4P2QA

Crystal structure of the 5cc7 tcr in complex with 5c2/i-ek
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
180
structure length
180
Chain Sequence
IKEEHTIIQAEFYLLPDKRGEFMFDFDGDEIFHVDIEKSETIWRLEEFAKFASFEAQGALANIAVDKANLDVMKERSNNTPDANVAPEVTVLSRSPVNLGEPNILICFIDKFSPPVVNVTWLRNGRPVTEGVSETVFLPRDDHLFRKFHYLTFLPSTDDFYDCEVDHWGLEEPLRKHWEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Deconstructing the Peptide-MHC Specificity of T Cell Recognition.
pubmed doi rcsb
molecule keywords H-2 class II histocompatibility antigen, E-K alpha chain
molecule tags Immune system
source organism Mus musculus
total genus 35
structure length 180
sequence length 180
chains with identical sequence F, K, P
ec nomenclature
pdb deposition date 2014-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00993 MHC_II_alpha Class II histocompatibility antigen, alpha domain
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4p2qA02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 4p2qA01
4NZUL 4Z7WE 4U1MA 1MH5B 5A3IC 2DQCL 4HWEH 4XNQB 2Y36H 2R4RH 2HP4A 4K7PL 1ZT4B 3NFSH 5FCUH 2FJFB 2NNAA 4RRPA 3O3EA 3VD7A 4L3EB 1NAKH 5D7JB 3FQWA 4IRSA 4Y4KA 3ARGD 3SKNB 4N0UE 1HHGB 1U2HA 1FCCA 2A77L 4LK4A 1G7PB 4PRDB 2BFVH 2DWEA 3KPQB 2X4SB 3ARDA 4XHQA 1N0XH 1ZOXA 5CBEA 3WMSA 4H25B 2EC8A 2R0KL 1JPFA 4FOMA 4WFFE 2Q6WA 1S7XB 1OHQA 1A7QH 4WCYL 3V52L 1NBYB 3V5HA 3TJEL 4CVUA 3ISWA 5F1KC 2AI0L 3GGWA 4YDLB 3G6DL 3U7YH 1AXSA 1BBJB 1U95A 3M1BB 4NQXB 1SEQH 1FGNL 2VSCA 4E5XA 4ELMA 1BD2B 4RBPH 4PB0H 1VGKA 3EHBD 1BGXL 4YAQA 1B0WA 3W0WB 1U58A 1W0VA 5CJ5A 5C6WH 4NZDA 5E6IC 4YXLH 4J8RA 2FBJL 1WBYB 4Z18A 3ILPB 2Y4SA 3TIDA 1N8ZA 1H0DB 1K4DB 2VZVA 5MEND 1U3HB 5LXGL 5E94B 2A83A 3O3DB 4G6MH 3TO4D 5LGKA 5EORL 4FQPA 4YXKH 1E4XL 3JWOC 1Q9LB 4WW2B 1LO3H 1NFIA 4HGMA 2IQ9L 1OARL 2DQHH 3H42L 1H3XA 4FRWA 4P23D 1S3KL 3ALWA 4IIQB 3C8KA 2I5YL 3P30H 2HJFB 4N68A 1WK0A 3G04A 2ORBL 4RQQA 4TVPL 3V4PH 4Z78A 5IP4A 5CSZB 1NUFA 3OAZH 2BNQA 3ARFD 4JPIA 3WKMH 1RUMH 4U6YB 3D39D 3M07A 1CICC 1HI6B 3DIFA 2AJUH 2V2XA 3O9WD 5EC2A 4GXVH 2QBWA 2GY7B 2DWDB 2GITB 1SJEA 4LSQH 1FL5B 1JPST 4I18B 1K8IB 3NABH 5A16B 2YD7A 1RY7B 4M7KL 4M9OA 5MEOB 4GS7B 4X7SL 1JUFB 3CSGA 4OLYH 5I16A 5I1AB 3TVMB 3MBXH 1KT2B 4R7DB 1BEYL 1AIFB 4PLJD 5ICZA 2VO5A 4WENB 3W82A 4JY4A 3L3OB 3GMQB 1V7ML 3TH2T 2HMID 3RZCB 4H20L 5SWZA 2CJUH 3FQUB 4S2SB 3TZVC 1DBKH 3SKMA 1Q0YL 4HKBB 3MNVA 2V2TA 4PY8J 3T0EA 1IMHC 3OR6A 3AMKA 4YIQB 5JLZA 2IGFL 3QIBD 2Z31B 3CH8A 2COQA 2E7LC 2P5WB 2PYEA 3L7EB 4XCFH 4UT7L 3IXAA 1SEBB 3UYPA 3K4DA 3T4YA 5E8PB 3TCLA 4XP1H 4YHIA 1A6ZB 2CDEA 1FSKC 4RDQF 1KPUA 2OTUB 1X4YA 4OCYH 1XCTB 1E4WH 3HI1B 3TNNB 2PUQT 1IKFL 1NCBH 1T7YA 3WIHA 1XGRA 1MFCL 1A4KA 1VESA 4GRLC 1F6LL 4QTIH 2HT2C 1EEYA 3P0VL 3IYLW 3AU1B 4OFVA 5B8CC 3D9AL 4Z95H 3W9DB 2BCKB 3VXRD 4KKCC 2R8SH 1CZ8L 1KELH 3O3AB 1Z9MA 2DQGH 1UEMA 1CXIA 4PJDF 4C56E 1SBSL 1J0ZA 3O4LA 3L6FB 5D1ZB 1G1YA 2QQNL 4PJFF 5DS8B 3IS0X 5ETUB 4ZG1A 4XVSL 2BSSA 4HIXH 1CD8A 4K3EH 1RUPL 5FYKU 3ROOB 1MY5A 1JL8A 1IGCH 4GMTL 3WLWC 1U92B 3LQAH 1PG7X 2GW5A 1C16B 2XI9A 3QQ3B 3X11A 2ATPA 3OJ2C 1AE6H 2NQCA 2HFEB 4XNUL 4R4BA 2B1HL 3K0WA 1TVBB 3T1FA 2P7TB 4V1DB 1HHJA 1A5FH 1PYWA 1J1XH 3PWUA 4WWKD 3QWQB 2QSCL 3CFJB 1TQBB 4I3SL 4PP2B 3SQBA 3QSKB 2IADA 5LAXB 1Z5LB 1IAIH 3GSXA 1N3NA 2D7TH 4YDKL 4MQSB 2E27H 1EJ6A 3QB7C 3O45B 1JIBA 3LRHA 1W2KT 1DVFC 2ADJA 4G42B 3ULVC 3T3MF 1JZ7A 5AZ2L 1II4E 1MOEA 4XVJH 2W9LA 3EJYD 3LHPH 4R8WL 4J1UB 3ZT6A 3F7YB 4GW4A 3H6JA 1ZLWH 1C12B 4NWTL 5IB4B 4B5EA 1OP5H 3W39B 3HA0A 1T83C 4ORZC 4LSPH 1TZGH 5A43C 3FFCB 2JJTA 1X5GA 5FDWB 3CMOH 5E70A 3HCVA 2Z93B 3TFKC 4PG2A 3IGAB 4WW1A 3RTQB 4JCMA 4OIIL 5BVJA 1CLZL 3VCLB 3MCKB 2XZQL 2J2ZA 3RL1B 2R2BA 3UTSB 1RUKL 1R6VA 4P5TD 5D7IF 5IBUG 5KG9B 1D5BB 5DD0H 5E6YA 5I30H 3HE7A 1CD1A 2VLRA 2H9GB 5J11B 4GKSA 3CVHA 1WWWX 4MNQA 2FJHB 5ID1A 2IBZX 3MACH 5ESQA 2CRIA 2W9EH 4P2RE 1D5MB 3EO9H 5TE6L 3FOMA 2DM7A 3JVGC 4YHMH 4FQQB 2HAZA 2D4DA 3OXSB 4N1CA 1U3YA 4LLMB 1U8IB 1G84A 1K4CB 4QRPE 4JREB 4LCYB 4NNYB 5JORB 5MERB 1SYSA 3BW9B 1DE4A 3EGSB 5TF0A 3JUYA 4IRSD 3GIZL 4Y4KD 5I1DA 2ZCLL 4B53A 4QKXB 5FFLA 1G9NL 1A7RL 1FG9C 3T3ME 3VU2A 5D7LE 3VFMA 3KYOA 2RBLA 4PJEB 3QDGE 2FZ3A 5KSBF 5JUEL 1F97A 3T2NL 1OLLA 1MCWM 1MCOH 4I2XB 3B3IA 3HE6C 3OKKA 1N2RB 3NA4A 2X1OA 3RI5F 2OR9H 1FZKB 1OAZL 3MV7B 5J13B 1H3GA 1UWEH 2NY0D 4RAUA 2FO4A 4IS6B 5TDNA 1JMZA 1M4KA 4GLRH 3REWA 3DJ9A 2JJWA 4K3DL 4HIJB 3K46A 2ZPKL 2DQFB 3SDXF 4NQSA 3FB5A 4DK3A 1T1YB 3JWNC 2E8YA 5D7IE 4AENB 2VLKE 5I74B 5HI4D 1MUJA 5KVDH 5EO1A 4PR5A 3SPVA 5CEZL 1KTDB 1S8DA 2APWA 3HRPA 3K8LA 3G9VA 3MJ9H 1MAJA 1F4YH 3A6BL 2FEDC 5C0CA 2DQUL 4RMSA 3WSQH 1N4XH 1QFPA 3GK8L 1Y6KR 4MLSA 5TJWK 3DXAA 3O4OC 1MIEH 1I7TB 1T04A 2H32H 5A2KH 4NGHH 2CRMA 2J4WL 3LKOA 4D0CB 2GTWB 5HI3D 1F4XH 4P4RA 1Z0MA 4S1RH 4YC2C 5GS0D 3L9RB 4X9FA 4Y2DA 1XR9A 3QUZD 3D85D 4Q2ZA 3D0VA 5ID0B 1OSZB 3EKCA 1FAKT 5HJ3A 3MZGB 3OGCB 5LGJA 5C71A 3MRKA 5KVEL 1PG7L 4PREB 2E7BA 1LP9B 1HSBA 5DJDB 1ZT7A 3GMNA 1K3IA 4P59H 4QHKJ 1QFWM 1FAIL 4HX1A 5HYSB 4GKZA 1EEZA 1F4HA 2WIIB 3LN4B 3MXWH 5EU6B 5GGSB 5J12B 4ZO9A 1I85C 5F3HB 1NC2D 2B7DT 3RU8L 1EBPA 4NQCB 5FCSH 3SDXE 1JRHL 4QY8A 4P48A 2YPVL 1ED3B 1A3RL 3NFNA 4N90D 5EUKB 3S9DB 2BMKA 2GUOB 3DRQB 3CDFA 7CGTA 1W0WA 4DTGL 3DVGA 5F3BB 4PJXB 1F8TH 2YPKA 1MEXH 4XP6H 3U4BL 3IFOB 2O61A 3MRIA 4I77L 3RVVD 3LKPB 4D2NA 3BYTA 5AZEH 2EXWD 2ENSA 4NKDA 3QFDA 3UTTE 2VLME 1TDQA 1MCHA 4DK6A 2PYED 4MA1B 3RAJH 1T5XA 2ZNWA 2IPKA 3BUYA 3OKNA 2UZXB 4L8DB 2W0FA 1J1PL 1HXMA 2K7PA 2P8PB 2F58H 5CZVL 4HH9B 3HNTL 5GZND 1IL1A 1OQOA 5EWIH 2AEPL 3VFVA 1RIHL 3UC0L 3PWPB 5FM8A 3MO1B 4U1JB 3S35X 1VPOL 2DAVA 3NFPA 4IOIA 2VYRE 2NXYD 5D7JA 2Y6SD 4M1GL 3JXAA 5D70H 3UX9B 4B7LA 1BZQK 5I18L 1FP5A 2XY1A 4KHTH 4CJ1A 5EIIB 5F9OH 5T5FL 1RU9L 1XF2B 1KTLB 1S78C 5JHDB 2LVCA 2NXZC 3CC5A 5CS7A 1CGYA 1UZ8A 2FB4L 4O4YL 5F21B 2GKIA 2BNUB 3G5XA 3S88H 4OZFB 4AMKL 1F90L 4EZMA 5D6CB 4HUXB 2R15A 4PYHA 3ARED 5C09E 3MPCA 1AGDA 3ECBB 3O4LD 3IJHA 1ONQB 2FR4B 2W9DH 3W9EB 2ZOKB 1U8HB 5D6DA 2A2QT 2K1MA 2W0KA 1FZMA 2XN9A 5J1TC 1LO5B 1VERA 4YXHH 4M00A 2YUVA 2MNUA 1MCJA 3WFHB 4I9WD 5HVWA 4RWYL 2KZWA 4K8RL 4LAJH 4Z7WB 5EB9A 4PP1D 2BSTB 3JWDL 4YEEA 2R0WL 4G8GE 1K8DB 1SJHA 2OXGA 4UU9A 1NCDH 3EOTL 1IZKA 2EDWA 1CFBA 2B5IC 4LGPB 2XZAH 5IQ9B 4U6TA 4D0BB 4N0UB 1X7QB 4E42B 3HI6H 4ZUUA 5AYUH 3RWJB 5C0BE 4PJHE 1VFOA 1ORQA 4X7TB 1CDJA 4S1QL 4FFYL 4L3AA 3VWJA 4WEBL 4PRBB 5ESAA 1QLRA 1NLBL 1RZJL 3CVIL 5D5MA 3K3QA 3WJLC 4PLKC 4L8CB 1QFOA 3I02B 4HWBL 1KCSH 1MJ8H 5JIHA 1NFDF 3G5VA 3PHQB 1CE1H 4XRCA 4PJAA 4N5ED 3L3DB 4JM2F 3MGOB 3DUHA 4FFVD 3QNYA 1I9RL 2F54E 3GI9H 3QXDB 4MA3B 1EGJH 4NZTH 3ETBF 5EIQA 3T77B 1KEMH 3U4EB 1DLHB 2DLTA 4OJFH 1AIFA 2VDRH 1S9XB 5BZWB 3W5NA 3TBYA 3X12B 4EN3C 1CICB 3VXSB 1JHKH 4EVNA 4CAGA 3A6CL 3MUY1 4TQEH 2RAMA 1CVSC 1X44A 3MLXL 1FRGH 3QIUA 1GC1H 5KOVC 3RWEA 2KKQA 5F8QC 2EC9T 1DBAL 1GGTA 2G75A 4BFEA 1JV5B 1ZVYA 3EOAB 2VDMH 2Z31A 3INUH 1GGCH 4M62H 3BESR 3JTSA 3ZTJH 2P5WA 5DDHB 5TGBB 2LV4A 1AXTL 1F13A 4FTVB 2DBLH 3TZVB 1SY6A 2WBJB 3DECA 3S96A 1A6ZA 1CLYL 4DKEH 1IILE 2EDTA 3N0PB 1V3JA 2JB5H 1HCFX 2D0HA 4QXWA 2EDQA 5DF0A 3QCUH 4Z7QE 1NANI 5HY9A 1PKQE 3NOIA 4MD4B 3AROA 2H2PC 1NFDE 3DBXA 4OD2A 3WL9B 4P2OC 4ZODA 4JAMB 4NCDA 1N7MH 1OF2B 1J05B 1RZ7H 2X5PA 3KLSA 4FFZH 3F8UB 5H37H 3MOAH 3O6KL 2IQAA 1D3CA 1Z9LA 1KJ3H 1PEWA 4TTDC 2VTFA 3KDMB 3W9DA 1KCLA 3PNWA 4MJ5B 4RBPK 2VDLL 1FSKB 5DQDH 1A47A 5IT2H 1NBQA 3LAFA 3E8UL 4Z8FH 2P45B 3OV6A 1I3VA 1MELA 1YEFH 3QUYC 4AQOA 4OM1L 1XIWB 3MLRH 2NPLX 4ZDHB 3O3BA 5D1ZA 3DLQR 4GRLB 1KJ2B 1OB1B 5ETUA 4EI5C 4LSUL 4JANA 2G9HB 2X09A 1MCDA 5ACMA 3V7MA 4JM2C 4YX2L 4N8PA 5IHZB 2G5RA 2I27N 4OLVH 2GT9B 3ZKMC 3CUPB 1KTRL 4ZPTB 3GRWL 2HWZL 2NW2A 5L0QC 3DMMA 3GUTB 3QDMB 4NM4H 3UYRH 3U82B 2IH1A 4L5FH 8FABB 4QT5B 3DXAD 2ZOLB 4DGVL 1QFUH 3BKMH 25C8H 5I17B 3B8YA 3OAZK 1MJUH 1MI5D 5ECJE 4M3KB 1LWRA 1LO2H 2FH6A 1T2XA 1I7RB 5KSAC 3QEQD 5LAXA 1ROWA 1U6AL 2D7NA 1NMAL 3A0OA 3ZKQD 1I8KB 4QYOB 4FG6D 4S1SL 3IXTB 2JIXB 3BZDA 4G42A 4NJ9L 4LCWE 5GGVL 4POUB 1K6QL 5FYJL 2C3WA 4MJIB 4RGNE 1JYXA 1JWMB 3OKEB 3OAYK 4LLUA 1C12A 4LGSB 5IHUL 1OGTB 1Q38A 4FQLL 4PTUB 4W6XB 4YHPA 1HNFA 1EFXA 3K2UH 4R2GB 4PJGF 3MODH 5HYJD 4N9GA 1AO7A 4WU7A 4KKAC 1ZHLB 1LNUB 4XCNB 4HLZG 1YN6A 1VACA 2LU4A 1DVFB 4HS8L 4MNGB 3RTQA 1ZVSB 1L0YA 3PL6B 3U36A 3HFML 2R1WA 3VCLA 1JYWA 3CLEH 3RL1A 4KKNA 5CD5D 3IDIB 3GNML 4MD5B 5FECB 2V5YA 5KG9A 1D5BA 3ARSA 3WFBL 2JE8A 3TN0C 2ZG2A 3QCVL 1BJ1J 2QADC 5F7WC 2BOCA 2WWKO 4KXZI 4QOKD 4B7IA 2VNCA 3O2VH 3NBNA 1BMGA 2OJEA 3U6RB 2NY5H 1EHAA 4NUGH 1T6WA 2OP4H 2VDOH 2Y9RT 3GJFK 2HT4C 4JFEB 3I75B 1Z3GH 1I7UA 3P4NA 3DROA 4M6OH 2VIRA 3BP4A 1K4CA 1YQ2A 2GJ6A 3O2DL 5B3JF 4NNYA 4N0CC 3TYFA 1GC1C 3VA6A 1GGYA 1FYHB 3QIWB 5CJ8A 3CDYA 3VXNB 5DJZB 1JGVH 4OD1L 2R1XB 4J3SA 4L3ED 5D7JD 5DQ9A 3SGEI 1MFBH 1NGXB 5DLMH 1QSFB 5TF1L 2LTQC 3PP4L 4KKLC 3O2WH 4X6FB 1RQ5A 1I9JL 3UXFA 3MRPB 5F96H 5HHOA 1R5IA 3KLHC 1N2RA 5AYQA 4KI5F 5D2LA 1FYTE 2DMCA 3SDAC 2AVGA 4HKJA 2W1NA 3PWVB 4IS6A 5IBLC 1BFOA 5DRXA 5CEXB 3ORJA 2QSVA 4HJJH 2YMXH 3LB6C 4WV1B 1BD2D 3B2UD 5FK9B 5FO9A 5I1EL 2VWEC 5E2WH 4TTGA 4HXBH 1VFUA 1T1YA 4AENA 4Z7OF 3HE6B 3W0WD 2VQ1A 1JZ4A 5IWLA 1I8LC 1S5HA 5BVPH 4TUJB 2FLRT 4HULB 4HBCL 4QRPB 2ZUVA 2Y25A 1U3HD 1D7FA 4Q9RL 3GJFB 4JO2L 1DEEA 1J12A 1W72H 4FQ1L 3UZVB 2ZKHH 4O2CB 1ZHNB 3RX5A 3TJHD 5B3JE 5GRUH 4FQXA 1SBBA 5IOPB 5DGQA 5D7LB 1MFDH 3DX7A 5IV2A 4U6HA 2AQ2A 4U1NA 4AQ1B 3RVWD 1U8PA 1XH3A 4FQIL 1PSKH 1Q8MA 3QPXH 1TFHA 1YNTB 2GAZA 5IQ7L 3RI5K 1FC2D 3ZE1F 3QPQC 2P47B 5HYQA 1B4JH 1RJZB 4HS6B 4QXTA 1FDLH 1PVHA 2HJLA 3L5XL 2DJ4A 2C3HA 2VXUL 3BUTA 4H1LG 1YNLH 3S4SG 3QNXB 1AHWA 5C70A 1QPXA 4JZJB 3P77B 3ALXA 2VKWA 1K5NA 4JFDA 1XR8B 3TA3A 2BHYA 1MREH 3U0PB 4WFGE 4XBGB 2XTJD 4YC2B 5GGTL 5EOCH 1ZEAL 5F3HA 4TSCL 1URLA 4HK3N 5HHQB 1A3LH 1INDL 3TVMD 1YY9C 4M3JA 4Z7OE 4WHYH 1EMTL 5DD1H 4JRYB 4U1IA 2GUOA 1MWAB 1CXFA 1JVKA 1U42A 2CO6B 3BOVA 4Y1AE 5F3BA 4PJXA 5C0JB 3T0XA 3IFOA 1E6OL 2VJXA 4OCSL 4RGOL 2GJZB 3KXFE 2Z31D 1CIUA 1H15A 3HPLB 2P5WD 5C0ND 3IDXL 1X5ZA 4AZ8A 1V7NL 2X9YA 1L7TH 5E08H 3OQ3B 1BF2A 5DMKB 4BKLB 1TJHH 4FP8H 1TZIA 3UPRA 4F7EA 3P9WB 1NMBH 2CLVA 2CIIA 3MO1A 2WP3T 1ZANL 2ZJSH 5J1AB 3THML 4J4PA 3NH7H 3RWCB 4LFHD 2HVKA 1MRFL 4JLRB 4S10A 4KK6C 5DUBA 3QJFA 3MV9E 4ZAKC 1KIQB 3GMPB 4K55A 4OUUB 4PRIE 3FJTA 1MCKA 4UDTB 2H1PH 4L9DA 3X13B 5D71H 3MRNB 1T0MB 5FYLL 3HLAA 1H3PH 3OKLA 4MGXA 4ERSH 1WIOA 4HEPG 1KTLA 4D8PA 3WN5B 4PJ7A 4LGRB 2EC9U 4U4BA 1BX2A 3UBXA 4OZFA 3TT1H 2DYPA 3BFOA 2OMBA 5KW9L 2GI7A 3MRQB 1GJIA 2WZPD 5FF6B 3RNKA 3FCTB 1B0GA 2B1AL 5D1ZD 3W9EA 1U8HA 2AQ3A 5EOQH 3PP3K 3UTTB 4MS8C 4EBQH 2NXZB 1QSEA 4OCXH 3WFZA 5FYLD 2L7JA 4ODTH 5HHMB 1T2QH 1LEGB 4AIZB 4FS0A 3OF6A 4TOYL 4APQC 3KLAB 4ZUTA 4M48H 4GRWB 3ARZA 2PKDA 5T1MA 3F58L 3BGMB 2OL3H 4XBEH 2IALA 3PHOB 4V1DD 2IPTL 5ITFA 1E4KC 4QWWD 4XB8A 4ODUA 1JNLL 4JVWA 3H9SE 1YMHA 3KYNA 3UJIL 2WUCL 4M6AA 4EOWH 2DQDL 3IB4A 3EFFA 4JQXA 4QRSA 1FG2A 3DO3A 3BKYH 5DRNA 3RUGA 3SO5A 4M7LH 3VGAB 2V5MA 3V6FB 3QUML 3FFDA 1ZLUH 3CPLA 4JGUA 4EXKA 4OB5H 5IJVB 3AS1A 4L8CA 2B5IB 5IMLA 3I02A 1I8IA 3LEYH 1FVCB 4L8SA 4UV4L 2PCPB 1FLRH 2YWZA 5BOPA 3MGOA 3MA9L 4K9EC 3MXVH 5HTSA 4ISVB 4F3FB 3FFCD 1KIPB 4YUEH 3P0YL 3T77A 3VXOB 5FHBH 1YEGL 4IHOA 4UDUB 5JW4R 4WDIB 3RTQD 2YZ1A 3CU1A 1KLUB 5KS9A 4G8GB 2PO6C 3X12A 3VXSA 1BZ7B 3UTSD 5B39A 4UTAL 1D9KA 2CPCA 5KJRL 1Q9KB 4NQTA 5JQ6L 2XYCA 2GK0A 4O02L 4E41E 5J57B 5DMJB 2YKLL 4RFEA 3OGOE 4AEHH 3AM8C 4YH6A 5C0BB 4Z77B 1MLCA 4HT1L 4PJHB 1BWWA 5I8KL 2Q20A 2BVPA 5EC1A 1OTSC 3P11L 5F7FA 1RJCA 2CKBB 1GPOL 4EN3B 2GJ6D 5TPWL 1HEZB 3G9AB 3VFSB 1H3UA 3ZKNC 2WBJA 4N8VA 3SE9L 4KKBC 5HYEA 2AK1L 4KK8C 2ATKB 1JGEB 5T3XL 5EN2A 5DMGC 2QL1A 5H2BB 3BGAA 5JW4Q 3GB7B 4MD4A 2F54B 1YEEH 3BKJH 6CGTA 1DUZA 3TT3L 4JJ5B 3WL9A 3VGBA 2Q76B 3G6JF 4UIMB 2OJZH 1F00I 4NO0B 2DQJL 3EYSH 2F74B 4M02A 3BMVA 4D9RE 3BPLC 3MV7D 5E1AA 4G6JL 3SE4A 1FJ1A 4MB5A 3C5ZA 4O2FB 3QDJA 3ROLB 5FA4B 1JFQL 1KLGA 3MRJA 1FVDB 1I9EA 4KQ3H 1XIWA 1VEOA 4YQXH 5T3XD 3QUXC 4P2OB 4XP5H 1HHHB 1OB1A 2WK2A 1CDHA 3MRGA 3QUKB 3BYYA 5IB5B 3MLTB 5DJAA 4C4KT 1NBZA 1EBAA 1ORSA 4NDMB 3UTZB 3VWKC 1KN4L 5IHZA 2VXSL 2H8PB 2IMNA 1M6OA 4QHNA 1TJGH 2L0DA 3T8XB 5BS0E 2YRPA 4JRXE 3GUTA 1MAMH 4K7FB 1J0IA 3QUYB 4P57A 8FABA 3J7HA 4KQ4L 1OGAE 4H88L 4LLYB 1KCKA 1PKQB 5CGYD 5I17A 3TBTA 5IR1B 3MGTB 1H3VA 5C8JA 1DBBH 1WJ3A 3UROR 4JM2B 4IRZH 4ZXBC 1I7RA 3CFKA 4HWZB 4PLOB 4WVRA 3T1WA 4HD9A 3NTCL 5C86A 3DGGA 3GSUB 4KJYA 1I8KA 3G6JE 3HMWH 4OM0H 2P8MB 3BH8A 3WFDL 4EUPA 4OZ4A 4EI6B 2XQBL 5I66B 5IMKB 43C9B 3QZWG 1QKZH 1RV6X 3QRFM 4ONHB 1MRCL 4HGWA 4LL9A 4WIQA 4KY1L 4LLDB 2BY1A 4XC1H 5HD8D 1LDSA 1GIGL 5EU6D 4H26B 5T3ZE 1XGTA 5IMMB 2VISA 5I73B 1I1FB 5BMFL 4Y4HC 5D9SA 5KSAB 4PTUA 3UTPE 2XICA 4NQCD 4DQOL 2AS5M 2AXGB 5BW7C 1YEHL 2VKXA 3N1MC 2VSDA 1S7RA 5IBUB 3MRFB 4ZO7A 3BT2H 4OBSA 1V3MA 2GK2A 3HB3C 4DUXA 1P2CB 1C8PA 1NLDH 2FIRT 1KPVB 4RA0C 4PRAB 5K9JL 2P5EB 4XXCC 3WNLA 2B39A 3UO1H 5FECA 3V9FA 1N59A 4CW1B 1H8OA 2HFGH 1BBDL 1JCKA 3OL2A 3RL2A 4N9OB 4Y0GA 4OCWL 2OQJB 2RFXB 1ZHKA 3CFEA 4YBLC 1P69B 2R0KH 3NCJL 5EA0H 1B6UA 1FIGH 3WHE1 2XWTB 2LU7A 3Q2CA 1MVUA 1IC4H 4DJMA 4UTBL 4H0GA 3RX8A 5HHXL 1AKJA 3MREA 3KJ4B 3HG1E 1YJDC 3PWPD 3TJEH 2PXYB 4RRPG 2HLFC 3SDCA 3QIWA 1BQLL 3G6DH 3VXNA 3AAZA 1K2DB 1AD0B 2Z9TA 1M7XA 4QF1A 3TN0B 5E5RB 4RAVB 3WXWH 5LWYL 5DRZA 1QSFA 2YRZA 4IRJC 3DI3B 4QTHA 2ZSWB 3VGFA 1XAUA 1P5VA 2YD1A 4K23L 5JHDD 4X6FA 1AQKL 1NCUA 2LVEA 3FMGH 2DYPD 2VQTA 4I1NB 1IGFH 4ONGH 4S0SD 2J8UA 4ZO6A 4DGIL 1RIUL 3BP5A 3LPFA 2VR4A 2W65B 2B4CH 4LARL 2JB6A 3BVNA 4J6RL 2YPLE 4M1DH 4XWOD 2BVUA 4JFPA 4NC1E 4M7JH 2LTQB 4HFWB 5MEPA 1CFNA 1DN2A 1HN1A 3NCCB 1OARH 2AV1A 2Y06H 3MNZB 4NWUL 4A2LA 3QH3A 4WV1A 4MWFB 1QSED 1NPUA 3NGBB 1ZTXL 2DLFH 3MYZA 4F9PC 4PS4H 3S97C 3LEXA 3LPWA 3SJVE 3VW3L 4XMLH 4XX1E 2EXYD 3OF6D 1JGLH 4AIXA 4XMKL 1CLCA 3SDAB 1FNLA 4YGAB 5IIEB 2AAVA 1A9BA 1MAKA 1QYGL 1TTFA 3Q5TA 4PJ9C 1N6QH 3GHBL 3JWOL 4M5ZL 4GBXB 2CMRH 5AWNH 3D3VE 1X9QA 5ADPH 3V0WL 1L7IL 1Q9OA 1QNZH 4NC1C 1G6RH 1A6VL 3IRPX 4OLWH 4UIKL 2OYPA 4TPRL 5IM7A 4JPWL 4M7KH 4LP5A 4XPHH 2DD8L 1CDCA 4EIGB 3BPCB 2UWEB 4WFFD 5DMIH 5E00B 3WEXA 1L6XA 3NPZB 1EXUA 1B0RB 3T0VA 1FNSH 2JJSC 3OZ9H 4HS6A 1FYTB 4BZ2H 5INCA 3EFDL 5KSVB 4BSVA 4LEXL 5CBAA 4NCC2 4KDWA 3QNXA 2DLGA 4LVOC 4MA8L 2LAGB 1XGPA 1A0QL 1CN4A 5GGUA 2BRQA 2A6IB 2C3VA 1C5BH 3IJYB 3WHE0 1F6AB 3G6AA 3CXDL 4M61B 1QD0A 2ESVA 4JJHA 4KV5E 2D7MA 4UT7H 1A7NH 1GSMA 4WUUB 2ZCHH 1IJ9A 3VXSD 1FO0H 3OX8A 1YN7B 4CUCA 1HOCA 1Z0NA 2X4TB 4ZD3H 5I1IL 1YC7A 1CG9A 1L6ZA 3QHZL 2ADGA 7FABL 4JY6A 1CGXA 3MLSL 2BNRB 2GJZA 4ETYA 4F37F 1EJOH 3BGFB 1UCBH 4LLVB 4Q6IC 1N6UA 2V7HA 3OKOA 5MENE 4R90H 2FD6L 3KGRA 4KMTL 1FE8L 5CFHA 4RX4D 3CK0L 4FTVD 1E4JA 1J5OH 3GSQB 4JG1L 4EXPX 1R3HB 2WBJD 4HUWB 4MZ3A 5TQ2L 3MZTA 3ZTJG 1KB5B 3TV3H 3ARTA 3RWCA 2VB5A 5IHLB 4JLRA 1F58L 1AGBA 1CR9L 2DM2A 1KJ2L 4LPTA 4P3WA 4RWHA 4Y19A 3P0GB 4H0IA 1A7PH 3X13A 1J0YA 5EUOA 5CWSB 3MRRB 4HWEL 4PGDB 4YPJA 4UBDD 4O9HH 1JE6A 2Y36L 5D7SH 3NFSL 3D39E 5FCUL 4JO4H 1T2JA 1NAKL 4LAQH 2DTMH 4Y4FC 3GMRB 3TO4C 4XNUH 2OI9C 4CL7A 1I3UA 1Z9SA 3OHXA 5IB1A 1QRNA 5I8OH 4CVZB 3LCYA 4G8EA 2EDFA 1N0XL 4OKVB 4ZPVA 4PJ5B 5EPMB 35C8L 1XIWD 5F9JB 5IG7B 1IAII 4D0DB 3FB6A 1DLFH 5K93A 2HT2D 1A7QL 2WWMC 5JPNA 4ZS6C 5L9DH 5IVZA 3ARFC 5FKPB 5DVOA 5ANME 4FQ2L 1I1RA 1JWSB 3IFPA 3QQ4B 3PQYB 2B4CC 3UDWC 3O9WC 1SEQL 1I9IL 3QDMD 1KJMB 2H26B 4PB0L 4YDIH 1G0DA 3MV9B 3D18A 4PRIB 4QHMB 3GSOA 3HS0A 3LSOA 3WS6A 4C83B 3HC4H 5JXEC 4YXLL 4JFZH 2H6PA 2ICES 2EDEA 4PLJC 3CJJA 4JY5H 2HMIC 3BD4A 2Q1EA 4XZUA 4G6ML 4P9HH 2OBGA 3EOBA 3EZJB 3MJGX 5DJCB 1B4RA 4YXKL 4OZHA 3SDYH 1LO3L 2FECI 2JIXD 4PJIF 4PJCB 5F7YC 1K85A 3BH9A 3FO1B 2DQHL 1IARB 5T1LB 3KPMB 1FORH 1JPGB 4MJID 2C4FT 4GSDH 4ESKA 4XCEB 4F33B 2PCPA 3P30L 2F5BH 3EJZD 4PRNB 3H9YA 1AFVH 3V4PL 4EDXA 1KB9K 1UB5A 4HK0B 3WYRA 2NLJB 5I1LA 3MLUL 4UUJB 3WKML 1RUML 4R2GD 5IMOA 4G43A 5TE6H 1XZ0B 4MQ7B 1MLBA 5IEHB 2AJUL 1T22B 4BFGA 4OF8A 4GXVL 2AGJH 4R3SA 3U79A 1IQDB 2Y07L 1KLUA 3PL6D 3ULVD 4LSQL 3IETB 1GVIA 4U1LB 4KJPC 3C60B 3NABL 2XKUA 3BD3A 3CX5J 3WLBB 1YEDA 2ZCLH 2X4QB 5SWSB 4GOSA 3H9SB 3C08H 3G5YB 3MBXL 5BO1H 2EO9A 4LF3B 2AK4B 3O2DA 2ZUYA 4NUJA 4AEIL 3BPNC 4FXKB 3TIEA 3K81A 1NDMA 1DBKL 1QBAA 4JFED 4GLRI 5AG9A 3WIIH 2PO6B 4UMGA 4X6CA 3PGDB 3HAEG 1HEZA 3VFSA 3QIWD 3ZT5A 4J3TA 2VR5A 1KSRA 32C2A 3QI9A 5FO8A 1NBVL 3B9VA 5EBWB 2V7NB 4XCFL 1QSFD 2EE3A 5GS0H 1UWGH 3DNKA 4WJ5B 1TJIH 2DS4A 3MNWA 4NN7C 2E6JA 4XP1L 3VG9B 4LRIC 2F15A 5JTWA 3BD5A 3VXPA 3BXNB 3KPTA 5B38G 2I60H 4OCYL 1LE9B 4NO0A 1T4KB 4OQ1A 5CKAA 2F74A 2FSEB 3H0TB 3LH2H 5J6HA 2ICEA 1E4WL 2X7LB 1NCBL 4WWKC 3L5JA 4O51B 1JTPA 5I1GH 5DVMA 5C6PB 3MRDA 4QTIL 5FA4A 4E41B 2YD3A 1FNAA 5I9QC 3ALPA 2DKMA 4Z95L 5F71A 2J4WH 2R8SL 1JK8B 4I13B 4MXWH 4Y5VC 2D0GA 3HE6D 2A9NH 1KELL 3IJSB 2DQGL 4U1SA 3UTZA 4YE4L 3BPLB 1MHEB 4RIRA 4QRPD 4JDVA 4N0RA 2X05A 2VE6A 5ISZA 2X40A 4HIXL 1TTGA 1IE5A 4K3EL 4POYA 1KENH 4LLQB 5CJOH 4FQHB 1ZLUK 5HPMB 1RMFL 3QUXB 3FQXB 5D7LD 2DMKA 5IR1A 3FTGB 4JFQB 3VFOB 1KCVH 5JNYB 4OCMC 3VWKB 5J1SC 1JRHH 1MVFA 3LKNB 5TDOA 3TYGH 1A3RH 1NSNL 1A5FL 2FEDD 4DVBA 5BZDB 1PG7W 3DARA 5FGCE 4P5TC 5GGTA 1D6VH 1YEJL 1NUDA 3SGKA 4HDIB 2G5BA 1IM9B 1WVZA 3HR5A 4ENEC 4ONHA 1IAIL 2NTFB 1JPTH 1C7SA 1CI5A 2D7TL 4G9FB 1JWUB 2BVOA 1CTOA 3IKCB 4ZXBB 2E27L 3N06B 4OZGF 1BLNA 1KGCE 4P9HC 3QCTH 2ESVD 3D48R 1Q0XH 4Z0BH 3O6LH 4U3XA 4I5BA 5CIPA 4HK3J 4XVJL 4JFOB 3IT8D 3LHPL 3LKQA 1AQDB 4IRSC 4JRYD 2YBRB 4Y4KC 5BS0B 4WY7H 4Y89A 4JRXB 5GJSL 2DIBA 3WUZA 1Q1JH 3KYMA 4BK5A 3T09A 1U8OB 2ADIA 5D2NA 1KPVA 3O6FB 5E8OB 2P8LA 1OGAB 4LSPL 3ARDC 1CFVH 1TZGL 4DGYH 3GM8A 5DJ6A 4Y4HB 3CIQA 4G8FA 1MSPA 1I7ZA 3CMOL 2DIJA 4OQTA 4N8CH 5GRJL 1FFPA 2XXCB 1HH9B 1WZKA 1MCRA 4PV9A 1H3WM 4ALAH 2C4XA 1JNHA 2UVFA 3FONB 3F62A 4N1EA 2NY0C 2AP2A 5DD0L 1T89A 2FECL 2AKRB 1ZHBA 5I30L 4UQ2B 2ZCKH 3ARXA 4Y16B 4I4WA 5C3TA 2X9WA 2PXYA 1GOHA 4JDTH 3QULA 3LKSA 3MACL 3WS3B 1ZWIB 2W9EL 1AD0A 4NRXB 3EO9L 4ZSOA 2W92A 4YHML 4JR9H 4PGBA 5KSUB 2VLLB 2Q7YA 2D03H 2BNQE 4YBLB 5J7CC 4QRQB 3O41B 1O5DT 3RY5A 4YWGL 2I9TA 3JTTA 2R0WH 5IEKB 1R5WA 4YR6B 1LE5B 3DX9A 2WP3O 2AEWA 2NY7H 1GYAA 3OB8A 3K4ZA 5GS0C 4X99B 5HI3C 1MCOL 4OF3A 4IRJB 4TULH 1ACZA 4CVXB 2VLMD 3BZ4B 1DQJA 4ZQKB 2NXZD 2P49B 2JK5A 1AGCA 3TBWB 5DEZA 2VXQH 4N90E 3OG6B 1CLOL 1PEZA 5ADOH 5HHMD 4BQBA 4PD4J 4X5XB 1OTUD 4Q6YA 5CINH 4POZD 4X6DA 4FFYH 2BHZA 1ZS8B 5CJBA 5E1HB 5HGAA 3T0EE 5BOZG 4X5WB 1RZJH 4OT1L 2VZOA 4KVNL 4CDHA 1C08A 2EECA 1F6FB 4HWBH 4QRTA 1A6AB 4L29B 4U31A 4AL8H 1JF1B 3CVHH 2F19H 5BV7C 2PYEE 3RWDB 3V6OA 1JHTA 4BA8A 5F7DB 3MJ9L 1F4YL 3BX7C 4NHUB 3WSQL 3LS4L 3IU3B 2BY0A 4H1LB 3BPCA 5ERWB 1N4XL 1XF3B 5D1XA 5B21A 2UZIL 5ICXB 1CYGA 3O6MH 2FJGA 4PJ9B 1MIEL 2FX7H 3T0EC 3EW3B 4OZIF 3OXRA 5L6YH 2H3NA 3Q6FB 3PWJA 4NGHL 3QEHA 2YPLB 2CDFA 3QG6B 1F4XL 1JI2A 2VC2H 2EXWC 4NFCA 4S1RL 1AGFA 4RAHA 2X70A 5HYFA 5KANG 2A6DB 2SEBA 4WTZG 5F88A 5D96C 4M61A 1FNEB 5DYOB 1FC1A 4U1HA 1FV1B 3OKMA 4P59L 5DT1H 2CKBL 1MHHA 4WUUA 1G7LA 3PWNB 3O4LE 4QO1A 4G8GD 5CP7B 1I1AA 1GOGA 3MXWL 1MFEH 4LBEA 2Y6SC 5BJTB 4PGEB 2F53A 3E6FB 3FHQA 3D2UA 1T1WA 3NIDF 1HSAB 1AC6A 5IFJB 3IVKB 4I9WE 4D9LH 1Q94B 5C0BD 2BNRA 1BVZA 2P4AB 3HC0B 5CP3H 3VFWA 3HNVH 5JR1H 2BRRH 2C4FU 4CGTA 3MJ8A 1F8TL 1MEXL 4XP6L 2Q8BH 3J8F7 4GO6B 4EN3D 3VXQA 4HKXA 3QNZB 4YFDB 4DVRH 4RZCB 2PNDA 1R3HA 5AZEL 3E8UH 1N5AA 4ODXA 2EYSA 4ONOA 1E27A 4MNHB 1YPZA 3QI9D 5T1KA 3RAJL 1J87A 1JGDA 2FNBA 4XHJC 3S35H 4L4TB 4NQEA 2F54D 4HIHA 5GJTH 2MJWA 4YFEA 1ES0A 2F58L 5E8NB 1WFOA 5DJ0B 5EWIL 1HQRB 3HPJA 5EBMB 4YX2H 4NO0D 2D7QA 1FNGA 3TO2A 3CFBA 3HTLX 3BEWA 5D70L 5ENWB 4OGXH 4KHTL 2J7LA 5F9OL 1RSFA 1VSCA 1D6EB 3S37X 5FYJU 2H2PD 1YNKH 4PJ5A 2XFXB 4NFDA 1F02I 2OSLB 4NO5B 4P2OD 3CXHJ 5I71B 1YYMH 3S88L 3LIZH 3UCRA 2AJZB 2JCCF 3RVTD 4M43L 3QAZC 4HV8A 4TTDD 3UYOD 1CTNA 4OFDA 3SKOA 4Y4FB 3TBSA 3TO4B 4M4RA 3EO0B 2OI9B 2VLRE 1EO8H 5L8JB 5D1QB 5F6HI 3V0VA 4QEGA 4MNQE 4RISH 4YXHL 1I1YA 2MCG1 1WLHA 1KJMA 2H26A 3QUYD 4FFVC 1CXEA 3NCYS 3EDJA 2X9XA 4DZ8B 2EKJA 3IDMA 5IHUH 4FMFA 1QQDA 4PG2C 5JZ7D 3RX7A 1KIUA 5FA3B 4C4KO 1D5XB 1NCDL 3T0BA 3ZKMD 3KPLB 5IFAH 3DOSA 5DJCA 5JDSB 2CO7B 2XZAL 1KOAA 1UJ3B 4W4NA 5EU5B 3KPOB 3HE7C 5HI5C 1MRDH 4ELKA 2XQYG 3HI6L 5F97E 2DB8A 5AYUL 3ULSA 3STLA 1U8MA 2Y5EA 3GNMH 3L3KA 2DQIH 2CXKA 3TPUA 5F1IA 3VFUA 3ES6A 5C6TH 3MTRA 5KSAD 4YDJB 3IDGB 4QHLA 5BRZA 2VH5H 1BQHG 4HK0A 4U7SA 1B2WL 2YUWA 5FKAB 4QNPE 4U49A 5GXBB 5IB3A 1B3JA 3RIFK 4NQDB 1MJ8L 1DTUA 4MQ7A 5IVXA 1CE1L 2FHCA 2MCPH 4BSWB 1AGEB 1OPGL 3IDUA 2D0FA 1LO0H 4WO4A 2CRZA 3GI9L 3P9MA 1G6RB 1OD9A 3C60A 1GHFL 1W8NA 2P5ED 4HHAA 1EGJL 4NZTL 2X4QA 4HKZB 4W68A 1IVLA 5CMAB 3RA7H 1QOKA 3G5YA 5TF1H 4OJFL 2VDRL 4NYLA 2AK4A 2DN7A 4MXQC 3TWCH 5FGBA 4OLXH 1ND0B 4JZOB 1JHKL 1R5VB 1DANT 3ZZ1A 4TQEL 2X1XR 3IDYC 1FRGL 12E8L 4JVUA 1GC1L 3DXAE 1UXSB 1RZFL 1IC1A 1R3LA 2MFNA 2PXYD 5T1DH 2VABA 1NAMA 3VFTA 4ZUSA 3GBNH 1JZ6A 1RZGB 4TUOB 2VDML 3INUL 1B6DA 1GGCL 4ZUWB 4M62L 1QLFB 4LIQH 3QEQE 3BPNB 2ZUSA 2HTKC 4LASH 2YC1B 2DBLL 4R7NA 3F7QA 1B9ZA 2HT4D 1WBXA 4DKEL 5I1CH 5LKNA 1FO0B 1ZA6B 3BXNA 1JYNA 4CNIB 2JB5L 1LE9A 1IC7L 2VL4A 3QCUL 4N0CD 3H0TA 3DO7A 3PV7A 4W4OC 2EDDA 1BP3B 4NJAH 3Q1SH 5CJXA 4I0PB 3N1PC 4F7MB 1N7ML 4FFZL 3LRSA 3KHOA 3D25B 3GJEB 3MOAL 2EYTB 1BVLB 4PRPA 3V6ZA 1FL3B 1KJ3L 5HYJE 3NN8B 4NN7B 3ULUD 5DQDL 3FT4B 4FG6C 5IT2L 1EUUA 3P4OB 5IQ7H 3IJSA 4Z8FL 1B90A 1YEFL 4NRZB 1M7IB 4XI5D 1I3GH 3L5XH 3MLRL 1MIMH 3UP1A 5CILL 4I48B 5E2UH 5IBLD 2EDJA 4GBXD 4F7CB 2CSPA 3HZMB 5GRZA 1RK0A 1CCZA 3LB6D 3RDTA 4FQHA 5I19H 5HPMA 3BN3B 4OLVL 1T1ZB 3RHWF 4R6UA 5EOTA 1NGWB 4Y5VB 1KNOA 4JFQA 3VFOA 5GS3A 5DEFA 3EYQD 4WW2F 4NM4L 3UYRL 2P43B 4L5FL 3GIVA 4OCRH 3BWAB 1SY6H 1QFUL 4L3EE 2Y7QA 5EZLA 1A22B 1FYTD 3O8XA 1YZZA 5SV3A 3OR7B 5CD5C 1MJUL 1J86A 2VLJA 4BELD 5HGDA 2VZ1A 1LO2L 4O2EA 1EO7A 3C6LA 1IM9A 5KVMC 1KLFA 1OLZA 1MHCA 4G9FA 1Y6NR 1JWUA 3QXAB 1HINH 1DN0A 4NNXA 2BY2A 1CQKA 4LCUA 3KPSA 2CK2A 3QPQD 1XF5A 3IDXH 3DETD 4WUUD 4YFLF 4IOSD 4P5TB 1P7QB 4JFOA 3K8KA 4CADA 5KN5B 5D7JC 5C9JA 5I15H 2VZSA 2BXYA 2Q3AA 3ZL4L 3KG5A 4A6YB 1KB5L 5C0EB 3WHXB 1BD2E 4K3HA 4AK1A 3AB0C 3I84A 5SWQA 3RKPA 2X4OB 4LCIH 3O6FA 4J23A 1IEAA 4LLWA 3W0WE 2X4NB 3K2UL 1T3FA 2BNRD 4LDEB 1PX3A 2C1PA 1RVFH 5E5UB 5E2TH 2E7CA 2NNAB 3O3EB 2Q3ZA 2AJVH 3FQWB 4IRSB 5IF0A 4HEME 4Y4KB 1QHPA 2DM4A 2DM3A 5FGCB 5D6DC 4UQ2A 1TETL 4Z7NE 4Y16A 2EE6A 4LIQE 2DWEB 5CBEB 3ARDB 4J3WA 2EDXA 4GW5A 4NP4H 3O2VL 1MNUH 1JPFB 2NY5L 2FGWH 4NUGL 2OP4L 2VDOL 2O5YL 2Q6WB 3VD3A 4KVCH 3VXUB 1NGZB 2C3XA 1VA9A 2FX8H 4M6OL 5D72H 3RGVA 1RZ8A 1VB9A 3V5HB 2OS7A 4F2MA 3GGWB 2AERT 2P44B 5DVNA 3O41A 5TE4L 1AXSB 1JGVL 1MQ8A 3I6LE 2YD8A 3UBXG 1U95B 5I76A 1A2YA 3TJHC 2CGRH 4E5XB 4ELMB 1MFBL 1HILA 4YR6A 1JBJA 1WFNA 1LE5A 1GGIL 2XTJE 1VGKB 4PUBH 4YAQB 3DRTA 3D0LB 4PJ5D 1U58B 1GGUA 5F96L 3RVWC 2HLAA 1PDKA 4GJTB 5JOPE 4J8RB 3IAQA 3VWJC 3BZ4A 4ZQKA 1N8ZB 3TIDB 3EDFA 3TBWA 4N5UA 4RFNC 5KANI 2A83B 4LRNH 4X5XA 4F15C 3CH1A 5GIRA 3C2SA 1NFIB 3PQYD 3CCHA 4HJJL 1U93A 2YMXL 1Y18A 4MD0A 5EZJA 4AYFA 3VFRA 5E2WL 4HXBL 1A6AA 4MCZB 2XTJC 1UM6H 3PJSA 3GSNA 3U7WH 4PRID 5DHVA 3G04B 2OCFD 5DI8A 2P5WE 1T0NA 4MS8D 1F11A 4Z78B 5BVPL 4F80A 2BNQB 4JPIB 3T2QA 4K2UH 5HGHA 3DHMA 2GCYB 1F4WH 1U3ZA 3DIFB 3BDBA 3OJDA 4WI4A 4H1LA 3WE6A 1YEGH 2ZKHL 1XF3A 3S4SA 1U41A 2ADFH 3BSZH 5EC2B 1O7SA 5D4QA 3TPKA 1SJEB 4KK9C 5GRUL 1CK0H 2KZ1B 15C8H 1MFDL 5T1LD 3LKRA 3UTQA 4U0QB 1TPXC 1BVKB 5BV7B 3RFZC 4K9EL 3CSYA 3L3JA 5I16B 2CUHA 2Z31C 1PSKL 2YKLH 3ARPA 3QPXL 5ICZB 2A6DA 5BRZD 4HT1H 4K3JH 5SWZB 1FDLL 3GSWA 1CQYA 1AP2A 1FFOA 4X6BA 2R2HB 1IRAY 3U46A 3MCLH 1IGIH 5DYOA 4PJDA 3MNVB 2V2TB 5JW3L 1FV1A 1YNLL 2F8VA 3P11H 3T0EB 2APFA 2P24A 3Q3GB 4RFOL 1FPTH 5JLZB 3GSRA 4PJFA 1MREL 2ED9A 5B39G 3C60D 3QISA 3D5OF 1ACYH 5EOCL 3DHJA 1CL7H 5E03A 2PYEB 4M8QB 1HSAA 5SWSD 3ARBA 5T3XH 4ZFFA 3IXAB 5I1HH 1A3LL 2XWBA 2IH3A 3CSPA 5D96B 2AK4D 1A21A 3TCLB 5DD1L 4YHIB 2CDEB 2BSRA 3P9LA 3V79C 1KPUB 1L0QA 3B5HA 4XPTH 5L8KB 2PO6D 4XH2A 3L3IA 2C3GA 2OK0H 3WNMA 2E5EA 3QNZA 4ZUVB 1XGRB 4JHWH 3VD5A 4BH7A 4N8VG 5D1ZC 1A4KB 4IOFC 1NCWH 5K9KA 5GHWH 1EEYB 1U0QA 1WBZA 4L4TA 1EAPA 4U6VH 5DZLA 2OR8A 2OZ4L 3CAFA 1L7TL 5E08L 1NKOA 1O0VA 1TJHL 3DMMC 4FP8L 5DJ8A 2X4RB 4JFFA 1NMBL 3SN6N 2ZJSL 3QDGA 1QACA 4PJEF 4X9IA 3O4LB 4QWWC 3WKNA 3ZKND 4U1GC 3GMLB 3MFFA 2EEDA 2H1PL 5ENWA 5D71L 2BSSB 4KK8D 3N50A 1H3PL 1OQXA 5DMGD 4E41D 1NH6A 4PRPD 1AO7E 3X11B 2ATPB 4NO5A 2FHFA 4R4BB 4Q9CA 3T1FB 1FNHA 2AJYH 1PYWB 3UTSE 4AT6B 3LDBC 3PWUB 5F1SA 5D7IA 1U8KA 1R3KB 3WFDH 3ZO0A 5D1QA 3ZDYF 1U8LA 4EBQL 5SX5K 1MRCH 3TBVA 4OCXL 4KY1H 3GSXB 4ODTL 5JIIA 1VDGA 3AC0A 1N3NB 4DZ8A 2Q7NA 5DHXB 1GIGH 1OAQH 3QO1A 3WNKA 1EHLL 3MJ6A 2HT3C 3X3FH 2C9AA 1OAYH 4M48L 2GJ6E 2ADJB 3RTQC 4U3CA 5DZNA 2OL3L 4XBEL 1RZKC 5I75C 1TNMA 2JJUA 3O8XD 4XAWH 4GW4B 3ZYJA 2RR3A 1UJ3A 3GBMH 4EUPG 2ERJC 1MCEA 1I8MA 4UINH 4EOWL 1WEJH 5L2KB 3C6LD 1IM9D 5K9JH 5KSBA 4KUZH 2MSPA 2YS4A 3BKYL 5HHOE 4G9FD 4I2XE 3VI3F 2F8XC 1IAKA 1D5IH 4ZXBD 4OB5L 1WITA 4YDJA 5BVJB 2I9LB 1P9MC 5HDLA 2ED8A 3LEYL 4NQDA 4OZFH 2YUXA 3HE7B 1M1SA 1CD1B 1FLRL 2VLRB 2YK1H 3MA7A 5BS0D 4GKSB 3CVHB 4JRXD 4MNQB 4C59B 4W6YB 2PF6A 4TNWF 3MXVL 5ESQB 3O6FD 1OGAD 4HZLA 5GZOD 1P1ZA 5T3ZL 4YUEL 3FOMB 1FFNB 4PV8A 3ZDYE 4Y4HD 4Q0XH 5LWYH 5FHBL 4U2ZA 4PJXF 5CEYA 1SYSB 3KR3H 1FZOA 1BIIB 1NUGA 3CZFB 5DRWA 5I1DB 5J13C 1YJDL 2BHUA 3HB3D 1E4XI 1AY1H 4Y16D 3VFMB 3KYOB 4AEHL 2DF3A 1Q9WA 3QT2A 2FZ3B 3PXHA 3DVIA 5I74C 5B38B 1BECA 3B3IB 1RZIB 1DQQB 3OKKB 4I0KA 5T3ZD 5IWLC 4LPYA 2VR9A 2JELH 3UTPD 3I50H 2VDNH 3VI3E 5I2IA 1R3IH 4RAUB 3REWB 2FO4B 5TDNB 3RY6A 1N5YL 5JQHC 1ZA6A 4XVUC 2EIEA 2ARJA 2JF1A 2BOBA 5HSFA 5CLWA 4XBPA 4KHXH 4NQSB 4OBRA 4FQXC 1HYSC 5EU6E 4ZFGH 1YEEL 3BKJL 5CGYC 5ESVB 1MUJB 2DI9A 3DI2B 5EO1B 4NQCE 4PR5B 3SPVB 3D25A 1S8DB 1L7IH 4IRJD 3MRBA 5C09A 3EYSL 5IW6A 3NIGF 1FGVH 1EV2E 5HHPA 5LQBH 5C0CB 3CDCA 3IDJA 3GDBA 1NCCH 1CFTB 4PJXE 4G5ZH 1T7XA 1AHWC 3PDDA 1QPPA 3MJ9A 1M7IA 4KQ3L 1WTLA 3TA3C 2P1YA 3PWLA 4I48A 4XP5L 3HZVA 3LKOB 4YHOH 5HD8C 4P4RB 4Z7WF 4Y2DB 1XR9B 4Q2ZB 3D0VB 4OI9A 1VHPA 5HJ3B 5A2JH 2QSTA 1MFNA 5LGJB 4X7CC 3OJVC 5KAQF 1TJGL 1WISA 3MRKB 1WIPA 4LVNC 5LVEA 1ZT7B 5H35A 3GMNB 3QZWA 1MAML 4HX1B 1F5WA 4GKZB 2WNGA 3CD4A 1EEZB 4PJ9D 3L7FB 5C7XH 2GQHA 4I3RL 4HCRA 1DBBL 4IMKC 5FUOH 3IU4H 1WUNT 4IRZL 4X4YA 5ABDE 5DFWH 5DWUH 4QY8B 7FABH 4MA1C 3NFNB 3MLSH 2XA3A 4P9MH 2BMKB 1F2QA 3QXAA 1WGOA 2FBOJ 2FYYB 5CCKH 3HMWL 4OM0L 1W0WB 4JO1H 3DVGB 1ADQA 1QVOB 4JDZA 2YPKB 2FD6H 1QKZL 3V7AE 2O61B 2XZCH 3MRIB 4J4PC 2IANB 1A4JA 4XC1L 2M2DA 1WWAX 4NKDB 3QFDB 5TQ2H 1MFAH 3CLFH 1VGEH 3T3PF 1QSEE 1PLGH 1T5XB 4YHNA 2X4OA 2IPKB 4X8JB 3OKNB 1CVRA 5C2BH 2W0FB 2X4NA 1HXMB 1IZJA 1IL1B 1U8JA 3VFVB 4XPGH 3BT2L 3DV4A 3IFNH 4MDIA 4OFYA 4RNRA 5DJXA 1NLDL 1KUMA 1WFUA 3UAJC 4YEFA 3MLYH 3NFPB 4IOIB 4P3CH 4M6NH 2RJMA 3UO1L 4XWOC 3MYJA 4HIIA 2PTTA 3DWTA 2HFGL 3AB0B 3F12A 1BZ9A 1F4AA 1VCAA 2IFFH 3OKYA 3AXLA 4P46B 3E6HA 3CC5B 35C8H 1UZ8B 4L4TD 5EZIH 2WAHA 5EA0L 1FIGL 2VAAA 1LEIA 3G5XB 3VXUA 1IC4L 1NGZA 43CAA 2EXYC 3QQ9D 2GJJA 5FUCE 4JFFD 3QXWA 4EI5A 5TE7H 5DHYA 1AGDB 2Y23A 3FO0H 4FQ2H 3IJHB 1VFAA 2HVJA 1FZMB 4HUMB 2XN9B 3WXWL 2BVEA 1I9IH 1QFWL 1KN2H 3VFNA 3DYMA 1EEUA 4XCCH 2VOTA 4BSJA 1G7HA 1YEIH 4MCYA 1QBBA 4JQXC 3D0LA 3H9HA 1K3ZA 2X44D 1FN4A 4X4MA 3T3PE 4H8WH 3IF1A 3C5SA 3SE3A 3FMGL 5KS9E 4BUGA 5GGRA 1IGFL 4TSAL 1SJHB 4ONGL 4UU9B 3ZYIA 4G9DB 3VXSE 2C26A 5FUCC 2B4CL 4X80H 4Y4FD 4KZDL 5F72S 4M1DL 4OCNC 4L8SC 3ULVH 2IAMA 2YA0A 5C0IA 4M7JL 5D1QD 4X9GA 3D69A 2Y06L 4ZUUB 1JP5A 2QV2A 1KEGH 2DLFL 1ORQB 3KPNA 4MCZA 4PS4L 2EIBA 1PFCA 2C5DC 2I07A 4JPKL 2WWMD 1LVEA 4XMLL 4HWUA 3VWJB 4ZS6D 5ESAB 1QLRB 1JGLL 3WIFB 4RFNB 5D5MB 4P4KB 1CDUA 3B8SA 4FTVE 4HC1A 3MLUH 5FYKD 2GCYA 1N6QL 2R0ZH 4J3VA 4F15B 1QHOA 4D94A 1R24B 2E9WA 2NX5B 3G5VB 4HZAA 3KHQA 4XRCB 3JV4A 2CMRL 2OM5A 4PJAB 5AWNL 5ADPL 3REVB 2Y07H 3SO3C 4UB0H 3VXTA 1QNZL 1J18A 3QNYB 1G6RL 4L4JA 4OLWL 3RWFA 2XTJB 4P0DA 1NCNA 4R26H 4XPHL 1BVKA 4YPGA 5JXED 2BVYA 5DMIL 4G7YH 5IW1A 3FRPA 3RPIA 3FQNA 1FNSL 4RMWA 3TBYB 3OZ9L 4BZ2L 1CGWA 4AEIH 2HTLC 3OAYH 3STZA 4EVNB 2R2HA 3MV01 2VRAA 4NQDD 4TUKL 2WBJC 1ITCA 2X1PA 3QIUB 5EBLA 1BREA 1G7QB 1RURH 4PRHA 3RWEB 4G6FB 4HQQH 4LLAA 3N9GH 2WM0A 3F7RA 3Q3GA 4YLQT 4JPVH 3VFGH 3F7PC 2YD5A 1TPXB 1ZE3C 2G75B 3ABZA 4FA8A 1C5BL 3BI9X 4G3YH 4HW6A 1R0AH 2APTA 3PABA 3JTSB 1N0LA 3KJ6H 4RMQA 1NBVH 4M8QA 3ULVF 4UBDC 4U2YA 1A7NL 5GGSY 3BWUC 3NCBB 3QO0B 2ZCHL 3F5WA 4RMTA 1BOGA 3S96B 1FO0L 2MMXA 2D31A 3QDME 5F7UA 4ZD3L 3KS0H 3C5ZC 3U2SA 4C57C 5HY9B 3GJFH 4LSDA 4KJPD 5DK2B 2O26U 5ALCH 3DBXB 4LOUD 4ZUVA 4OD2B 1XIWC 2WIMA 4WHTB 5GRVL 1EJOL 1UCBL 1UACH 4YHLH 5JPMA 1SYVB 1YUHB 2IQAB 3FO9A 4R90L 3NMEA 2ICWI 4CU6A 3PNWB 3L5WA 5J6GA 1J5OL 5EO9A 3H8NA 5EULV 1MJJA 5EU3A 3RWGA 4YE4H 2X4RA 3WBDA 3TV3L 4MJIE 1VFBA 1XMWA 3O3BB 3WCYA 4NT6B 5CGTA 4CN1A 1XCQB 3DSFH 3GMLA 3QFJA 1A7PL 4JANB 1HCVA 4I0PD 5DK0A 3S3PA 5IHBA 1FHGA 3FN3A 2BP3A 4O9HL 1RMFH 2Z4QA 4PJGA 1NMCC 5D7SL 1JRHI 4K94H 4JO4L 1UB6A 4LAQL 2DTML 2NW2B 3FAWA 2VL5A 3DMMB 4MNGE 4XC3H 3MV11 3ULVE 2IH1B 5FB8A 2GFBA 4OI8A 5I8OL 1NSNH 1BIHA 3ZE0F 4AT6A 4U1GB 2CK0H 1MWAH 1PZ5A 3CSBA 1R3KA 1YEJH 3KPPB 4FHBD 1CGUA 3EJZC 1DLFL 2X41A 5GRXG 2FEEL 5L9DL 2HFFA 4H8WC 3S34H 5L7XH 2EE9A 2H2SC 3MRCA 4R2GC 3KLDA 4JFEE 5M7QA 3QQNA 4IEFB 4Q97A 2V2WB 3C9NA 5FHAH 3LQMA 4JZNA 4X0KA 4CRPA 3LDBB 2WLZA 2NMSA 2ITCA 3PL6C 1A1MA 4YDIL 1QBLH 2XT1B 3PDGA 5AEAA 4LLUB 1DDHB 5GJSH 3HC4L 1QSFE 4JFZL 4R0LA 4YHPB 1BQHB 5L2KA 1EFXB 2CLRA 3FRUA 4WRLA 3UJJH 4BQCA 5LGHH 4ZFOL 4JY5L 2NY4C 3SE8H 4N9GB 1AO7B 3WDIA 4P9HL 2CDGB 3NZHH 4WU7B 3GHEH 2KH2B 1YN6B 1VACB 1IGMH 3IKKA 3SDYL 5GRJH 3U36B 2R1WB 2I9LA 2BVQA 2AABH 3BKCH 2CR6A 3O81A 1IAMA 5I75B 3V5KA 1S7WA 1BFSA 3RVXD 1J1OH 4AY0A 4XPAH 3SDCC 1FORL 3QIWC 1P7QD 4GSDL 5IK3A 2ERJB 2F5BL 3QR2A 5C08B 1VKXA 2BOCB 1AFVL 1CFQB 4ENED 3ZE0E 3C5JA 2OJEB 1L4IA 2NY2C 2XV6B 1SM3H 4YHKH 1FFNA 1I3RA 4Y1AA 1I7UB 4E0RA 1OTTD 3P4NB 3DROB 2AGJL 4LSVH 2VIRB 3BP4B 5LCVH 2GJ6B 4ZAKA 1K9TA 3EJJX 2KQMA 3HAEA 3TYFB 4X6EA 2X4UA 3F6IA 1IAOA 1JPSL 2MWCA 1BIIA 1TNNA 5BQ7B 3CZFA 3KXFA 4GRWH 5DQ9B 4YWGH 4DOHE 4YJZL 3B9KB 3C08L 4Z7VB 3BDXA 5IGXH 1ZGLP 1HNGA 5BO1L 3ARDD 4WV1C 2QHRL 3VG0H 2OLDA 5K59E 3ZE2F 5HHOB 1G9MH 1R5IB 4GG6B 5BXFB 5B38A 4PB9L 1RZIA 1DQQA 3VXUD 4CDGC 2AJXH 3WIIL 2Z8WC 1KGCD 4LKXB 5D2LB 4LNRA 1CLOH 1A9EB 5F7LB 3VMNA 2EDNA 1EUTA 4F9LA 2CD0A 3KPRA 4HKJB 1INQA 4CMMB 1BFOB 5DRXB 4ODSL 4OT1H 4KVNH 4J7RA 5FO9B 4TNWK 5GS0L 1UWGL 1HWHB 4C58B 1TJIL 1G7JA 5ESVA 2VQ1B 5FGRA 5JA8B 2ESVE 4HJ0C 1S5HB 2ICCA 2I60L 4FQCH 3LH2L 4LSRH 1OD7A 3EYFA 4JRYE 5LJYH 4HUVA 1DEEB 3PP3H 3LS4H 1FH5H 2AJSL 5I1GL 4XCYA 1CFTA 2UZIH 5CZKA 4FQXB 4OI7A 4JZJC 5HVFB 3MLPA 3DX7B 5IV2B 4U6HB 3LEVH 5CJQH 4MQXC 3GMMB 4U1NB 2J6EH 4MXWL 1U8PB 1W72A 1XH3B 4K94C 2A9NL 2GAZB 4HF5H 4GRWF 2G2RA 4MSWA 5DFTA 1FIEA 1T5WA 4D3CH 5HYQB 4JFXA 4QXTB 1P4LA 3ZE2E 2BNQD 2HJLB 5I0DA 3RY4A 1IKNA 4QRRB 2CKBH 1AHWB 3O0RH 4CJ0A 1RHHA 1KENL 1KC5H 1K5NB 5CJOL 4JFDB 2XNAA 3TA3B 3L7FA 1MCSA 5EUOE 1IGYB 1KCVL 5MP6H 3NIFF 5CKGA 1GRWA 2N7BA 3T2OA 3FOLA 4MX7A 1F3JB 3ARQA 3MUZ1 1S7TA 3TYGL 1QG3A 1IAIM 1JTOA 4LVNB 4ZS7H 5SWZD 4U1IB 3WXVH 4NO3B 2FYYA 1D6VL 1A14H 1IT9H 1XFPA 5H94A 2D7OA 1QVOA 4PRHD 3T0ED 3SGDH 2IANA 1JPTL 3E2HC 3MRMA 3WNPA 1JNNL 3GSVA 1H15B 5E56A 1G0YR 5E5MA 1HXYA 3QCTL 4Z7UB 5HHME 4OV6F 1Q0XL 4RA3A 4Z0BL 3O6LL 4X8JA 1CXLA 4G80A 3WN5C 4MAUH 1NANH 3BRFA 2ITDB 2A6KB 1IM3A 3BMWA 4KJQC 4GRWE 4YZFF 4WY7L 3UPRB 1TZIB 2VZUA 4AG4H 4F7EB 1Q1JL 2CLVB 2CIIB 4YK4C 2HVKB 1DEDA 3BEVA 5DUBB 3NACH 3MV8A 3QJFB 4U6XB 5F6HJ 1CFVL 3CFDA 4PJHF 4DGYL 3C6SA 1FVEA 5JW5A 4NBZB 4O5LL 3HLAB 3OKLB 4MAYA 4KROD 2NY6B 4N8CL 3MBEB 4P46A 4NHCH 4D8PB 4X6CF 3ZKXB 4ALAL 4PJ7B 2Z0BA 2AQ1A 5T5NG 1BX2B 1MCPH 3NIFE 3UBXB 1OTUC 4OZHE 1ZT1A 4POZC 4WU5A 2CUMA 4PJBB 2DYPB 3BJLA 4M43H 2ZCKL 1DUYA 4LU5H 3RNKB 1XGUA 3OJMB 4JDTL 4NBXB 1OAKH 1B0GB 2IC2A 2N7AA 3U9PH 4JQIH 3DUSA 2ZUXA 4MXVF 5L2JB 2Q86A 3WS6C 4JR9L 3SEPA 4LP4A 1G9MC 1QSEB 5FO7A 4JEGB 4XHJD 2D03L 1AR1D 5GISH 5C0AA 5EFIA 4EKXA 3MROA 2VDPL 4ZUTB 3VGAC 5T1MB 1IC5H 2R1YA 5CIPH 2O5XL 2BC4A 2WV3A 3NCMA 4G9DA 2IALB 5ITFB 1BOYA 4ODUB 2NY7L 1M05A 3FZUC 4XNZC 4YZFE 1J8HB 2H45A 4HH8A 1YMHB 5JIKA 1QA9A 3KYNB 2EH7H 4TULL 2Y5TB 2HA1A 5E7BA 1E6JH 3EFFB 3BZEA 4QRSB 1FG2B 2VXQL 5DRNB 5ADOL 3RUGB 5FOBB 2DQTH 4OQTH 1XGYH 5CINL 3FFDB 2GSIA 3CPLB 1E0OB 2RB8A 4X6CE 3WIFA 3K1DA 2A6JA 1A02N 4Z7QF 4P4KA 1B2WH 5AD0A 3HMXA 5IMLB 4ODVH 1I8IB 3QWOA 5K33A 3DYOA 1P84J 4L8SB 1R24A 2NX5A 5HGBA 3HZKB 4AL8L 3CVHL 5BW7A 2F19L 1NJ9A 4DFHA 1OPGH 3REVA 4L1HA 1RJYB 4WTZA 4NN6C 5L2KD 1GHFH 2D9QB 3G5ZA 2YD6A 4MXVE 3G6JA 1YQVH 4IHOB 5IVNA 5KS9B 3PE9A 3LN5A 3O6ML 2FX7L 3DV6B 5L6YL 4NM8H 5KVFH 5B39B 4HAGA 1D9KB 3BHBA 12E8H 5I1KH 2VC2L 3SO3B 2GK0B 1G7QA 2VLRD 3HE7D 1T1XA 5HI5D 1RZFH 3FQTA 4RFEB 4U7KA 3QI9C 4QRUA 4MNQD 2R56H 1M71B 1MLCB 3LVEA 2BVPB 5EC1B 1FZJA 1TLKA 5DT1L 3ULUH 2QSQA 4ONFH 2E9BA 3O11A 3BP6A 3QO0A 4A2MA 3SGEH 2UYLA 4N8VB 4LHUA 1MFEL 5ISZE 5GPRA 1NUNB 3EYOB 5GS1A 3S3SA 3ZYOA 1IC7H 4KRLB 4XPFH 4ZMAT 5EN2B 4M7LT 3QYCA 4YFLI 4D9LL 5DK2A 1DUZB 4WHTA 2FX9H 1X5HA 1WZMA 1HYRC 3HNVL 5M94B 5JR1L 2BRRL 4UT6L 5INDA 1SYVA 1YUHA 4P5KA 2ZUQB 3RVTC 4BZYA 4MXQD 4ODBD 2Q8BL 4PBXA 1I4FB 4KDTA 4DVRL 5E1AB 4KMLB 2FIKA 1FJ1B 3C5ZB 3QDJB 2XOTA 1KLGB 3MRJB 1ZLVK 1E28A 3S35L 4NT6A 5CILH 5JOFA 1XCQA 5GJTL 3MRGB 4F58L 4OAWA 3GO1H 5E2VH 4NPYA 5DJAB 1NBZB 1ORSB 5JZ7C 2BDNH 3S37H 2HTKD 1M6OB 5TH2A 4QHNB 4L8BA 2N4IA 2BZDA 1HKLH 1LDPH 5C0CD 1P6FA 2FL5B 1EZVY 3FQRA 3D6GA 4OGXL 4R96A 1H9VA 1RIVH 4P57B 3SGKC 5J9PA 3DPBA 1YECH 2P5EE 1JHLH 1BJMA 4KTYA 1YNKL 3ULUF 3TBTB 5E9DA 3SJVA 1UH2A 4BH8A 3KPPA 5C8JB 3MUJA 2F8OA 2A0LC 4HS3A 1YYML 5I73C 3LIZL 4Y2DD 4BQ9A 1NMCB 3CFKB 5IJKA 2J1KA 4G6AC 3FT2A 4HUNB 4FQJH 4XT1C 4XB7A 3DGGB 4KJYB 3QHTC 3BH8B 1EO8L 3D3VA 2V2WA 4EUPB 4OZ4B 4PIRF 6FABH 4RISL 3B4NA 2GTZB 4HGWB 4C54A 5D2NC 4I3GA 3IS1X 2YEZA 4ZSOE 4OLEA 1XGTB 2VISB 3ZL4H 1DDHA 1OW0C 1KB5H 2UWEF 3HRZA 5D9SB 1MCLA 2EDKA 1BQHA 4IBLT 1NC4A 3KNBB 4WI6A 3ARGA 4M9PA 2AV7A 1S7RB 4L9LA 5IFAL 2CDGA 3LMJH 5C0GA 4J2XA 1T89C 4Z0XA 3CFCH 1N64H 4ZFZA 1MRDL 3KJ4C 5DR5H 1BFTA 1IFHL 3EDKA 2PXYC 1T0PB 2IAND 4H0HB 1H3TA 2IFGA 2DQIL 1N59B 1H5BA 5C08A 1TETH 3RL2B 5C6TL 4MDJA 3V4UH 5I1JH 1CFQA 1RAMA 3ULUE 2VH5L 4R4NC 4HAFA 1ZHKB 2NY4B 3CFEB 3Q48A 5CUSH 2O5YH 4X6DE 1WCBA 1MVUB 2MCPL 1AKJB 2C1OA 3MREB 2K9UA 3SDCB 1LO0L 1GZPB 1YDPA 5TE4H 3VRJA 3AAZB 1XEDA 4P2CG 4QF1B 3SBWA 5BQ7A 3FHAA 3HUJB 3UZQA 4UNVA 3B9KA 5DRZB 2R39A 2V17H 2VWEE 3CX5K 4MAYD 3RA7L 4Z7VA 2V5SA 4QTHB 1GGIH 4P46D 2UV3A 4F7PB 2NY2B 1XF4A 3TWCL 3MRLA 3NGBC 4OLXL 3ULUC 2X89A 2UWEE 4GG6A 5BXFA 1OP9A 5HHNA 4CVWA 3PGCA 4P23A 2J8UB 1Y6MR 5CHNA 3RNQA 1A6TA 3BP5B 4LKXA 3S5LA 1IBGH 1KIRA 2UUDK 1A9EA 2KBGA 2JB6B 2XA8L 3BVNB 4XI5C 4NKOB 5T1DL 1YY8A 4PGCB 1GZQA 4CMMA 3GBNL 4GBXC 4JFPB 2PW1A 3GEWB 3U30C 2XN9D 2AJ3B 1CFNB 5D93C 2AV1B 3ARFA 4LIQL 5MEPB 3AY4A 2I26N 4DUWA 3QH3B 1UXWA 4ODHH 1G7IA 4N1HB 1M7DA 4Y5YA 3QHFH 2HRPH 4LASL 1LEKA 4BQ6A 1UC6A 3LEXB 3O9WA 3KWWA 4YHYB 1EAJA 5I1CL 3U0TA 3FAXA 3EYQC 2ED7A 4O58H 4WUUE 5D1XC 3FO2B 1A9BB 1OAUL 4ZTOH 4X4XA 4NJAL 2F53E 3Q1SL 5C07A 2I24N 3MUGA 3WO3B 4W70A 1Z6JT 4K7PX 4DOHB 1Q9OB 5IB2B 2KL6A 5IM7B 2BNRE 3CDGA 5ANMA 2W59A 3GMMA 2VXTH 4K9EH 3VFPA 2OTWA 3WEXB 3RKDD 1EXUB 4GAYA 3VWJD 5B22A 5LBSH 1RK1A 2E3VA 1UJTA 3DETC 5INCB 3QIBA 4P4KD 2RQ8A 3DX8A 1I3GL 5F7HA 1MIML 4RDQG 5E2UL 4BSVB 2NX5D 5CBAB 3I6LD 5JW3H 4JN2B 4QRRA 3DVNB 1CL7I 4R9HA 1XGPB 4RFOH 5GGUB 5I19L 4NQEE 4FNLH 2C3VB 2OTPA 3LS5H 3G6AB 1JZ8A 1IGYA 2CUIA 2Q8AH 4XXDB 3E0GA 2ESVB 3BGFC 5EU4A 5JOPD 1F3JA 4PJCF 4OCRL 1ERNA 4F7TB 1SY6L 5F89A 2CIKA 1LMKA 1ZV5A 1WTGT 3OX8B 1HOCB 4NO3A 4BZ1H 5FGSA 4WI7A 3RBGA 2RIKA 1UQSA 3QIUD 4KK9D 1CG9B 2ZG1A 4P2QB 4G6FD 2ADGB 3VXRA 3WNOA 4PJ5E 4JY6B 4HLJA 1NCAH 4KFZC 2IEPA 3FL7A 4PJ8B 4CN6A 1R3JA 1HINL 4QLRA 2V7HB 3OKOB 4ZYKA 1B88A 4Z7UA 3DGCR 1ZSDA 5HVHC 2OZ4H 2XWJA 2ITDA 2A6KA 1C5CH 3PQYE 5I15L 5DUMH 5GS2D 2HJKA 2LE9A 2Y72A 5ALBH 1S7SA 4LCIL 1AGBB 1JN6A 4U6XA 1HDMA 3E2HB 5DQJA 5GRWA 2R29L 4QCIA 4Y19B 3VGEA 1LHZA 1MF2H 4ORGA 5EUOB 3NVQA 1WT5A 1C1EH 1ZVHA 1RVFL 3MBEA 4XNXH 3Q5OA 3ARYA 5E2TL 1OM3H 3UZEA 2X4PA 3PV6B 1WWCA 3NCFB 2AJVL 2J3SA 3RWIA 1UGNA 1D5ZA 1SHMA 4AM0A 3NZ8A 4PJBA 4PJIA 3OHXB 1PY4A 2JTDA 5DD3H 1QRNB 4PJCE 4YK4B 4CMHC 1A7OH 5IB1B 3K2MC 4G8EB 4ZPVB 2FCBA 4NP4L 4YDVA 1MNUL 1P4IL 4IOFD 2FGWL 3FB6B 5L2JA 3TNMB 4KVCL 2EEAA 3L1OH 4GH7B 5JPNB 5DUPH 2HKHH 4NZJA 5BRZE 2FX8L 2VITA 2ZUUA 5D72L 5IVZB 2HKFH 2JLLA 2B2XH 5IESH 3EBAA 4HLZH 2P46B 2ZP0T 5IVXE 1EHLH 3IFPB 2WWKT 4PG9A 1EDQA 1X3DA 3DMMD 2DLIA 2CGRL 4XPBH 3WJJA 1QUNA 3LQZA 4PUBL 3D18B 3GSOB 3HS0B 3LSOB 5E9DD 5SWSE 1CDBA 1J8HA 2DICA 4X9BA 2H6PB 2J88H 1S9WA 2Y5TA 4UT9L 2AK4E 2EKSA 3DX6A 5AAMA 4OKDA 3S36X 3VDBA 4XZUB 5FOBA 4LRNL 3F7VA 3EOBB 4S0TD 1HHKB 4OZHB 3MMEA 1KG0A 4PD4K 2HRLA 3VXMB 3BH9B 4GQPH 3T04D 2FH8A 4XNZB 4WO4C 4ZFOA 1CGSH 4XGZA 3C60C 1UM6L 3NAAH 3HZKA 3U7WL 4NKIH 4KGLA 4EDXB 4KAQH 4M1CD 1UB5B 1RJYA 3EAKA 1DZBA 1EFXD 5I1LB 4K2UL 4WHDA 1NC4D 5T3ZH 5IMOB 4G43B 1F4WL 5FGBC 1MLBB 2NW3A 1AO7D 2HT3D 3BAEH 4RSVA 3WV0A 2AW2A 3BSZL 2ADFL 4P3DA 4R3SB 4XNYH 4ACPA 1ZGLA 1CK0L 3DV6A 1CGVA 4WUKH 15C8L 5EO0A 3LV3A 3V4VH 1YEDB 3ARUA 2R23A 1YJDH 3N1FC 1KBGH 3V5DB 5C08D 5MI0C 4PRPE 1A6PA 4NN6B 3QXTA 4HWNA 5F1NA 1M71A 5KOMC 4ZNEE 4K3JL 2KUTA 4NUJB 3R8BB 2EDRA 1CIDA 3TIEB 1UKSA 1NDMB 4UZGA 3MCLL 1IGIL 3VG9C 2ARWA 4JHAH 1KCRH 2IPUG 3I3DA 4X6CB 3UMTA 2GIYA 3B5GA 3FB7A 1FPTL 4I0CC 5EH1A 4YNYA 1N5YH 2WINA 3QXVA 4OSUH 1ACYL 2GSGA 3EYOA 4GKNA 5CJXC 1CL7L 32C2B 1T6VN 3OKDA 3QI9B 3ESVF 5FO8B 1ZMYA 3B9KD 3UPCA 3GKWH 1S9YB 4U33A 5I1HL 4MJ2A 3GSNH 5HYIA 5DHVH 3MNWB 2NZ9D 4C55A 2X89D 5HHOD 3VXPB 4QGYA 5J6HB 4XPTL 1LGVA 3W2DH 2ICEB 3TGXA 1NGPL 2OK0L 1I4FA 1UYWL 4H1LH 4X7DC 5F7KC 4JHWL 2VLJE 3QUZA 5E4EC 3D85A 4QXUH 3OWEA 1NCWL 3MRDB 5GHWL 5D7KD 1C5DA 2HG5A 4KC3B 4Z5RA 3RDTC 3L3GA 4G9FE 3W11C 1DQTA 4U6VL 2VUYA 3JV5A 2A38A 3VMPA 2DKUA 4OZGA 1DCLA 3TP4A 3VH8G 3KPSE 4OF6A 4U1SB 4RIRB 1UCTA 1UEYA 5DMYA 4JDVB 4DCQA 2MHAA 3VE0A 1NC2A 3EYVA 2J5LB 5C07D 2FL5A 3O8XC 4XVUD 1U9KA 3I85A 3FN9A 3SCMA 4LCCA 2VE6B 5ISZB 4FMKA 2WUBH 5F7MC 2E7MA 1YMMA 1CD0A 4TVPD 3CX2A 2ICWA 4FQXD 3C6LC 3MGAA 4TRPL 1HYSD 1DL7H 3HZYA 4LKCA 4I3RH 1MCBA 1I1CA 1LK3H 1TVHA 2CLZA 1EEQA 5CSBA 5TDOB 3CXHK 1NFKA 4HJGB 1HH6A 3ME0A 2AJYL 4UILH 3L5HA 2R0LH 4DVBB 1TIUA 2NY3B 1G1CA 2M8XA 4X5LA 4JKLA 4QRRD 1QEWA 2G5BB 3R4DA 3HR5B 2V9RA 4EDWL 2GTZA 3C2AH 2IG2H 3RP1A 4JFDD 2C7UB 3TA3D 3JUZA 2YRLA 3O6FC 1OAQL 5GZOC 3V6BR 2BVOB 3G08A 4UAOC 1NL0H 3X3FL 1BLNB 5K9QG 1OAYL 2XTLA 2W0PA 3LD8B 3VRIA 4I5BB 5CIPB 3KNBA 1MCWW 2ZZUT 2W07A 2BJMH 3S36L 1J7VR 3LKQB 4CN4A 4XAWL 5E4IA 3FT3A 4PY7B 3GBML 5EZOH 3KYMB 3SY0A 1DBML 2ADIB 4UINL 5D2NB 4M5YH 4ZOBA 1CU4H 4Y16C 1WEJL 5HXMA 2P8LB 4PPTA 3T0AA 4KUZL 1G6VK 5DJ6B 3BO8A 4G8FB 1I7ZB 5FDYA 2P42B 1NGQH 3AREA 1D5IL 2RCSH 1FFPB 1NCTA 3GMOA 4PV9B 3RGVC 1JNHB 4PTTA 4E9LA 5ICYB 3RWHA 3ARVA 1ZHBB 2YK1L 4Q9QL 3CU7A 4I4WB 3BZFA 4KH2A 4YO0A 1RUQH 4J4PD 3QULB 1BJ8A 3LKSB 1GZPA 4LEOA 3N1GC 4OD3H 4S1DD 1UM4H 2D2OA 4ZSOB 3HUJA 5JOEA 2YSSA 1QFWH 4Q0XL 4FN0A 4PGBB 4IDJH 2Q7YB 2NY6D 3MBED 1RPQA 4LQ1A 2GY5A 4F7PA 3L3HA 3KR3L 2IMMA 1UA6H 3PDOB 4X83A 1EO5A 1NQBA 3QDHA 1FQ9C 3PIQA 2I9TB 4UNTA 4L4VB 1OP3H 3JTTB 4OZIA 1KJVB 5FYKH 4TSAH 3UPAA 1R5WB 3UAJD 1AY1L 3DX9B 1IEBA 4O00A 1RJLB 4KZDH 3IAPA 4NKOA 4PGCA 4Y5XA 3ZTNH 4WNQB 2AJ3A 1DQJB 5MEQA 3VJ6A 2JELL 2JK5B 4KV5F 1AGCB 3I50L 1RULH 2VDNL 1OAXH 1R3IL 2ZSVA 3EZ8A 4PJDE 4JPKH 4FXGA 4X6DB 5HGAB 3FO2A 3DUUA 4JKMA 4PJFE 1C08B 4KHXL 3NCYP 5B4MD 4QRTB 5F8RC 4M8VA 4LQFH 4ZFGL 2I25N 4HUUA 3QUMB 3U30B 5D93B 1J8HD 1HWGB 8CGTA 1JHTB 1J10A 5IB2A 3ZYZA 5J06A 1FGVL 1MQKH 5LQBL 2IBBA 1HIMH 4HWBA 1KPRA 1A3QA 3VDCA 3K4AA 1NCCL 2PW2A 5D1XB 5F6IC 1TENA 3B43A 3KYKH 4HXAH 4G5ZL 2FJGB 3OXRB 2H3NB 3PWJB 3MR9A 3QEHB 2CDFB 4TUKH 1CBVH 4YHOL 1VADA 4JN2A 1AGFB 2AXFB 3MFGB 3ZHDA 2X70B 4G8IA 3DVNA 3ARBC 4L4TE 1A1NA 4LMQE 1MCCA 2SEBB 3SQOH 3LZFH 5F88B 3R06A 5JMRA 2WW8A 3M45A 2EYRA 4NFBA 3WD5H 4JB9H 4XXDA 2ICWJ 4U1HB 3OKMB 1MHHB 4JFFE 3K80A 3OG4B 3FRPG 1G7LB 2D9CA 1CE6A 1CT8A 4L3CA 4F7TA 5C7XL 1I1AB 4NC0B 4LBEB 2F53B 3M8OH 2FRGP 1XT5A 1BM3H 1D9KD 3D2UB 3D87B 5AUMA 1T1WB 5FUOL 3IU4L 1X5FA 1YYLL 1WC7B 3H7LA 4P2QA 4OV5A 5DWUL 1ETZA 2W60A 3FB8B 1LK2B 5J4MA 3BQUB 4P9ML 5CCKL 3VFWB 4PJ8A 2JCCA 3NA9H 3P4MA 4JO1L 4GG8A 4WI9A 4ZOCA 3MJ8B 4NKMA 3QQ9C 5JXAH 1KYOJ 5JO5A 2CH8A 2XZCL 3VXQB 4HKXB 2HTLD 5KZCB 5E99H 3QA3A 4PBWD 1FL6A 2A9MH 1N5AB 4ODXB 2EYSB 5CP3A 1E27B 1MFAL 3CLFL 1VGEL 1YPZB 5T1KB 1PLGL 1JGDB 1Y0LA 5C2BL 4NQEB 4HIHB 1ES0B 4KPHH 4NO2A 2QQKL 5I71C 3HPJB 4XPGL 1DQLL 3ILQC 4W4OA 3IFNL 4OGAD 5HVHB 5FYKE 1FNGB 3S3JA 2WSKA 3TO2B 3CFBB 3MLYL 3PV6A 3BEWB 4P3CL 4M6NL 5DTFA 3MRHA 1MI5A 1NEZA 2Z91A 3LQAC 3IFLH 3TC9A 3C5ZD 3QEQA 3QDJD 5D1QC 5H37G 1MCNA 5CEZD 4W6WB 2IFFL 5KSBE 4X98A 3WUWA 4FFWC 4HCRH 1T80A 5EZIL 1PAMA 3GRWA 1S7QA 2QR0A 3TNMA 5SX4H 4HIEA 3V2AR 3I3EA 1FCGA 4HV8B 5A2LH 3SKOB 3Q6GH 3TBSB 3H7BA 5TE7L 4NQDE 3RIFF 3FO0L 2B20A 2G60H 4ETQA 1ADQH 2B0SH 4CMHB 5GSRA