3TA 1NBVL 1K8IB 3BISA 1A7NL 1XFPA 3P4NA 4I13B 5HYJA 5IP4A 3I6GB 5MEQA 2Z8VC 1VDGA 1RJLA 3HMXH 3L3DA 3QNZB 3UYRH 1CD8A 4OZIF 1KCSL 5DO2D 3T1FA 3U83A 2MTPA 3OXSA 4ODWB 3QUMA 1MH5B 2XY1A 1PG7H 3MJ8B 2A38A 5FUZH 4PGEB 4PD4K 4WIQA 1A6AA 3O11A 3CFDB 1IQDA 5F3HA 2F5AH 4OZGB 1YA5A 3C8HA 2P45B 3MA7B 3PV7A 3OTTA 5DQJA 3KPNB 1T7VA 4LAQH 2QQLH 3QFJB 3ZE1E 2RBLA 4HGMA 3TIEA 3OKLA 4G8EB 4YHPA 3VWJD 5MENA 3DSFH 1K4DA 2W0LA 5MERA 2HRPH 4OF3A 4CRPA 1P7QA 1KLGA 3VFTB 5KSAA 1TQCC 3WHXB 1AGBB 4UI2A 5FCUH 1JV5A 2JK5A 2XKSA 3DO7B 4PUBL 5IROC 2KZ1B 3RI5F 4Z0BL 2O5YL 5DFTA 4GXVL 4GRWF 4FABL 4G43B 2FEEL 3NCCB 3ZMRA 3TZVB 3H3KA 4U49A 3EO9L 4WI8A 4ZS6C 4XPBL 1T66D 5DRWA 2HLFD 4FFVC 4POUB 4OZFH 4WV1B 1PLGL 3SCMD 2D3VA 2AEIT 1RZGA 2GUOB 5D2LA 2WWMC 1A0QL 4KK5D 6FABL 3BE1L 4KAQL 2ADFL 2FYYB 3KPLA 3SKMB 4X7SL 1KEGL 4BFGA 3ILPB 2VZTA 4I8DA 5EZOH 4LLMB 2H8PB 3VD3A 4BUGA 3GUTB 1RSFA 4APQA 5ICZB 3IKKA 3RNQA 2AJVH 1DUZB 1PZUB 1PFCA 2XXCB 8CGTA 3VXUB 1DFBL 5JHDD 5MEOA 2VXUL 1EO8L 2QQNH 1Q9LB 4D9QD 7CGTA 3VWKD 2XQYG 2NY3B 4QGTA 2ZCLL 4MNGA 4UILL 4R26L 4HMDA 3VFWA 2EDXA 5C71A 5HVHB 3BZFA 5KVFL 4X4XB 5DJZA 1BQLH 2E27H 5C0IA 4NN5B 1CFQB 1U3HB 1BZ9B 5FGCE 5DJ6A 4UQ2B 2QV2A 4PV8B 3EGSB 4BKLB 1W72A 4X80H 3T3MF 3HI5H 3VGHA 1FP5A 2JB6A 1G6RB 4Y5YB 4YDVA 1MCJA 5DHVA 2NY6C 5DMYA 1IM3A 3RY4A 4OLZH 4ONGH 1ZLVK 3QCTL 2VDQL 1SVZA 3V5HA 3HS0A 3B8YA 4PBVC 1DBBL 1KTDB 3TN0B 3PWUA 1YEGL 3IDXL 1KCRL 3GMMB 3OGCA 2DDQL 1HIMH 4W4NA 1ZHLB 4NKDB 1N7ML 2A6KA 1V3MA 3RTQB 4HH9A 1EO5A 5IBLD 2BSRB 3F7YA 4X8XA 4U2YA 3NIFE 1EGJH 1FZJB 4IRJB 5D1ZC 1BD2B 4F33B 4QHUA 2D7MA 2DYPA 5FB8A 2FIRT 3MZTA 4PR5A 2EDQA 4PRPD 4XWGL 1BOGA 1ZT1B 3UEZA 5FA4B 4I48B 5EU6D 4FXGB 2BHUA 3OKKA 1MCSA 5F9OL 5JXED 3V0WH 1WSST 2V7HA 2F15A 1UH3A 1L7TL 2R0ZL 4RWYH 3EYFB 3U30C 2E6PA 4NO5A 3FRUA 3RDTD 2NXZC 5C9KA 4S2SB 1BZQK 1IGFH 1JNHB 2NX5D 1FDLL 4PJAA 5ENWB 1JI2A 4PP2B 2B2XL 4KDVA 3JV4B 1RUQL 1INEH 1NMBH 1FGVH 2AEPH 3MRMB 5KG9B 3KYNA 2QKIA 4DKFL 5IESH 3S9DB 2FNBA 2XT1B 4DW2H 1MPAL 1UG9A 1Y18A 3QDJB 2Y4SA 5I1KH 4XAWH 5JQ6L 3SGKC 3PGCB 3IF1B 3OGOE 4G7YH 3P77A 4RFEB 3EYSL 5KJRL 5H94B 4JRYE 1BBDH 1JWMA 4ODBD 1UZ8A 3I6LE 3RL2B 2F53A 3K1KC 1XZ0B 1NAMB 1Y6KR 3WIIL 3EFDH 2VDOL 1QFWH 3C2AL 1QLEL 1CFVH 4YDKH 1Q0YH 4Y4KB 5EORH 4S11A 1CE6A 3SE3A 2CUMA 1LDSA 4AENB 1AHWC 4JM4H 1T0PB 5HDQL 3BUTA 4KRPC 1MLCA 4HG4K 2C1OA 5H35B 1U8NB 2BVYA 3MLZL 4ZD3L 2QSTA 5JOFB 1CN4A 1QSED 4KXZI 4LSVH 2W59A 4FQLH 1B0RA 3MRBA 4LPWA 5KN5B 5F9AC 1LGVA 1LWRA 3K0WA 2EXYC 4LLUB 3ARQA 4L3ED 1KN4H 2R0KH 2R2HA 5GIRA 5DVOA 3OXRB 3RZCD 5JIHA 1GOHA 2H45A 3RNKA 4I18C 1ORQA 3VJ6B 1WIOA 3ARGA 3M1BB 3HNVH 4QF1A 4K8RH 4ODHL 2PO6D 4YPGB 4WHTA 3HZMA 3ZE1F 1I4FA 3MMEA 2FZ3B 5IFHL 3FQRB 4ZS7L 3HLAA 2P5EE 2ZCKL 4U1NA 1R0AL 3ZO0A 4Q9QH 2GJ6D 2XKNB 4LBEB 4OLVH 4Z6AT 5C0CD 2GKIA 2KZWA 3WMSA 2CXKA 1OW0A 4LOUC 2HG5B 1X5FA 4U1SA 2X09A 4ZPVB 1EEYB 5TF1L 1YNTA 4M9PA 4WFHE 2D9QB 1L7IH 2ZOKB 3O4LE 1MCEA 4YHYB 4AM0A 3BFOA 2YOCA 5HHNA 3E3QE 2X4TB 3KWWA 1T1XB 2RFXB 4G6AD 2OL3A 1DEEB 1YQVL 4LGRB 4KV5F 2BNUA 1MJJA 4P2QA 3MGOB 3JTTA 5DWUH 5GGTH 4YX2L 3C60A 2A0LC 1TJIH 2DM3A 5C0RH 5CKAA 1WAAE 3ES6B 2DQEL 4HMCA 4UDTB 1B4JH 3BWAB 2ZSWB 5D7LD 5BXFA 1MJ7H 2FWOA 4JFPB 3FMGH 4F3FA 1YEIH 2DQJH 1XH3A 1QD0A 4YHIA 3TIDA 4NO0B 2RCSL 5K9OB 3F6IA 3PP4L 1AIFA 2WWKO 4LU5L 3JWOC 3S4SA 2DKMA 1N5AB 1HHJA 3F5WB 1HOCB 1QLFB 3MR9A 1A47A 4K7PX 4XRCA 3VXRB 4NRYA 1YPZA 1N5YL 1I1CA 4EI5D 2FL5A 4LSPH 4MD4B 3ZKMD 2BNRE 1BFVL 2HFGH 4LCUB 2HJLB 2Z8SA 3PF2A 4YGAB 4G8IB 2F54A 4ZXBA 4C56D 4XNMB 5TDOA 4LLYA 4KI5C 1OGAA 2XY2A 1IVLA 1D6VH 5C09E 3RP1A 3KYMA 3OL2A 1PSKL 1MVUB 3MACL 4K8RD 5MEPA 1FL3B 2VLLB 1T89A 1R3KA 4JHWH 4QWWD 2VXSL 4HCRA 3U7WL 3IKCA 1AXSA 3O3DA 4Y2DD 1X4ZA 3NFNB 4FA8A 5GS0C 1HSBA 3H9SB 2Z92B 2IPTL 4S1SL 5KTEH 1RUPH 5DURD 2I5YL 4HPOH 1LVEA 4PB0H 3CGTA 5I1DA 4LSRH 3MROB 3RWGA 1CGYA 5E08H 1B88A 1S5IL 1KXQE 5DRZA 1XIWA 4IS6B 2EIBA 4HXBL 3SKUD 1F4YH 1AD0B 1IAIH 3PWNB 2VAAA 2EE9A 1A1OB 2QSCL 2X4RB 2EEAA 1W8NA 1AD9B 4PP1D 5JLZB 5F97E 4ELKA 4TSCH 4PJIB 1MNUH 4Z8FL 3HZVA 3MCKA 3Q48A 2XTLA 4I2XA 4WWID 1RPQA 1MRFH 2PXYA 5A2KH 1WQVT 1E4XH 3KPQA 5F6IB 2DQGL 3ARXA 1NBQA 1OAZH 2HLAA 1B9ZA 3S4SG 4ZUSA 1S7VB 1UH4A 2B4CL 3QQ3B 2C5DC 3SOBH 4HH8A 3VFNA 5DFVC 2P8PA 3QFDA 3ZE0E 4N0FA 1BM3H 3FOMB 4YHKL 4ODVL 3O9WD 1QQDA 3RUGE 4YQXH 1RIVL 1A1NB 4JFOB 2DMBA 1FFQA 4P48A 3VDAA 3LN9A 3BMVA 3T2NH 1BHGA 2JJSC 4M00A 4Y4HB 1ED3B 3HMXA 3ZDXE 4MVBD 4U0RB 4OF0A 5I8EA 3TO4B 2DQIH 2FO4B 4EDWL 4JQXA 2J5LC 3O6FC 5EOQL 4WHYH 1V7ML 2F74B 3VFSA 5DK0B 2E9BA 4BELD 1JWSA 3A6BL 4HWZB 2DLTA 4F7TB 3ULVC 1XR9B 4BFIA 4U6HA 1FO0L 2DM2A 2Y6SC 5JNYB 3MCLL 1M7IA 2DIAA 1DQDL 1DVFD 1JGVH 5ITFA 1FFNA 4KK6C 2X89D 5IEHA 2X4PA 4M8QB 1UKTA 1RY7B 4HX1B 2QQKH 2G5BB 4F9PA 1JZ4A 2J8UB 4PJ8D 2R0LL 2O5XL 1KBGL 5K9KB 4CJ0A 1GGBH 1YEHH 4OIAA 3BW9B 4PJ5D 4C4KO 4QRUA 1HXMB 1UJ3C 2ZOLB 5DQDL 4WWKA 5C0GA 4LPXA 3DRQA 4NBZB 1CYGA 3CFCL 4Q9BA 3RX5A 4HS8H 3RFZC 3BDXA 1HXYA 3QEGL 4CBPA 1QBMH 4Z76A 3WIHH 3BP5A 1X5ZA 1D6EA 1DDHA 4PRPA 5B4MC 2QTEA 1WWAX 5EU6A 5IK3A 5E8DL 1JF6A 1T0MB 1DEDA 3O3AB 3MO1A 3D3VE 4MMXC 5DRXB 4JVPA 4G9FE 1G9MC 2CK0H 2HH0H 2EIEA 2J4WH 3IS0X 1S7XA 4HC1H 4TYUA 5C6TH 3U1SH 5AWNH 5HSFA 4IRZH 1OWRM 3R0MA 3RDTB 1UWEL 5IW6A 1QLRB 1JUFA 1KEML 1WIPA 4XNUH 1CDJA 3G6DH 4DGIH 5DUBA 2NX5B 1UENA 2YN3A 1C7SA 2G60L 4RA0C 2CR6A 2F9BT 5LXGL 3D0VA 25C8L 4TULL 3Q6FB 4XBEH 1U93A 1KN2L 5CILL 5T5NF 4NKIL 2EH7L 1CD9B 5IB4A 4XNXL 4LFHG 1QFHA 2DS4A 3H0TB 3P73A 1QPXA 4E0RB 4Q58C 4JG0L 5GPRA 1WAAF 5CINH 3NA4A 3U9UB 2XWTA 5BV7L 4FXKA 2LVEA 2XA8H 4ZUVA 4H1LB 2NTFA 5BQ7A 2GW5A 1LO3H 4G8GA 2AK4A 4XVSH 3RA7H 4PRHE 5TE6H 4Y4FB 5CJOL 3V4UL 5T1LA 3PWLA 4I1NB 4L8SC 4FXLA 4W6XB 2DQUH 4IDLA 3KPMA 4KPHH 1KIRA 1MHCB 1TFHA 2CKNA 3WSQH 4OF8A 2ZKHL 1WV7T 4XCFH 1HWGB 3WFDH 1C5CL 1RUAL 2NY4C 3WFHB 4H26A 4Z7OF 3IVKB 4HK0B 4KJQC 1T22A 2D9CA 1UKQA 5DMKB 3BDYH 2Y36H 4NC1C 3TJHC 2MOVA 4PJGE 4LLVB 5F9DC 5IB5B 3OAZK 3S3SA 4Z7VB 1QSEB 3LQZB 3KS0H 1KB5L 4I4WA 4I3SH 5ANME 4U31A 3CCHB 2ESVA 3RWCB 1JNNH 4JFHD 5FM5M 2HTLD 4L3EB 3I2CH 2J88L 3DX9B 3MLYH 5DJXB 4GAYA 2X9XA 4MQTB 5L7XH 3DYMA 2NQCA 2XICA 3EOTH 4HK3J 5L2JA 4JHAL 5CSBA 3KNBB 1F3DH 4IRSD 3OG6B 1NCTA 2FJHB 1BWWA 3FFDA 2VDRL 4RMRA 4HXAH 5IKCA 3WL9A 1AQKH 1GZQB 3ZL4H 4U6TA 5HYQB 5C0CA 2Z93A 2GJ6B 3N85L 3BZDA 3WXWL 5A16B 3D85A 5J11B 3GMPB 1NEUA 2HVKA 3MV7B 2OJEA 4HUWB 2Z4QA 1QRNB 3QUKA 2VLRA 2JIXD 1NDMB 4LCYA 4CN4A 4PGJA 1JMZA 3WIFA 1ETZA 3KYKL 1CXFA 4ZO7A 3BZEB 1N4XH 1R3IH 1QA9B 4KWUA 3HRZA 3WXVL 3CH1B 4X5XB 1JJUA 4WW2F 3RVUD 5DRNA 3LMJL 1EAJA 2RB8A 4MD0A 4P5KB 4P9HH 3UAJD 4JM2B 3CLEH 3PNWA 3NN8B 3AUVA 5I1IH 3O4OC 2HWZL 1MUJA 4U4BA 2X5PA 1BJ1H 5K9JL 1CFTB 3DSNA 2WLYA 1OLZA 4G3YL 1IQWL 5CEZE 1A6ZA 3ZE0F 2H3NB 1XGTA 3RAJH 4KKCD 4E42A 3QEQE 5EU3B 5D7LB 4NQCB 1VADB 5DEFA 43CAA 4ELMA 3OKEA 3HC3L 3RUGF 35C8L 1IL1A 1RUKL 4LGPB 4TUJB 3E1F1 2OR7A 3IXTB 4HBCL 4WVRA 1WITA 1Z5LB 5C0BD 4QHNB 4WFGE 1CL7H 5IF0A 3GSWB 2AVGA 5KSBE 3SKJL 5F71A 1TVHB 1Z0MA 4EI5A 4GKNA 3KPPB 4BH7B 1CIUA 1LP9E 2VH5H 2C3VB 5CCKL 5IVXF 5GJSH 1PKQA 3P0VH 1XGYL 4AEIH 2V2TB 5FYKU 4C56A 4KXZH 4KROC 5INCA 1VGKB 2WK2A 3HE6A 4Z7UE 5KSVB 4GO6B 5EUOB 5I8OL 4L4VD 1X7QA 5D6CA 3MRPA 4WGWB 5DJCA 4GW5B 4O4YL 3JWNC 3UTTD 1OAXH 3N9GH 4NQDD 4P5MB 3DYPA 1UACH 4ONHA 2XTJC 3VMNA 4X7TB 3QIWC 1VKXA 4N68A 4Y2DB 4HT1H 4Y1AB 4PJXA 4E41D 5LBSL 4JFDA 5GRXG 5DURB 4ETQA 1LILA 5HPOA 5HI4D 3TA3C 3RY6C 5HGAB 4F58L 3QUML 3OX8A 1X5JA 3U9PH 3KPOB 2UVEA 1JHLL 3QDGA 4P2RD 4R90H 4Y19E 4NOFA 3UTQB 1UJTA 1A5FH 1CT8A 4JO2L 4MJ5A 4CJ1A 1U8IB 5ICYB 3IXAB 3O6KL 5F7MC 2B4CC 1HI6B 1C12B 1E28B 3UTOA 1EFQA 2PTTA 5C6WH 1YEJL 1OAYL 3CXDH 3CDGB 4MLSA 2RAMA 2FX7L 3QSKB 2R39A 4OUUB 1LD9B 2DTMH 1ZLSL 2DWEB 3IU3A 3G04A 4QYOB 4AIZA 4P4RA 4F7PA 3VE0A 4BM7A 1INDH 4JFFB 5C08A 4NQEE 3SO5A 4BZ2H 4CN1A 4I3RH 3OKDA 4GS7B 4RMWA 1ZA6B 3KPSD 4QHLB 1BQHB 3LPWA 5BS0B 1KJ2A 4XGZA 3O3UN 3Q3GB 1OP9A 4NGHH 4FP8H 3RIFK 3FCTB 4OLYL 5LVEA 5DJ2A 1MHHB 3GSOB 2UYLB 5LJYH 3O9WB 4S1RL 1A9BA 3FHQA 4ZNCD 1O0VA 5I19L 3HMWH 4ZTPH 1GPOH 4NWUH 5T1DL 4H8WC 1A7QL 2W9DL 3O81A 4HUUA 1RI8A 4B53A 4L4JA 1FVDB 1S7RB 2WINA 5E9DE 3VXQB 1MI5D 5I1AB 1RHHB 4R2GC 2FATL 4P5TC 1JI1A 5F9JA 1JYXA 3O2WL 4XNQB 3HNSL 1S9KC 1UEYA 3MLUL 4P59H 1WCBA 4MB5A 2NLJB 1WFTA 1RZJC 2JF1A 4L29A 1QKZH 4UQ3B 2NZ9D 3RU8L 3SJVE 4DQOL 3ARDB 2AXGB 3NH7L 1YMHA 3MXWL 5FECB 1A4JB 2P24A 5HGBB 4TN9A 1L6ZA 4PJ5B 1OB1A 1R3JB 1WWBX 1W72L 3O8XC 4MWFA 1BGXL 2XYCA 5C0AD 1C5BL 1A3LL 2CH8A 3FN9A 3QZWB 4JPKH 1ITBB 2RR3A 4PJFA 2OR9H 1A6VL 3PHQB 4F9LA 3RWHA 1JHTA 1AR1D 4MNQE 3KVQA 3HAEB 5TDPB 3MRHB 2R4SH 3TNMB 1UCTA 2LU7A 2OR8A 3H42H 3B6SA 1T3FA 3D9AH 2MKLC 1KB9K 2X4SB 2Z35B 3FT4A 5CSGA 4LIQL 5JTWA 2VN7A 2WANA 2EC9T 3BGMB 2X05A 4CNIA 5ID0A 3FONB 2ZCHL 3EFFB 3IDNB 4K3GA 3M07A 4RZCB 4QT5A 2V2XA 1FYTD 3U6RA 5JR1L 3KPRA 1BAFH 5J4MA 1EDQA 2PYFA 2DKSA 3TBWA 2Q76A 1NFIB 5CJ8A 3FO9A 2HT2D 1FCCA 1I85A 1A6WH 1Q9OB 2UZYB 3LN4B 1R5VA 1KIPB 5FF6B 3UPAA 3FO0L 3V6OA 4YHLH 1KJMA 5TE7L 5BZDB 2P7TB 4QCIA 4LVNB 1UA6L 1MCDA 3TBTA 3WFCL 3QUXD 3L1OL 2OI9C 5FHBL 4J3XA 2X9WA 3VMPA 2A74A 5T3ZL 1CICB 4JKKA 1ZVSA 3NIGE 1NGQL 3D39E 5ESVA 4Z7NE 1T1ZA 3REVA 4L8CA 2MFNA 4NQTA 1WCQA 1NBYA 3QP3A 2WIMA 3CSYA 5CSZB 1CU4L 5IG7A 1WZMA 2PCPA 1EHNA 4L5FL 2YA0A 5DEGA 5F72S 1Q9WA 5TQ0L 5J7CC 5JORB 1J0HA 4DGYL 3LKPB 3ARFC 3MFFB 1MFBL 3S5LA 4ZAKA 2APBA 3VFOB 2DWDB 5I1LB 4Z7UF 1NGYB 4LPCA 5IFAH 3C5JA 4NUJB 1YYLL 4EDXB 1WEJH 1BLNB 1HKLL 5I1HH 2NY2D 5KS9A 4X99B 4HGKC 3WIHA 1SEQH 3BJLA 5I75C 4GQ9L 5GSVB 3VD4A 3TJEH 4YHOH 4G6MH 4PJDA 5B38A 4IRSB 5HHOD 5TJWK 1SBSH 2HN7B 3LH2L 1WLHA 1BECA 5HVWA 5I1GH 3B3IB 4HC1A 2YC1B 2DD8L 5FGCB 5E6ID 4R7NB 1L9NA 2N7BA 3FO2A 5GGUA 4C83A 4OZHB 5EO1B 2ZUWA 4MHHI 1TZGL 2BJML 3I6KA 2JIXA 5JHLH 4KGLA 4AH2A 3VH8A 4OM1H 4PGCA 3UPRB 3MNWB 5ID1A 1TZHA 2BNQE 4LSUH 1T03L 1CXEA 3O6MH 4NZRH 3CC5A 4QXTA 1AFVL 5FYLE 5CIPA 5ELIA 1U0QA 1N64H 4WHYG 4ZFOB 2GFBA 4XHQA 4XMKL 2MKWA 2DTSA 1G9NH 4MGXA 4JB9H 5EU5B 2Q8AH 3VXOA 3E8UL 4X4ME 3GHBL 1KCVH 1DL7L 1WBXB 5D72L 4K55A 3EDJA 4G9DB 2GYSA 5GHWL 3GHEH 2AJ3A 3KDMB 3U7YH 1FL5A 1XF5A 4CVXA 2VDML 1GIGL 3JWDC 3UDWA 3FN3A 3S5LG 2YEZB 5IR1B 5BZWB 3KLHC 3L3OA 1CR9H 2AV7A 3GJFB 1YEEL 3UDWC 1HNFA 3WE6A 3EYOB 2C26A 5C0BB 3MRFA 4PD4J 3DXAE 5JIIA 2WP3O 1NEZB 2AI0L 3PHOB 1QBAA 2EZ0D 2W92A 3MJ8A 1I8LC 2CRIA 3WLBB 3P2TA 5CJQL 2IC2A 4M3JA 1N8ZA 4XBPB 1FLRL 1P1ZA 4M8VA 4TQEL 4XTRC 1FSKB 4L4VB 1JVKA 4GXUM 1GJIA 3KPNA 1NC2B 5FOBB 4NQDB 5E2UH 2C4XA 1T2JA 3VH8G 4E41A 1D5ZA 5DMGC 4LMQI 1IMHC 2E6QA 4AIXA 4N8VB 4EQ2A 4JRYB 3MNZB 3TYFA 3VXMA 1KCUL 1OTTD 5EBLB 4HDIB 3V95A 3WHXA 5EWIL 2AJSL 4MA8L 3U79A 3AVEA 4MDJA 5IB1B 2AS5M 4LF3B 1LO0H 1MCOL 2FCBA 5HGDB 1LEGB 4JR9L 4RDQG 1AO7D 5IBUB 5KVDH 3TZVA 5CBEB 1DQQB 2LVCA 4JY5L 4U7MA 4HCRL 4Y5XA 1L0QA 4GKZA 3HG1E 1RFDL 2MHAB 2GI7A 4L3CB 4OLWL 5B39B 4XCEB 4WHCA 2DM4A 5FEBA 4GW1B 3L5XL 4PFEA 4XVUD 3GSNB 3CPLB 2MQCA 3CFJB 1F2QA 4M1GH 4JO4L 3MRKA 4RMSA 4KUCD 1U8PB 4FQHA 4WV1C 5DJAB 1YMMD 3QI9C 5GGRY 1SMAA 1TCRB 2FYYA 3SKMA 5CEYB 2DI7A 1EVUA 3ILPA 5JW4Q 1FIEA 5J1AB 3KXFD 5ADOL 4JHZA 2FECL 4LLMA 1OAUL 2H8PA 3SO3B 4N1CA 4JY4A 4ZNEE 2JE8A 3QUYB 3ARBD 4FQ2H 2IH1A 4V1DE 3NCFB 3O3BA 1IARB 4YDJB 1IBGL 5DFWH 2YD1A 3KPSB 2FGZA 4JKWA 3MQIA 1T1WB 2W9EH 3BH9A 3MLWL 3RVXD 5EZIL 1GC1H 1WUNT 1P69B 1NGWB 1ZEAH 4BQCA 1CBVH 5FAAA 1L6XA 3Q2CA 4IIQA 5FUOH 2VIRB 2G75A 4X4XA 2H9GB 2NY3C 1H0DB 1MCBA 3ALPA 5IMKB 1U3HA 3NIGF 4UAOC 1BZ9A 1CDCA 1KT2B 4Z7NF 4K94H 4UQ2A 5EOCL 3EGSA 4BKLA 5HVHC 5JOPE 5C92A 4JPWL 3CSGA 3CD4A 1PW3A 4NN5C 2VZUA 3BPNB 2DAVA 3O4LB 1JK8B 1G6RA 1TXKA 3NPZB 5TE4L 4M5YH 2YK1L 3ARED 3OQ3B 2N1KA 4Y5YC 5ILTL 1MCLA 1IM9D 1J8KA 1OSZB 3BHBB 5IVZA 4U05A 3TN0A 2GCYB 3RGVA 1D7FA 2J12B 4FN0A 3SDAA 3HMXL 3R8QA 5E4IA 3UYRL 2CRYA 1P4LB 4NKDA 4TSBL 3PWPD 1QACA 2QBWA 3TN0C 4Q6IB 2DQDH 3BGFB 4GMSH 2FEDC 1PG7L 1FZJA 1R5WA 5FUZL 4H0IA 3RTQC 4F33A 4D8PB 1H5BB 5C9JB 5J0BA 2F5AL 3B5TA 5C0AA 3WNNA 3N50A 4IRJC 4GKOA 4LLAA 1ZT1A 3L95B 4I48A 2NY0D 1QG3A 2R1WB 2M2DA 4LAQL 5CEXB 5LWYL 2QQLL 5T33H 3S36H 2BNRB 2R56H 3DSFL 3BEWB 2HRPL 3VFVB 3F58L 1IC4H 4KKAC 4S2SA 5FDWB 2UWEE 3BAEL 4KK9D 1JNHA 5FCUL 3SQBA 2VZ1A 3QEHB 1AQDB 5J6GA 4IHOB 3C8DA 4PP2A 4JFQB 4FMFA 2APXA 1FYTA 3PL6D 2OXGA 2CMRH 4N0YH 4Z9KB 1F8TH 4TNVF 3P0YH 3GMOA 3TBSB 3MRNB 4N0CC 4U3HA 2BOCB 5DVLA 3HKFA 3VG0H 1NCWH 4CU8A 1W0WA 3BKJH 4OCNC 3PGCA 3IF1A 3GJFK 3MFGB 1IAKA 3I3EA 1JBJA 3D25B 1LEIB 5LGHH 2FLBT 2OTUB 5FYKE 1TQBB 1NAMA 3TH2T 5EZOL 3G5ZB 3DV6B 4UINH 4WCYH 1QP1A 5C7XH 3EHBD 3K2MC 4HKJB 1U3YA 1KYOK 1VEMA 5TGBA 5IHUH 2ZJSH 2AJVL 4GRWH 1MCWM 2R15A 1X5XA 2IAMC 1A7BA 4NO3B 4G80A 5H8DA 3TO2B 1IGIH 1JPTH 3NFSH 4Y4KC 4JCMA 2QQNL 3QH3B 4POZC 2JLLA 4JN1H 1EJOH 2VZVA 3ZTJG 5AD0A 5DJ8A 2R23B 3S34H 3E6FA 1HKFA 5E94B 2EDEA 3H7LA 2E27L 3WEXB 3BH8B 2GJJA 1F6FB 3OXRA 3WO4B 4JJ5B 4YDLB 4X80L 2E7MA 4XP4L 3LEXA 3VJ6A 1TCMA 4FQXB 1I7RB 1WT5A 4RFNB 5HD8D 5BRZD 4YPGA 1G7QB 1J8HD 4ONGL 2NXYD 1WTGT 2E8YA 1SJHA 3V7AG 2FZ3A 2EYTB 2SEBA 3D87B 2HAZA 4HJ0D 3IJHB 4XNYH 3BYYA 3VGGA 2NZIA 2XKNA 1ZGLP 4C55A 1HIML 3IJSB 2EICA 2FH6A 3EJZC 4CADB 3PDOB 5FYJU 3K2UH 3W82A 1YPZF 4JCLA 4NC1E 3GK8H 5E6IB 1EGJL 1DBML 2CK2A 4KI5F 4OFIA 2ZOKA 1QSFE 4U0QB 5D71H 4CVZB 2I07B 4N0UB 1NUNB 1MCHA 4ZSOB 4BSJA 3C5SB 1ADQH 2X4TA 3PE9A 3U0WH 1HYSD 4P2OD 2HKHL 1T1XA 3I75A 4N8CH 4YHYC 1A3QA 1XGPB 4XT1C 2I9TA 2WSKA 3SPVB 4NCDA 3V0WL 5J3HD 3VXSE 1DQMH 4R4NC 3MGOA 4RWYL 5MHSD 1S7QB 4RMQA 2APWA 4R0LA 2ZSWA 3QDMD 1IGFL 2ENSA 2XWBB 3SEPA 1G7LB 3V6ZA 1UGNA 4HK3N 2IPUG 4MQ7B 1IKNC 3G6AB 1INEL 4UT9H 3E6HB 1FGVL 2AEPL 5T1MB 3RWEA 3UTPE 5IESL 5E7FA 1QZ1A 3F5WA 1IEHA 1QLFA 3VXRA 3S37H 4DW2L 4PRDA 3QQ9D 4NZTH 4KY1H 2HFEA 4G9FB 1BZ7B 2JJTA 4RMUA 4OBSA 5I1KL 1AR2A 4J1UB 4XAWL 3SGEI 2ZUTA 1NL0H 3SDDD 3K81A 3ZDYE 3L7EA 3CFIC 1RJCA 4LCUA 4P9ML 3WNMA 3N06B 3MRCB 4XB8A 1BBDL 1LDPH 1T21A 4KKBD 5DC9B 4XNMA 3B5HA 3G08A 3LY6A 3EFDL 4J4PA 4JN2B 1QFWL 1BVKA 3A6CH 3TBVB 4XPHH 5DHXB 3F7VA 4JGUA 5DO2C 5EORL 3DGGA 3C6LD 2PKDA 5I16B 1NFDE 4JM4L 4Z7QE 4GFTB 2ORBH 2YMXL 3NFNA 4BQ8A 2OK0H 3H9SA 3BIAX 1YC8A 1ZGLM 4JFEA 4NYLB 4LSVL 4X6DB 3MNVB 4FQLL 3MROA 4NCC2 3FO1B 5I15H 5TDNA 4F15B 3QCUH 2AAVA 1IEAA 2R0KL 4IS6A 2CIKB 3BQUA 4KDTC 1ZLWH 1NKOA 2ICWI 4JRWA 3VWJC 3VXPA 4PRHB 5HY9B 1AD0A 4NQXB 5B3JE 2XI9A 3T0EA 1T0NA 3HNVL 3PP3H 1A1OA 1CFSB 1GGIH 1AD9A 1AO7B 5C07D 3ULVF 3BZ4B 1ZXQA 4FQIH 3T2QA 4G42B 2WUCH 1GYAA 4HJGB 5IOPA 2FSEA 4PRIE 4I0KA 3CH8A 1RZKH 3DIFB 1I1YB 1TZIB 1U42A 4PJGB 4Q9QL 2UWEF 4OLVL 5DD6B 2YZ8A 1AGCB 5ANMB 2XTJE 2L7UA 5F6IC 4C54A 4XXDA 1J0YA 2HLFC 1F6AB 1QNZL 1BREA 1I3VA 3QULB 3WS3B 1NBVH 4M61B 3QQ3A 3M17A 5LGKA 4HIIB 3M45A 4KK5C 5C0NC 1J0JA 3SDXA 1INQA 3BI9X 3IAPA 1L7IL 3FOMA 5E1AB 3QWOB 1BP3B 1AI1H 3G5YB 5JZ7D 3ARBB 2FHFA 3U82B 2MNUA 1A1NA 4D2NA 2XN9A 2I60H 5BCAA 3L7FA 5BOZG 5KBNC 1GZPA 4Y4HA 1ED3A 5DWUL 5GGTL 5C0RL 1TJIL 3TO4A 1A7RH 2EECA 4GQPH 1QTYT 1B4JL 4OKVB 5HBBA 4C57C 4Y4HC 4QHKI 2F74A 1MJ7L 5DK0A 4U0RC 3TO4C 3CDCA 2ERJB 5GGSA 1YEIL 2DQJL 4F7TA 3LKOB 1XR9A 3ELAT 2A6JB 3CFBA 1M6OB 4LVOB 5JW5B 4A6YH 2CD0A 5D7KD 3OAUH 1KJ2L 4BH8B 4OQTH 3DX7A 3PWJB 4HX1A 4UV4L 4PUBH 2G5BA 3AREB 2JCCA 1JTTA 1QVOB 4P23D 4LSPL 2HFGL 2JJVA 2ZOLA 3PWPA 1OARH 2CKBB 1LEKA 3IYLW 3QEQB 4GUPB 1D6VL 1PLGH 2OYPA 2WWKT 4P57A 1CVSC 1A0QH 1JGDA 1WFNA 4YFLI 4L1HA 3QUZB 4LCCB 3VCLB 4QRTA 5HDBE 4JHWL 1RJZA 1T83C 1WICA 4NRZB 4PJCE 3DRTB 4X7SH 4F7CB 2YPVH 2DI9A 3O3AA 4XAKD 3STZA 5E8OA 1U8QB 5KTEL 4MZ3A 5DRXA 4HPOL 5JPNB 1T4KB 1LP9B 4OV5B 1LO2L 4LSRL 1SJVA 5CGYD 5E08L 4DN4H 1QLRA 2GTWA 5I0ZA 3MXVH 5EH1A 1F4YL 5DR5H 1IAIL 1O7SA 1OT1A 4HS3B 5IW3A 3RDTC 3AROA 3CUPA 5FO7B 3Q6FA 5ETUA 3TFKD 2ARJB 1REIA 1FQ9C 2CIIB 4TSCL 1S8DB 3PL6B 4MA7H 3UTZA 1MNUL 3Q5YA 3OKNB 4E0RA 2AJXH 3TV3H 1MRFL 4GRLB 1E4XL 3BT2H 2FR4B 3U9UA 4WUUE 3MBED 4H1LA 5HHPB 1OAZL 3VXNB 4GBXD 2AQ2A 2PF6A 4Y19B 1Q38A 2CR3A 3SOBL 4ZOBA 2ZG2A 4B41A 1DUYB 4S1QH 4WI6A 3W9DB 3ARTA 3LQMA 1F3JA 1NJ9B 4JFYB 2DQCH 4Y4FC 4X9GA 1NBZB 1HHGB 4YQXL 5M7QA 1FVCB 4PRBA 4ZO6A 3WFHA 1PD6A 4HK0A 4EI6A 1N3NA 3T2NL 5IB5A 4Z7VA 1A21A 3F7RA 2K7PA 2DQIL 2C3GA 4XWGH 3QEUB 2X1QA 1K9TA 5DGRA 5T1KA 4WO4D 4XX1E 1KV3A 1VPOH 3RWCA 1F45A 1CVRA 1Q8MA 4JQIH 3AMLA 4FZEH 2R0ZH 1RJYB 3MUJA 5EPMB 2K3TA 4PJEA 4QGYA 1YUHB 2PUQT 1CXHA 1U8LB 3HFMH 3WLWD 1JGVL 4Z7WA 3B5GA 4MA1C 3RZCC 2IANE 1XCTB 2QQKL 1J8HB 4LKCB 1OLLA 3OB8A 4GAGH 1G7PB 2PO6C 3SE4C 1GZQA 1GGBL 1YEHL 5HYQA 2DM7A 3QO0A 4JE4B 2MMXA 4HAFA 4DKFH 1EBAA 4R3SB 3GMPA 1H9VA 3MV7A 4HHAB 5GISH 1QBBA 1QRNA 3U4AA 4PJBE 3GMLB 1V7NH 4HS8L 4O2EB 1VEOA 4FZ8H 5J11C 1Z0NA 4BJLA 1QBML 1FV1A 3BP7B 3WIHL 5LAXA 2PETA 3BZEA 3PQYD 1K6QL 4H1LG 4HWEH 4X83A 3WJLA 2EC9U 4K23H 1OP5K 4KJPD 4LQFH 3CH1A 2VABB 4X5XA 3WIIH 4ZTOH 3JVGA 5C0DB 3N1GC 4P5KA 3HRPA 3JTSB 4JM2A 4P2OB 1EBPA 3NN8A 4HLZH 2CK0L 1UM5H 5D1QA 1J9CT 4HC1L 4NN6B 5C6TL 5AWNL 4NJ9H 4IRZL 4G6AC 3BPCA 4U1LB 4XNUL 2DLFL 1T04A 2Q1EA 5EZLA 4JO3L 1IZJA 4IEFB 3G6DL 4ODSH 5EU3A 3V0VB 4DGIL 1VADA 1HQRB 4PYHA 4EXKA 4K9EC 2YRZA 5HI5D 4OCSL 3TPUB 1TVBA 3IXTA 1Z5LA 4MNQB 3AGVA 3HZKB 1D5XB 3VFMA 4DFHA 3CK0H 3OKMB 2NY6B 1TTUA 4Y88A 5CINL 1GGUA 3KPPA 4ODHH 4LASH 4BH7A 1C08B 4NNXA 2EE2A 1NUFA 4MS8D 4L4TD 2XA8L 5IM7B 3SDDB 1MCPH 1LO3L 4IOIB 3WUWB 1VGKA 4K3HA 4Z0XA 4XVSL 3RA7L 3ZKMC 2I9LB 3IDJA 5TE6L 1XT5A 3IDGB 4F37F 2GEEA 2DQUL 5DI8A 3TVMA 4KPHL 4GW5A 5D1ZB 3MV11 1MREH 4D94A 5IEKB 3WSQL 3FQUB 3G5VB 5F88B 2EKJA 2RQ8A 4I9WD 4XCFL 5GRVL 4ZYKB 3WFDL 1ZSDA 5DC4B 4K8RC 3BDYL 2Y36L 4OGAD 3OWEA 5I73B 3VGFA 3FQTA 5CBAB 3DI3B 3WNLA 4Y2DC 4QRSB 4I3SL 1CTOA 1F2XK 5DVNA 1U95A 2CQVA 5D5MB 3ZT7A 2VDPH 1JNNL 3LZFH 2EXWC 2PYED 2W0FB 3DWTA 3UTQA 3I2CL 3LEVL 3MLYL 2ICEB 1Y0LB 5L7XL 1Y6NR 1CGXA 3GJEA 4ONOA 4URTB 2IBZY 4MCZB 4HIEB 4UMGA 1HI6A 5C07B 1E28A 1QRKA 15C8H 4A2MA 4QOKA 1FNAA 3CDGA 4LKXB 2X40A 1UC6A 1AQKL 4PP1C 4OUUA 3ZL4L 2DJUA 4X4YB 1LD9A 1ZLUK 3DMMD 1OTUD 3UC0H 3RKDC 2AGJH 1XGRA 1KSRA 4JDZB 1MCNA 2YUXA 1OP3K 3EOBB 4YDIH 4EUPB 1UWXK 1X5KA 4Q0XH 5IQ9A 1U8HB 4Y16B 3QFJE 1QEWB 3VXTB 5E2TH 5L88H 1HHKB 4QHLA 2P46B 2MCG1 1AXIB 1BQHA 2A2QT 2IBZX 3CU1A 5BS0A 4HW6A 1N4XL 1R3IL 4EN3A 3Q3GA 4GS7C 3MRLB 4QRPA 1MHHA 3GSOA 3FFCE 4GLRI 5EUKB 3CLEL 1EERB 5GSRA 4LEOA 1KPVA 5I1IL 1MHEB 3PXJA 3SKOB 4PJFF 3O9WC 5H2BB 3HR5A 3SGEH 1MJUH 1FZMB 1G7MB 3IFNH 3DX6B 4IOSD 1FVDA 3RAJL 3UTSD 4CL7A 1MLBB 3VXQA 4NC2B 1V8HA 4MVBC 3BX7C 3VI3F 1RHHA 1IC1A 4LCWD 4F8QA 1FNEA 3LS5H 4PIRF 4XNQA 3TBYB 1OSPH 5D2LE 4U7KA 1CL7L 1I9IH 4WU5B 3D18A 1A14H 3FB6B 4Q9RH 4ORGB 2W65B 1A9EA 4P23A 2XNAA 3L9RB 5JOEA 3ARDA 1FFRA 2VH5L 4HEME 2AXGA 4J23A 1KF9B 4A2LA 2YD2A 5FECA 3P0VL 3VXUE 3U4EB 2X1XR 4D0BB 2Q8BH 1R3JA 3L3JA 3ARDC 3NZHH 3ZYIA 5JUEH 1J10A 1Z6JT 1JN6B 2K7QA 1UB6B 2V9RA 3SKNA 3QZWA 5ACLA 1IZKA 1EEZA 2E3VA 2YPLD 1G0YR 3PHQA 5ALBH 1E6JH 1OAXL 4X9IA 3KYOA 3WBDA 3IFPB 1UACL 2J3SA 1RZIB 1A6UH 1CDGA 5TDPA 12E8H 3UMTA 3CFKA 4HT1L 3DXAB 5CJXC 4NDMB 2ADGA 1KOAA 2X4SA 4JQVA 1BQHG 4YHKH 3OAYH 5EC2B 1KIUA 4NFBA 2BFVH 2WIIB 5IHBA 3FONA 3FT2B 4JQVC 4R90L 2MJWA 3BKMH 2D0FA 4OQ1A 4KMQA 1A5FL 2OTWB 4DKDC 1NFIA 1T5WA 3QIUB 4R96A 1FJ1A 4CDGC 5F9WB 3PV6A 4OCYL 3OZ9H 4LIQE 3CXDL 5BZDA 1A1MB 1BD2E 2X7LB 1RIHH 1JIBA 2YRPA 1FO0H 3MV8D 1VEPA 2DTML 2Q3ZA 3P9MB 4FQQB 3HPJA 5GZND 5J89A 4BUHA 3DECA 3VRIB 4MAYD 2HT3C 4PJ9D 2QEJA 1I3UA 4OF6A 1KULA 3B9AA 3F12B 2E5EA 2NR6D 4J12A 1CICA 1EH9A 5ISZD 2R0LH 4Z77B 1KBGH 2H26B 1CLYH 5B8CA 3ALWA 4GH7B 1FG2B 2D31B 4A6YA 3AM8C 3ZTNH 4UUJB 2IGFH 5DGQA 3X3FL 1P4IH 4QKXB 4WFFD 4NGHL 5E2VH 3QIBB 1B90A 3RWIA 2BSSB 2YN5A 4LRNH 3UROR 3SE9H 4M6AA 4DZ8A 3TPKA 3VFUB 3B9KD 5FO8B 2R2BB 3LKPA 3HZYB 3QZWG 3DURA 3HMWL 3MFFA 5T3ZE 1GPOL 1PZ5A 4NWUL 4QRRE 5I1LA 5IB2A 1NGYA 2VLJD 5BMFH 4YO0B 1U2CA 1ZHBB 3LRGA 4LLWA 1HCVA 4OT1H 4AEHH 1DR9A 1KJVB 5GZOD 4WO4B 1BLNA 5E7BA 3U2SB 1C1EH 3UBXB 5IQ7L 2O26U 5T3XH 2DL9A 2VDLH 4GW4B 4LDEB 1JHKL 3GI9H 3ULSB 1WTLA 4LSTL 4P59L 5GSVA 2HTLC 1MCKA 2XZAL 4UDUA 4RMTA 1EA9C 1EK3A 1QKZL 2HN7A 5F7KC 2G60H 3B3IA 5DHYB 4IRSC 2YC1A 2IH3A 5SWZD 5KZCB 4J3VA 1DSFH 5IIEB 3MLTA 4PLJC 3GRWA 3MNWA 4Y2OA 3MOBH 3EO0B 1DBAH 4JPKL 1NC4D 2OR9L 1HCFX 5E8EB 5FKAA 1NCDH 3TM6A 2NYYD 3SDCD 3W0WD 2R4SL 2VUOA 5E0QA 3H42L 4OZGF 1EIBA 3D9AL 5AUMB 4XBGB 4ZUTA 3HB3C 5EU5A 1KUMA 1X5YA 3R1GH 3RVUC 4PG9B 4BZ1H 4YE4H 1PYWA 3IGAB 3UAJC 3OPZH 4G9DA 4B50A 3KDMA 2DKUA 3ARUA 1HNGA 1BAFL 5HHXH 2YEZA 5D70H 1BIHA 5BZWA 3KGRA 1ZOXA 2VL5A 2I27N 3GJFA 3MRDB 4KKCC 5F7LB 4YHLL 3EYOA 3TT1H 3QWRA 5GRJH 5DSCB 2NNAB 4Z5RB 1SVCP 2W1NA 3MSPA 4QEGA 5IJKA 1E4KA 2O93L 1I7TB 1TETH 3W9EB 2OLDA 2XACC 2GT9A 4L4TB 1UCBH 5ADPH 3U0TA 5L0QB 4MQXD 2VSCA 3C9NA 4XBPA 4JZOB 4LNVA 1HH6B 4TNWF 5T3XD 3LAFA 3RIAF 1PEZA 3RGHA 1Q72H 3EJYD 2A6DA 1FSKC 1NC2A 1OPGH 3AAZB 5DA4A 5FOBA 4FS0A 2GK2A 1N59B 5E4EC 3ABZA 1D9KD 2H2PD 4PJ7B 1JPGB 4BSWB 1LK3L 1W2KT 4CGTA 1S7SA 1SQ2N 1JP5A 1U91B 3WDJA 1GVIA 5F1IB 4FTVE 5IFAL 2MQ3A 1A6TB 4LF3A 5IBTH 1WEJL 3NFPB 4QY8B 3LQAH 5I1HL 5HI4C 2PYEB 4M6NH 1DQQA 1ZK9A 1LE9A 4ACPA 4G3YH 5B39A 1IQWH 3TJEL 3WKML 2ITCB 4YHOL 1WBZB 3RHWK 3MUHL 2OZ4A 1P2CB 2CJUL 4GSDH 1J05B 4YH6A 4RBPH 1T20A 1AP2B 4MJID 3ARVA 1U8PA 4TUOB 1N6QH 5L2KD 4JANA 4L9LB 5FM4A 4ZG1A 3H9YA 4P9HC 1FRGL 1S7UB 3DMMB 4HULB 1ZKAA 1FZKB 3DBXB 1TNMA 3BPLB 1BVZA 4XP6H 1ACYH 2FJGB 4OM1L 5IGXH 1CCZA 2W60B 3WDHA 3QUYA 1KTKE 4LSUL 3SO3C 4M5ZH 3WNKA 3O6ML 4NZRL 2BXZA 4YDJA 5BJTB 1RZ7H 5L6YH 1H8OA 1T1WA 1RV6X 3TH4T 4L8SB 2P5EA 1N64L 5I76A 1JPFB 2WBJD 4W4OA 1PQZB 3WKNA 1T7WA 1NGWA 2XWJB 2NY4B 5DQ9A 3IRPX 2Q8AL 1H0DA 5CP7B 5JW4R 1KCVL 1UH2A 1XCQB 4PJIE 4U1JA 3QT2A 3S37X 1N0LA 1RK0B 2BVOA 1OTSC 3GHEL 3LRSB 4HDIA 3U7YL 1QSFB 1JK8A 3X14B 1ULVA 3ISWA 4G5ZH 2V2WB 1UZ6E 3UTSB 4F7MB 4OAWB 4PJHE 1DLFH 5AZEH 2OMNA 3BPNC 5JW4N 4F58H 3QUMH 1CFBA 4LCWB 4UV7H 5E5RB 3G5XB 2BVQA 4WW1B 3MV9D 3WCYA 1JHLH 3BHBA 1KTRL 2GCYA 9CGTA 5IBUG 1GRWA 4JO2H 3MREB 1WAAA 1P4LA 4JLRB 1I3GH 4E9LA 4CU7A 5B39G 4HIJB 1QFWM 5JHDE 1OAYH 1BBJA 4Q6IC 1YY8B 3BGFC 1H5BA 2FX7H 5A2FA 4D9QE 2DMKA 4K7FA 3GKWH 5ALCH 5CS7A 4MYWB 2X4QA 2Z31B 3AY4A 3ECBB 3HE7D 3ILQD 3JV6B 2ICES 1J88A 4HKZA 2FHCA 4GAJL 2YPLB 2WP3T 5SWQA 5CEXA 1FNSL 3GIVA 5E2UL 1NGZB 2CDEA 2BNRA 3EKCA 3C2SA 1XF2A 4ZOEA 3VFVA 4NKQB 3U0PA 1KNOB 4XPGH 5E8NB 1J0IA 2Y72A 3QJHB 3D0LB 4OLYH 2JKXA 5C09A 1YYMH 3DI2B 4KFZC 3QEHA 1LO0L 1AQDA 4S1RH 2J8UE 1E27A 1UVQB 4J7RA 2ZP0T 5KVDL 3WO3B 1NFDB 4O2FB 4MLIA 4NRXA 2NPLX 4NHUA 5T1DH 4MDIB 2ZUVA 2CDFA 1A7QH 1WJ3A 2WBKA 1R5IA 2CLVB 2VITA 4JRXD 1UM6H 4OGZA 4M1GL 3QHFL 3MV8A 1KYOJ 1I9RL 3A67H 3D25A 3STLB 4GLRH 4OBRA 2O5ZH 4KJYB 5T5NG 1SJEA 1HQ4B 4EVNB 3NMEA 3DX8B 4ZDHB 4PRPE 5HYJD 4PJ9B 1JPST 3RU8H 4GG6E 1CQYA 2G2RB 4HKJA 5EU6E 1TQBC 1KACB 5I1EH 4DQOH 4POYA 1FL6B 1G1YA 1S9WB 3QUXC 4ODXB 1B6DA 1OF2A 5EU4B 4NO3A 1NMAH 5F6HJ 5ICXB 3MOAH 2HFFA 1YQ2A 3QH3A 3R8BB 2VXTL 2W9EL 3PWVA 3ZKXB 3FB5B 3R0NA 4WW2A 1QHPA 2EYRB 2A6IB 1N6VA 1ZEAL 2R23A 4Y5VB 2NX5E 5FUOL 5DHVH 4YAQB 4NKMA 3V5KB 3QIWB 3WEXA 3CAFA 3R4DA 3B9KB 3S35H 3GNMH 4H88L 3UPCA 4K94L 5D1XB 3RBGA 5DT1H 2CXGA 1BMGA 3T0WA 4YLQT 2HVJA 4KJWC 3NPSB 1U41A 4M7JL 4FQXA 5MEND 1I7RA 4HGWB 3IFOA 3WO4C 1P7QD 1VFAA 2FIKB 4X9HA 4YDLC 3OHXB 3BIKB 3MLVH 4NT6B 2C1PA 4M5YL 3MRJB 4U1IB 2ICWA 3RUGA 1KPRA 4FQXC 1XGUB 4RFNC 1Q94B 2ZWLT 2IPKA 1LNUB 1LE5A 3DVGB 2NY2C 3K7UA 3N0PB 3IDYC 5JR1H 1P7HL 4OFDA 5ESAB 1XF3B 1RK1B 4CADA 3PDOA 2DQDL 2HYMA 4GMSL 5GS3A 5KVEH 2YS4A 4DGVH 2V5TA 1JL8A 5SWZB 4C59B 3GIZL 3QNXA 1AGEB 4HZLB 2YWYA 4WRLA 4CVZA 4ZO8A 5E6IC 1WC7B 3EAKA 2VR9A 4OLUH 3OG4B 1QSEE 3L1OH 3S96B 5LCVH 1KLUA 3NCMA 2J8HA 1XGPA 1IGTA 2W0PA 5T33L 3S36L 4MX7A 4APQD 4L3EE 4NQSB 2R56L 1H3XA 3LKNB 2D2OA 4U1MB 4EJ1C 3HPLB 1FO0B 2EDFA 1CU4H 2WQ8A 1G7LA 3DNKA 4L5FH 4M7ZC 3X12B 1GXEA 3GMRB 3OV6A 3UJJH 3I02B 2ILLA 4MQ7A 4NKOA 4JFXB 4N90D 3G6AA 1FFOA 2CMRL 4PJCB 1RZ8B 3E6HA 4LHQB 4N0YL 2XG5A 1CDYA 3OR7B 5EO0A 4KMTL 3PGDB 3T77A 2GJ6E 3P0YL 5C0CE 2VE6B 1P4BH 3D3VA 5HDOA 3DTXA 2IQAA 4MA3B 3BKJL 4N9GB 4PJIF 4M43H 4M9OA 5BW7A 2VNCA 1VFBA 2WNGA 4GQ9H 1WBYB 4WEMB 1UZ6F 4XI5D 3UYOD 4JN2A 2OP4H 2XOTA 5C7XL 1DN0B 1V05A 4RRPA 1IRAY 2EDBA 5IHUL 1F11B 2ZJSL 4JFZH 1S9VB 1ZMYA 3ARZA 3O8XB 1OGTB 1IGIL 1JPTL 3H7BB 3NFSL 4NM8H 2BVTA 5IHZA 1R3HB 4JN1L 5E24E 1EJOL 3MZGB 1U8MB 5D7LE 3S34L 2BXYA 4WUUB 2DYPD 4DK6A 2BSTB 1K5NA 3MPCA 1D9KB 2FHBA 4ELME 5DJYA 1K3IA 1C7TA 4MD5B 3QR2A 3TT3H 4JJHA 4PRHA 5HY9A 2EYSB 1FPTH 2DN7A 4F15C 1S7WA 1FFPA 5EOTA 4D9RD 1OTTC 3BP6A 2ATPA 1TENA 3BZ4A 5BV7B 4G42A 1T80A 5D72H 2JB5H 1PKQE 5H37G 1I1YA 3EYUL 4JPIB 4X0KB 4XNYL 1CD1B 1RMFH 4R8WH 5EBWB 4PJGA 4C56E 5EUOE 5DD6A 1GIGH 2ARJQ 1IGYB 4R9HA 3K74B 5L2KA 1T1YA 2V5MA 1I7ZB 2GJZB 5IJVA 4MJIB 1F6AA 3K2UL 3HC0A 3KJ4B 3QULA 2J8UF 4XVUC 4LLQB 2DQFB 2OL3H 3GK8L 4HIIA 1QUNA 2CLZB 3P4LA 3SY0A 1G9NC 4P4KB 3W5MA 4BYHA 4X6CE 3QWOA 1BOYA 1C16B 5INDB 2LTQB 2AI0H 1ZGLB 2IANB 1KELH 1F5WA 2F53D 2APFA 2IG2H 3U0WL 4PTUB 1DN2A 2VISB 3VFRB 2V5RA 5DVKA 1KB5B 3MRIB 1CWVA 1I1AB 1F4WH 5CJQH 1ZANH 2Q87A 3T4AA 4D0DB 3ARBC 4RRPG 3GB7B 3BXNB 1DQML 4KRPD 1FAKT 1VERA 2G9HB 3L6FB 3OB0H 4AG4H 4NFDA 4OLEA 1E4WH 4PRAA 1OCWH 1X9QA 4PJBB 2A77L 4HSQA 5IB3B 4ZPTB 5J1SC 2EXYD 4X9FA 2AXFB 3T3PE 2A6JA 1CXLA 5JW5A 3BOVA 5CKGA 4UT9L 2ERJC 2EDNA 4HUXB 3L3IB 3PWJA 2VTFA 4LVOC 1X5IA 3S37L 1MAJA 1BJMA 5JA8B 2VLKD 4JR9H 4NZTL 3ARGD 3DGCR 4ERSH 2ZUQB 4U6XB 3PGFH 4QTIH 1WIUA 4HWBH 1R6VA 3GMNB 3MV9B 1NL0L 5GS0H 3AREC 4HCRH 1YDPB 1HSAA 5L9DL 1LDPL 1RVFH 3CVHA 1NLBH 4P49A 4WU7B 3QEQA 4GUPA 2UY7A 3A6CL 4XPHL 4RAUB 5D2NA 5E8PB 4JO4H 3QUZA 3P11H 5HYIA 3VCLA 4NN7C 4YBQC 1IAII 4NRZA 3D48R 3NABH 3DRTA 2ORBL 5KSBA 3HE7B 4LCCC 3F7QA 2OK0L 2CDGB 3RIFF 4JY6B 5ADOH 5M95B 1U8QA 5DUML 5JPNA 1LP9A 3SBWA 5BOPA 4XC1H 4OV5A 1LO5B 4PRNB 5I15L 3KJ6H 2NY0C 4TRPH 4LLDB 4F2MA 3QCUL 4Z7UA 2B8OT 3DHMA 5JMRA 3MJGX 4MB4A 4WI5A 3L3KB 5EZIH