4P2RB

Crystal structure of the 5cc7 tcr in complex with 5c1/i-ek
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
187
structure length
171
Chain Sequence
SRPWFLEYCKSECHFYNGTQRVRLLVRYFYNLEENLRFDSDVGEFRAVTELGRPDAENWNSQPEFLEQKRAEVDTVCRHNYEIFDNFLVPRRVEPTVTVYPLLVCSVSDFYPGNIEVRWFRNGKEEKTGIVSTGLVRNGDWTFQTLVMLETVYTCQVEHPSLTDPVTVEWK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Deconstructing the Peptide-MHC Specificity of T Cell Recognition.
pubmed doi rcsb
molecule keywords H-2 class II histocompatibility antigen, E-K alpha chain
molecule tags Immune system
source organism Mus musculus
total genus 36
structure length 171
sequence length 187
chains with identical sequence G, L, Q
ec nomenclature
pdb deposition date 2014-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00969 MHC_II_beta Class II histocompatibility antigen, beta domain
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4p2rB02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 4p2rB01
4AL8L 1UJTA 3CSGA 4AQOA 4BH8A 5JW4R 2BNRA 4MMZC 1HSAB 3LH2H 5GZOD 3NBNA 1I1CA 4B7LA 2V2XA 2YEZB 5JHDD 1FDLL 2L0DA 4J23A 3OWEA 2KZWA 1XGUA 2R2EB 5DYOA 5EZLA 3BZEA 3QAZB 1UM6L 4Z7NE 1MJJA 5KS9B 1T1ZA 1A5FL 4LSRH 1JNNH 3VFWA 3HC4H 1LP9B 4NJ9L 4F7MA 4NQCE 5EOTA 1U8OA 3QWOB 2R2BA 2A6IB 2VLRA 1KTLB 1NBYB 2VAAA 1RQ5A 4LSQL 2Q3AA 4MA1B 4MA7H 4NQVA 3SBWA 3CZFA 4FMKA 5TE4H 2KBGA 4KQ3H 3P40A 3FHAA 4I2XE 5CLWA 4NHCH 4JCLA 4XAWL 2Z93B 1G9EA 1HXYA 2HP4A 1FZKA 4QRPA 3ZDZF 3CXHK 3QUYC 3W81A 4X0KA 3ALXA 4XCFH 4RWYH 4XPTH 4ZXBC 5D70H 5ID1A 1FYTB 4UIKH 3WNPA 1G7JA 5C6PB 1B6DA 2XA3A 4JHAL 4XC3L 3ME0A 4YHZL 5TH2B 1OGTB 3GI8H 1MCEA 2AJYH 1WFUA 3V6OA 5JW4Q 4NKDB 1OOAA 2Z31C 2ZCKH 1ZLUH 1W72B 1CICC 4Z0XB 2YA2A 2XZAL 4RMSA 5L88L 3GB7B 1NC2B 1BLNB 5F44A 5HGDA 4XCYB 3VD4A 3G6JB 4KTDH 4WWID 4M7LH 4DGIH 1KJMA 4PJ5B 3ALPA 1TVBA 2VLKB 2HJFA 2D9CA 3QUYD 2BHUA 3UJTH 5JPMB 2A9NL 1LO4H 3QNXB 4MNHB 4ZXBD 4EI5C 4BH7B 1H3PL 1C5BL 3SKJH 4LLDB 4OZHA 1OL0A 3OAUH 3FB7A 3O9WA 2BMKA 2YC1A 3FAWA 4Y4FB 3V6FB 1D6EB 5EO0A 3D2UD 3RZWA 2DQEH 4NNXA 2DYPD 4OUOA 2Z31D 4HIEB 1OP5K 2K7PA 2PKDA 1OAKL 4Y2DB 3QQNA 4HZLB 3IRPX 1A9BB 5IEKB 2FECL 5I8CA 3NCCB 4F8TA 4X6CA 1JWUA 3CX2A 1WAAF 1VFUA 4JG1H 2DTML 5KG9A 2MMXA 4TVPD 1BEYL 2DLFH 4MNQE 4ZD3H 1JGEB 3HE7C 3F6IA 3MACH 4XB8A 4HW6A 4XRCA 3LQZA 4LEXL 3IFOB 1W0VB 1C16B 1AHWA 4G6JH 3LQAH 2DQFA 4PJ7F 3VH8G 1UG9A 4EI5D 5D2LB 4KU1A 1EFXB 1JFQL 3TBWB 4I3RL 1KPRB 1FL6A 2EEAA 3V7AE 5I1DB 4S2SB 3RVWD 4NHUB 4G7VL 5FUCC 5T3ZL 3QQ3A 4PIRF 2FX8H 1JZ8A 4S1QL 5DQ9B 3CFBA 1YPZE 4NQXB 3NPZB 1G0YR 1J0ZA 2EE2A 3WDIA 3U30B 4QRUB 1FORH 4LF3A 5L8KB 5I1KH 5CUSH 5DA0B 1HH6B 2JCCF 3HE7D 1FFPA 4LCIH 3ZZ1A 1J0KA 3WDHA 4MNGB 4WI9A 5FM5M 3ULVE 1H15A 2C5DC 3VXOB 3IETB 3PQYD 1IZJA 3LKQB 2Y06L 1QBBA 3GMQA 3AY4A 1TENA 1WZ1L 5L2KD 1U58B 4JREC 3GI9L 1AD0A 3Q48A 3CSBA 4PLKC 1L4IA 3HAEH 1WLHA 4M7ZC 5CJXA 3C6LB 1FNEA 1MWAH 4P5MB 3RY6A 1IGMH 1ETZA 4EVNB 3F5WB 2QR0A 3NH7L 2VISB 4U1NB 4QXWA 2OS7A 1JHTB 5AYUH 5J56B 1HCVA 3GGWB 3BMWA 5IGXH 5HVWA 3LH2L 3STLB 2P7TB 4ZTOH 3SDXA 3T0EE 2YD7A 3WFCH 3EYQC 1P9MA 3VFMB 2PCPA 3P9MA 3WSQH 2VLLA 3BO8A 4HAGA 5HDBE 4E42A 1KFAH 1CGWA 2UUDK 5SX5K 4HMCA 1FVCA 4RFNB 4LSRL 1JNNL 1CI5A 3TIEB 3RGHA 5AD0A 2NY1B 4O2CA 4PLKD 4L1DA 5E94B 4GBXC 4HJJH 4NCC1 5HBBA 3OF6A 5IB1A 3RBSA 2P8PA 2YPVH 4MA7L 4HS3B 5E56A 4P46D 3SGDI 4XP9H 4KQ3L 2DS4A 4EIZC 4NHCL 3D48R 1J18A 4NQEB 1IGTB 1QSEE 3DHMA 1UWXH 3WLBB 5IP4A 5L7XH 5DJXB 4UI2A 4QOKA 4WI8A 4OCSH 4XCFL 4RWYL 3EYQD 1EDQA 4R4FH 4XPTL 5D70L 4XHQA 3RRQA 2NZ9C 1JWSA 4LFHG 4UIKL 5ICYA 2I27N 4KTEH 1UB6A 2E27H 1CIDA 1I75A 3GI8L 2AJYL 1CIUA 1A1MA 1HEZA 4DTGL 4DK6A 4X7SH 4GBXD 5A1AA 5KZCD 2Q8AH 4WHDA 5D93B 1PLGL 5C09A 3WD5H 2IAND 4WVRA 4D0CB 1EEYB 1EO8H 4KMTH 1EFQA 3BP4A 3DURB 3FRUA 5IB2B 4LHJB 4KTDL 4M7LL 3WIFB 1S3KH 1Z5LB 1WFNA 4IOIB 1QLFA 5KOVC 3PWVB 5CJBA 4ZFOA 3GIZH 1AP2A 3CFIC 5EH1A 3DYMA 2AV1A 3UJTL 1XF2A 3QUML 5FA4B 1VKXA 2OQJB 1LO4L 5JXEA 3RUGF 1TJHH 2M26A 2NZ9D 4XCEB 3SKJL 3MRLB 3PWLB 3EDJA 3OAUL 4MJ5A 1DANU 1ZT1A 1RJLB 3UTPE 1YDPA 3CPLB 4PYHA 4TQEL 4YNYA 1WBYA 1CFVH 2A6JA 2F8OA 1CE6A 3OKOB 4F7EB 3FQNB 4NQDE 1MOEA 3FCTA 5JTWA 2XNAB 4NO0A 1SJXA 2VSCA 4K3JH 1CGYA 4P2RB 4JG1L 2W07A 3OG4B 2H8PB 2DLFL 5K93A 4PJBF 1U92A 4ZD3L 5BW7A 4L4VD 4S0SD 3GMOB 2C4FU 4C56E 1PG7H 3FO9B 1IM3A 3LY6A 1J8HE 2LV4A 3B3IA 2XZCH 2P5EB 4Z78A 4G6JL 3LQAL 5CWSB 1NFDA 4PJXA 5KTEL 4PD4K 4LNRA 3MRCA 3JV6A 1MCBA 5E6IA 3VDCA 1VFOA 4AT6A 4CVWA 2MFNA 1S9XA 1NBZA 2FECI 4ERSH 1I3RA 3MV01 3L9RA 3OKDB 5HHOE 1RSFA 1E28B 2PYED 4W6XB 2FX8L 5CZKA 3DARA 3D0LB 1MVUA 3VXRE 4R0LA 4Y5YC 3QDME 1I1FA 4NFCA 3PP3K 4RIRA 4JG0L 1VGEH 4TSCL 1FORL 1ROWA 1MHCB 1RZKH 2X1QA 5I1KL 5CUSL 1FBIH 4LCIL 2J1KA 4Y0GA 4BUHA 5IK3B 3KPMB 3LQMA 2J7LA 3KDMA 3I02A 5CS7A 3GSNB 5IOPB 3WFEH 1H3UA 1FL5B 5CD5C 3QWRA 3S34H 2AERT 1I7ZB 5B3JE 4AIXA 4ZDHA 5ADOH 4Y5XC 2ZSVB 1XIWB 2BNQD 2J8OA 1MWAL 3QR2A 3LDBC 5EO1B 4KDWA 1IGML 3OXSB 2ZNXA 2YBRB 4OGYH 4JQXC 3SPVB 5KW9H 3I9GH 4JRYB 5AYUL 1LE5B 4U6YA 3QEUA 4Y4HA 5DMKB 1H8NA 2YPLE 3GSVB 3NFPA 5IGXL 3HE6C 4X6EB 1ZHLB 3G5VB 4ZTOL 4LHUD 1MVFA 2YD9A 2EYRB 4YHIB 3SE3A 1MCIA 1S5HA 2WQ8A 3WFCL 4FQXC 1KEMH 1G7PA 3L7EA 4LSUH 3FT2A 1Q0XH 3HMXH 1KFAL 1IJ9A 2EDDA 3B9KC 4X7CC 5CD5D 3EYFA 5ISZD 3TPUA 4JFFA 4QEGA 5CIPH 5GISH 1FAKT 3VXUD 2ADGB 3SCMB 2X4SA 5JMOC 3H9YA 2YR3A 4DUWA 1OTUC 4HJJL 3LRHA 1KJ3H 1WBZB 4XP5H 2YPVL 4JGUA 5FK9B 4QNPF 4OT1H 3ILPA 1ZLWK 4RGMB 4I8DA 4HQQH 4XP9L 3HCVA 3MLTB 3OB0K 5TFSH 2ICCA 1OAXH 4NN5C 3BOVA 3WIHA 3H0TB 1ZGLP 2Z8VC 4NZJA 4N0RA 4U2YA 5GS2D 5A16A 1IM9B 5L7XL 3TYGL 1ZWIB 3C5SA 3VA6A 4OCSL 4UQ2A 4FQXD 3BX7C 4R4FL 4ORGB 4U6XB 1AGBA 3WKMH 2QLVB 2E27L 3B9KD 4HS6A 3WBDA 2IPTH 4U1MB 4ELME 4HIIB 2EXWD 3DXAA 4WU5B 5SWSD 2NLJB 1OTUD 5H2BA 4H0IA 3W82A 3BZDA 2W0KA 5SWQB 4M61B 4WO4A 3V8OA 3WD5L 4TVPH 5F72S 3LD8C 4KMTL 1EO8L 2AXFB 5DHYB 2Z9TA 2R2CA 2FJGB 2VRAA 1A3LH 1S3KL 4P2OC 2H2PC 1UJ3A 3PWPA 1FO0B 3GIZL 5T1KD 4QRRE 4G9FA 1OM3H 1XF5B 4NKQB 5IB3B 5DVNA 2ADIA 3MLXH 5IJVB 2FSEB 4KTYA 1KIPB 4PG2C 1JTPA 2BJMH 2H32H 1T1XB 1TJHL 2MJWA 1BVLA 2YSSA 4PJGE 4LGRB 2Y36L 3SDCA 2X09A 2FEEL 2VLME 1FSKC 3MOAH 3OJ2C 4K07A 1JZ2A 2Q1EA 1ONQB 1CFVL 3C9NA 4XNQA 1A7QH 5E2VH 3LSOA 5BOPA 2DLEA 2JJVA 5D5ME 2KDGA 4KHTH 1QSVA 1G0DA 1I8LA 4K3JL 3T77B 3MR9B 2VDQH 1N26A 1RK1B 4XXCA 3TT3H 4BKLA 2Q20A 5BV7B 1T89A 3VXTA 1T21A 2WBWB 4F2MA 4P2OD 2H2PD 2ARJA 1ZSDA 3Q6FB 4CBPA 1UM4H 5AZ2H 1MCLA 1PG7L 3WUWA 4M6OH 1Y18B 1F11A 3PP4L 1MCWW 5IMLB 3KPRB 5T33H 4EUPB 4GMTH 3WJJA 3O2DA 1CG9B 4DVRH 4U1IB 5DC0A 5K9JH 4ERSL 1HHJB 3QCTH 3MV8A 2Y5EA 4GG6B 2QTEA 3ULUC 1VGKB 4HC1A 1DP0A 1Q9OB 1QPPA 5CKGA 5IBTH 4JKKA 3BRGC 1NCAH 5D71H 1NGXA 4YGVA 5D4QA 5HY9B 3KJ4B 1VGEL 1LEIB 3AXLA 3AREC 4PJEA 4RQQA 4G3YH 1RZKL 3MA9H 1EA9C 3PWNA 3RWGA 2GT9B 1FBIL 3P4MB 4NDMA 4P57B 2X4NA 2CXGA 3QIBA 4QYOA 2APVA 4Y19A 4RA0C 1P7HL 2RFXB 3CUPB 3QFDA 1DEDA 3IDNA 4IOFC 2NY5C 4DVBB 4JY4A 1S9WB 2NY6C 2AV7B 4JZNB 1T7YA 5AWNH 4PJIA 3WFEL 1DCLA 2F54D 2APWA 2IF7A 3S34L 2F9BT 5GRXG 3GRWA 5C3LD 3PF2A 5C0AD 5DUMH 3F12A 3RQ3A 1QR1B 3ULUD 2I60H 5ADOL 3V95A 2XKNA 4WFFD 3L3IA 3PV7A 1T0MA 3UJIH 3MLSH 2HAZA 2WMPA 1N3NA 1YZZA 1HILA 2FHBA 4OGYL 3CCHA 3ARED 3C2SA 3O8XA 5D6DA 5KW9L 3I9GL 2BCKB 2P8LA 2EDRA 1JJUA 2CH8A 4BFIA 1MHHA 2ZPKH 4U1HA 4WEBH 3T1WA 1QRNB 1M7IB 3JTTA 1NQBA 4OZIF 4FFZH 1TQCC 4NFBA 4JFHE 3ZE2F 1KEML 4IOFD 1NAMH 1CN4A 3LEXA 1LD9A 3VXME 3B6SA 2AABH 1CQYA 2NY6D 1Q0XL 3HMXL 4M43H 3T09A 3B5TA 4BK5A 5KSBB 5GISL 1MJUH 3VMOA 5DJ0B 2AW2A 4UT7H 2YOCA 3CH1A 4QCIB 4PJCB 3JWDC 1KJ3L 4XH2B 4PLJC 4XP5L 1G7MA 3MO1B 1LE9B 3FMGH 3MLUH 3BKCL 1U8QB 3QRGH 2P1YA 4JFDE 5E00B 5F9JB 4HQQL 3GFUA 3MZTA 3JXAA 1KYOJ 5TFSL 3RWIA 4GUPB 1OAXL 1GSMA 5FHAH 3VGAC 2DL2A 3V8CA 5C0EB 3EKCA 4P3WA 3QQ9C 4GAFB 5F1NA 4DK3A 4IS6A 3MROA 3BHBB 4ZOCA 5HHXH 1BFTA 1H3TA 3ZSTA 3WKML 2NXYC 4ZAKB 1S7XA 2X89A 4L8BA 3GHBH 3WIIH 3RDTA 2IPTL 1DQQA 3GSQB 2VIRB 3WUWG 5FYJD 3QXUA 1Y6MR 4JFEB 3T4YB 4TYUA 1IC1A 4PGDB 4ZPVB 1ZHKA 3L1OH 1L6XA 4PLJD 1BD2D 4M5YL 1EIBA 3V4PH 4WUUD 5J1TC 2FWOA 4CW1B 1IGJA 4XAKD 1A3LL 4DKAA 4X99A 4LCUA 3QQ9D 5DC9B 5EBGA 5EBMB 1OM3L 3A6BH 5CJOH 4P2QB 2DMBA 3ZYJA 3MLXL 4Y8AA 2BJML 5DO2D 1RZJL 3BH8B 3SDDB 3BD5A 2O61A 5JA8B 3RZCB 5FUOH 3U0WH 5J0BA 3NACH 3U2SB 1BHGA 5D72H 3MOAL 3DROB 5FO8B 2FL5B 4HHAB 1VCAA 4GQ9H 1NGYA 5JHLH 4XX1G 3SBWC 3UPRA 1XAUA 3QB7C 4AYFA 4YHPA 3NCJH 1A7QL 5EBLB 4OI9A 5A2JH 1A1NA 2QQLH 2BNRD 4KZDL 3KLAA 4RFOH 3GHEL 4HGWB 4OIBA 4U1LA 5C08B 2R2HA 4KHTL 1SJVA 1JZ6A 4Z7NF 1Z9SA 3LKRA 2ATKA 3TT3L 2D0HA 3NN8A 3SJVA 4HX1B 5J1SC 1TTFA 5DGQA 1UM4L 5AZ2L 1P4LB 2FEEI 4XNZC 5FYKE 1JCKA 4M6OL 1BGXH 3V6OC 3O4LB 2VLRD 2K3TA 2F8XC 4G8FA 4JGJA 2HLFD 1FGNH 5EU3A 5T33L 1W8NA 3IJSB 4GMTL 5BRZE 5DJYB 4DVRL 5K9JL 2FEDD 3NCYP 4KROB 4HKZA 3AMKA 3QCTL 4ZO6A 1NPUA 2GJ6E 3ARRA 4Z7WA 2F5BH 5HHPB 4PRID 2UY7A 3VFTA 4D8PA 5IBTL 4R26H 1NCAL 2H9GB 2F74B 4QRPD 2H45A 2FZ3B 5CEYA 3UROR 5MEPB 2J5LC 4G3YL 3MA9L 1CD0A 3O9WC 4PRPA 2Y7QB 4MB3A 5C07B 1TTUA 3PXHA 2NW2B 3B2UC 5I71C 4PJHE 4KWUA 3MV7A 4WCYH 1CGSH 3IXTB 4EJ1C 4RNRB 5I6XB 35C8L 2QEJA 4Z7VB 2AKRB 3BXNB 3QZWA 5AWNL 5IBUB 2XY2A 2VLJB 3MRDA 1HZHH 1MFNA 2IEPA 4LCYB 1DE4B 2I60L 3P77B 1D5ZB 3QQ4A 5EULV 3DETC 3B5GA 2OXHA 3UJIL 3MLWH 3MLSL 1I9IH 3I2CH 1KNOA 4OCWH 1AHWC 1MH5A 1XF3B 2FJFA 3NTCH 3G08B 1F45A 5E1HB 1U95A 2M1KA 1JGVH 2EIZA 3O9WD 2NY4B 3FT4A 3GSRA 4QTHB 3RPIB 5EZOH 3TNMA 2ZPKL 4WEBL 2ICES 3E6HB 4FFZL 4F33A 1D5MA 2OI9C 2YD2A 3B2VL 1NAML 1RJZB 2AABL 4AZ8A 2DM4A 4M43L 5E8DH 1JF1B 2VMFA 3MLVH 1MJUL 4LFHD 4QY8A 4HUKB 2APBA 1F4WH 3DETD 1IQWH 4QHNB 4D0DB 4A2MA 5JA9A 5EUOB 4H1LA 3QCVH 3MLUL 3GMNA 4I5BB 3QRGL 1D5IH 3T2NH 3GJEB 3UCRA 1X5IA 3IRZA 5FHAL 3GSOB 5KS9E 4WW2A 3AY4C 1U9KA 1LP9E 4YHKH 1CFNB 3O6KH 2M8XA 3PHOA 1HKLL 4YH6A 5DVOA 4PJDB 1R5IB 1RU9H 4ZUWB 4JB9H 4PRHB 5HHXL 5CJXC 2C7UB 3UTTB 2B1AH 3QA3A 4NO5A 2VITB 3GHBL 5DUPH 3WIIL 5HDOA 3ZKQD 4BSVA 2FJHA 3ULVF 5EU4B 1EVTC 4NNYA 1ZOXA 4AEHH 2IAMA 5BS0A 3T8XB 4V2CB 2D4FA 3QEGH 3L1OL 3F58L 4R90H 4IBLT 1T2XA 2Q7NA 1DDHB 3V4PL 1T5XB 3MRFB 1FYTE 4RAHA 1P9MC 4YHYC 2IADA 4IMLA 2AAVA 3U6RB 2ESVA 3E0GA 3QDHA 1GL4B 4W4OA 4D9LH 4NRZA 3A6BL 5CJOL 4CNIB 1U91B 3GMMA 1TJIH 3WYRA 1DJSA 4EQ3A 2V7HB 3DUSB 3U0WL 3NACL 4TNVK 5D72L 2Q7YB 5I8OH 4KI5C 2X4PB 1DSFH 4GQ9L 1JN6A 1MFDH 2JB6A 4NQCA 2C1OA 3NCJL 4PJ5E 2VLKE 2AEWA 1HHKB 1KLUB 2QQLL 3VI3E 1T5WB 4RFOL 1CS6A 5DR5H 1D3CA 2DOCA 2WW8A 3BKML 2V5TA 1BWWA 3MRRA 2ERJC 3K2UH 4X5XB 4ETYA 2K7QA 4G8EB 3ARWA 4G8IB 3IXAB 4RGNC 1AC0A 1A2YA 1R3KA 3N1FC 4JDZB 2QKIA 1BGXL 3BQUB 1Y6KR 3D0VA 1RV6X 3FQWA 2BHYA 2YPKB 5I9QB 1KCUL 1FGNL 1CDBA 3OF6D 1I8KB 4KI5D 3MMEA 2P47B 3RY5A 1CZ8H 2MOVA 4GAYA 4NBYB 3ULUH 1GRWA 3WEXA 4JFPB 2IJ0C 4YAQB 4G43A 4UDUB 4PGEA 2F5BL 1F6LL 4E0RA 5JO5B 2MHAA 4YUEH 4R26L 4JLRA 3MJ8B 3RKDC 3HI1A 4QOKD 1PQZA 5E2WH 1FNGB 1NCCL 5D2LE 4CVXA 5JXEC 4LEOB 3X11B 1AGFA 4MCYB 3O3UN 1MJ8H 2W65B 3U4EA 4RGND 1EHAA 2CLRB 2QHRH 5J1AB 4F7PA 2ZG3A 1QSFB 2HFFB 4WCYL 1C7TA 4H1LG 4HH8A 1CGSL 3QH3B 2ZUQC 5FO7A 4E5XB 5FOBA 5DRNB 5BOZG 4MAUH 1K5NA 4XBGA 5C09D 3OR7B 1D9KA 5D1ZA 1T4KA 2LFGA 3T0BA 1HZHL 1QZ1A 4NKOA 1WJ3A 2V7NB 1UYWH 3TN0A 5DJDB 5DRZB 3O41B 1JNLL 5BW7C 3BIKA 3X14B 5T5FH 3KXFE 4FRWA 2AJVH 1DN0A 1I9IL 3I2CL 3RKDD 4OCWL 5E6YA 3NTCL 1MREH 5FGRA 1AQDB 4IM8A 5D9SB 5JXED 3PJSA 2DJSA 1OF2A 1JK8B 4KMQA 1YEIH 1J5OH 4JM2B 3MBEA 1JGVL 1N8ZA 3SQBA 5E6IC 2R69H 4JRXB 5HHQB 5EZOL 3DX7B 4I0PA 2O5YH 1F3DH 3KPQB 5DRXB 2R1YA 1C08A 3C6SB 3DO3A 2GTZA 3BEWA 1WWCA 3VXSB 32C2B 1UFUA 3IAPA 1HSBA 4OFKA 4NO0D 5FYLH 5E8DL 3R06A 4C58B 3MLVL 1Z3GH 1ADQA 5LG1A 4NC2B 3JWDH 3MX0A 4PP2B 4Q2ZB 2VE6B 2D7PA 1S7VA 2JKXA 4P0DA 3G9VA 1F4WL 4PFEA 1IQWL 1PBYA 1HHIB 2JJTA 3QCVL 4JFOA 2E9BA 1D5IL 3T2NL 1YN7B 1I1AA 4GSDH 1G7LB 1C5DB 4J7RA 4Z76A 3BZ4A 5E6ID 4Y16C 1JNHB 2NR6C 1CVSC 5DMJB 3TC9A 3LHPH 5TE7L 4YHKL 2Q8BH 2IH3A 3O6KL 1QQDA 4Z95H 4CJ0A 4JB9L 2PYFB 3PGDB 1ACZA 2EKJA 2B1AL 4K7PH 3MJ9H 5IFJA 1J88A 1N64H 4X80H 4GT7A 5DUPL 2K9UA 3ARFB 2CKNA 1N59A 2AI0H 4JANB 1GZQA 1NFIA 3HAEB 4QRQB 4NQEE 5GHWL 4AEHL 1MWAB 4HKJB 4O5LH 4PJFA 2G9HB 4ZOAA 3QEGL 4XNYH 4H0HB 4MB5A 1XT5A 3UZVB 2HJLA 1NCNA 1MLCB 2I24N 3SE3C 2A83B 4PRBB 1KV3A 3MFGB 4PB0L 3F7VA 3O6FB 1Y0LA 3ULVH 1YEEH 1XGYH 2IBZY 4P5KB 4L8DA 4IJ3C 4Y16D 2NR6D 2FR4A 1P2CA 1EEQA 4MD5A 4D9LL 3QWRD 4MDIB 4XMPH 2UWEB 2UVEA 2V5YA 1MAKA 5GRUH 1ZT7A 3BIAX 4TNWF 5IF0A 1FVDB 1UXSA 1A21A 3QJFB 2YRPA 5F7LB 5I8OL 1G7QA 1DSFL 4FQQA 5JNYB 3MRJA 4MJIB 4DN4H 3T04D 4RZCA 2ZUTA 5CGTA 1YJDC 3ARDA 2OTWA 2PTUA 5CAYB 3IVKA 5DR5L 4C83B 3W5NA 3P0GB 3P0VH 1GOGA 4DEPB 4LBEB 2XWTA 3UYOD 1TTGA 1T22B 2VL5B 1QSEA 1LO2H 1SYSB 2LE9A 4JFFD 4QT5A 4K23H 3KYMA 1BIIB 4FTVE 1YQVH 1YYMH 3GSUB 1UWEH 4CJ1A 4P4KB 5ICZA 1EXUA 4WO4C 5DK2B 3SO5A 4B7IA 4AJ0A 4P2RE 4CMHB 3RWJB 3MCKB 1CZ8L 2YS4A 2NCMA 5D7JA 3D25A 4KQ4L 3SKOA 2ZNWA 1HHGB 2XKSA 1UJ3C 3HUJB 2CK0H 5HDQL 5TF1H 2P5EE 3GBMH 1OP3H 2ZUWA 5KSVB 4N1EA 1IEBB 5E2WL 2H41A 5HSFA 4ZQKB 3GZKA 4ELMF 4V1DB 1IGIH 1MJ8L 4KJPC 3SDCC 3VFVB 4LQFH 2QHRL 3L95A 5EIVA 2GCYA 1BF2A 4PB9H 4EI6B 5GSVA 3TCLB 1Q8MA 1PYWB 4MAUL 4WO4D 5CJ8A 1PKQA 1I8LC 1KB9K 3U46A 4XXCC 3N9GH 4LVNB 1P1ZB 1T89C 1HI6B 1UYWL 3V7MA 2X4UA 4F9PA 3P9LA 1TZIB 4PJGF 3PWPD 1P6FA 5T5FL 3L3DB 1QYGH 4U3CA 4IRSD 1HN1A 2AJVL 4UIMB 1U36A 2AJZB 4A6YA 1MREL 2PTTB 3P4OA 1YEIL 1J5OL 4KJPD 3SDCD 3ESVF 2R69L 3WJJC 5FB8A 3LKNB 1T1WB 5D5MF 2E9IA 4C56A 3EYVB 4WWKB 2O5YL 4O4YH 5INCB 3BGFC 3HZYB 2DI9A 3OJDA 4J3VA 4HWUA 5IROA 2CO6B 4YBLC 2VKXA 5AAMA 5FYLL 5FDWB 4R4BB 2BSRA 1Z3GL 4ZYKA 4JRYE 3IFLL 3JWDL 4AK1A 5FYJU 4PJ7B 3BDXA 4QF1A 4FA8A 1NEUA 3QDMA 3QIBC 4LAQL 1U8JB 5KBNC 4DKDC 4GSDL 2WINA 4H8WH 2GK2A 3T0DA 1UKTA 3MXWH 1NUDA 5JLZB 3VG9C 4EOWH 1OQXA 3OKNB 2PW1A 2H1PL 5B38B 5F6IC 3LMJL 1FN4A 2V9QA 4YFLF 3LKSB 3MV8D 4Z95L 1A6ZA 1SMAA 1VA9A 1Q9WB 2Q76B 4HFWB 2A6DB 3FQXA 4HLZG 3MJ9L 4K7PL 4LVHB 4MVBD 5JOFB 2JCCB 4YPJA 4X80L 1ZLUK 1U2CA 1WT5A 3AS0A 5JIHA 5D6DC 4HUVB 3O8XC 2AI0L 1E0OB 3HZMA 5ICXB 2VDRH 4O5LL 4AENA 4HWZA 1P5UA 1NDGA 2L7UA 4XNYL 2J3SA 3P2TA 1IGYA 4OGXH 4Y19D 3LV3B 3V5KB 3V6BR 3ESUF 1KJ2A 4CDHA 4U3XA 4KGJA 2ORBH 1YEEL 1XGYL 3EO0A 4GW5A 3H6JA 3ULVL 3VFOB 1G84A 1H0DA 5HHMB 4MD4A 3BKYH 4XPAH 4XMPL 2NQCA 5CEZE 1NGQL 1SEBB 2X40A 2BP3A 5GSRA 1CDIA 2DICA 5CIPB 3BZFB 5T1LD 2BC4B 2Y1VA 3O8XD 3ZSSA 2FX9L 1JPGA 4XC1H 1DL7L 5I18H 4W4NA 1AIFB 3HLAA 5CEXB 3DSFH 3T0WA 3ZE1E 1PAMA 1R5WB 3HA0A 5BVJB 4TSBH 5EZJB 2OL3H 3B8YA 2H3NA 1MI5B 3QUYB 2NY7H 4GRMB 2BVPA 2ADJB 2EYSB 2OJZL 2QQKH 1LO2L 4PGZA 4J8RB 5F88A 3RDTC 3S4SA 1GPOH 1YQVL 3LIZH 2ZUVA 1NMCC 1UWEL 1M6OA 3ROOA 1CDHA 1FYHB 2Z31B 3ZE0E 4YR6A 1EVUA 1CICB 2BOCA 2FIRT 1F2XK 3Q3GA 3L3KA 3L5IA 5BJTB 5GS3A 3LAFA 3VFUB 2DQIH 3EDEA 4Z6AT 4GRWF 5DJ2B 2CK0L 5TF1L 1OT2A 2C1PA 5I17B 5IB5A 4X98B 5E1AA 3UTSB 3KPRE 5TDOB 4OLUH 1KXQE 1IGIL 2GITA 4LQFL 2X89D 3TVMA 4OLXH 4GG6E 4PB9L 2H32B 3JBG7 2Z4QA 1GGIH 3CFCH 4L3EB 4BFEA 4S1DC 2R1XA 5B22A 3QHTC 4F57H 1AGDB 5GGRY 2MKLC 4R7DA 3IKCA 1LDPH 1NUFA 3N9GL 3HC3L 4Y1AA 4MD0B 2RAMA 3EOBA 1H5BA 1NGZA 4X7DC 1QYGL 1S7RB 4MDJA 5EU6A 3RWHB 4HMEA 3FKUS 3NFSH 1YN6A 4AMKH 4BELD 2QQNH 3UYPA 2WIMA 4E41D 1HQ4B 4O4YL 5CINH 1M71A 5F7FA 3NCEB 2F5AH 1OHQA 3SN6N 4ISVB 2D7NA 4R7NA 4JJ5B 2AK4A 2X70B 1F3JA 1JGLH 3UBXI 5LVEA 1T03H 3C60B 3BPLC 1T3FA 5GGQH 1VACA 4WJ5B 2WUBL 2VH5L 3WS6A 2QBWA 1QRNE 3BEVB 1RUMH 2GY5A 2P5WB 4I9WE 4K8RC 1QVOB 2VERN 2QQQA 4U1GC 5B21A 4BZ2H 5KSAB 3ZYIA 4H8WL 1NANH 3VFNA 3W39B 3MXWL 4PRNB 5DQDH 3P73A 4MA8H 1UWXK 3KYAA 2VKWA 4EOWL 2KQNA 4PGCA 4XTRC 2M2DA 5KSBE 1ZA6A 3H7BA 2V5MA 4YFEA 4MA3A 4BFBD 3GMLA 3CVHA 5HDLA 4D94A 1P7KA 4PJCE 3LKOB 1XGPB 5E95B 1BJMA 3P9WB 4DCQB 4JREB 4P5TA 1KENH 8FABB 4YBHA 3X12B 1JMXA 4PJHF 4M7ZB 2XWBB 3FONA 2X4RB 1FJ1A 5IEHB 3S4SG 2HJKB 5HI5C 1ZA3B 2W60B 4RMTA 2VDRL 3FN9A 3PDOB 2MPAH 3BMVA 4K8RD 3RJDA 1ND0B 2ZOKB 4OGXL 4F8QA 4LIQE 5IQ7H 5GGTH 3MV7D 5TQ0H 2JIXD 5K9KA 4MCZB 5DRWB 4FXKA 5T3XD 2HVKB 4XTRD 2E7CA 1SJEB 4JDVB 2PW2B 3PUCA 3T65A 4JFEE 3BKYL 4XPAL 4I48B 1NAMB 5D7SH 3VG0L 3WCYA 1R3HB 5ACZA 5F1SA 5GGSB 1MCHA 2IC2A 2DIBA 4TRPH 2PF6A 1YJDH 1R3JA 3OPZH 3RL1B 3WIHH 1DLFH 4O51A 2C9AA 2IANB 3CFKA 4XC1L 5HI5D 2LAGB 4D9QE 2DQJL 4XHJC 3PNWA 4L29A 3CDGA 3ARTA 3TBTB 4WW2C 4P2QE 1F4XL 3DSFL 4FQCH 1RZGA 1TVHA 4TSBL 2OL3L 5IG7B 3LPGA 4JFDA 3D39B 4YDKH 4JKMA 3U82B 4FABH 4QXUL 3TWCH 5HGAB 5DD6B 3RU8H 1Z2KA 4GKNA 1BMGA 1GPOL 3JUZA 5F7WC 3LIZL 1LO5B 2EE3A 3AU1B 3TH3T 2IAMC 5C08E 5MENB 2FLBT 3EOTH 1B9ZA 1YNKH 3G6AB 3TBYB 1RHHB 3O45A 5CP3A 5F89A 3ROLA 1NMAL 4R2GC 1E4XI 3D18B 2P24B 4U1KA 4XHJD 4ZFOL 1JIBA 5EU7E 3E8UL 3L6FA 1FFNB 4Q6IB 2DQIL 4W4OC 3WXWH 4DGYL 2JK5A 3O4LE 2EXYC 5BZDB 1UENA 4L4VB 1ZLSH 1JZ5A 5IESH 2I9TA 1KT2A 1U8HA 5ABDE 2OX5A 1MLBA 4OLUL 4CVZB 5F3HA 4OLXL 2I5YH 4Z18A 1I9RL 3FQUA 4K3EH 2H26B 4GRWH 5C0BD 1GGIL 3CFCL 3DVGA 2IAMD 5CSZB 1S78C 4F57L 1INDH 4XZUB 2PYEB 3MRMB 1FFQA 4R2GD 2DLGA 5EBWB 4AY0A 2LABA 1LDPL 1XR9A 4KK5C 4JQIH 1AJ7H 5C07E 5TDNA 1IKNA 1CT8A 2H6PA 3MRBA 2G2RA 1LEGA 2EXYD 2ZZUT 3MREB 3NFSL 4KI1A 1CFSA 4Z7VE 3IGAB 3O2DH 4AMKL 5ILTH 2CSPA 4MJ6A 2QQNL 4OZGA 4UT6H 2VLJE 3CFEA 3MUGB 5CINL 2IPKA 4Z77B 4UQ3A 2F5AL 3C5ZB 5T1MA 4HC1H 25C8L 3KNBA 4NQCD 3MRPB 1A02N 4L1HA 3ZHKA 5J3HC 4ZPTA 3BH9B 1S78D 3OJMB 4WUKH 3OR6A 2X41A 1JGLL 3UTQB 3QXTA 1S8DB 4IHOA 4M93C 4JM4H 4GRLA 1T03L 3UTZB 1U8MA 1OWWA 1UT9A 2EDOA 4KK5D 4HJGA 1F5WA 5F1IA 4GXVH 3HHRB 4RDQF 1RUML 3DX8A 4NRXA 3DX6A 2ZCLH 4XNUH 3QIUA 2CDGA 4BZ2L 5ACMA 2A77H 3PWJA 1XGTA 3VXNA 4N0UA 1F02I 3GRWH 4MA8L 5DQDL 4AQ1B 1MFAL 4NZRH 2NPLX 4WHYH 5F7DB 1D9KC 2QSVA 5D1ZC 1JYNA 3AM8A 1GYAA 1GH7A 3QP3A 3C8KA 3QUXA 1BQSA 1MQ8A 3NFNB 5MEQA 3AS2A 3PV6A 1PVHA 4MMXC 3H9SA 3TN0C 3VXUB 4APQD 3DIFB 5J3HD 4NSKB 5EUOE 4RCAA 3S36X 3NABH 4Y5XB 2GKIA 1WCBB 1UZ8B 5ENWA 3LDBB 4XP6H 5I2IA 5GRJL 1WWBX 5E8PA 3HPJA 2G75A 1ES0A 2MPAL 3EHBC 4JO4H 5E24E 4U0RB 1RIUH 4BJLA 4L4TB 2GJJA 4N0FB 4PJDE 5IQ7L 5D96C 5GGTL 4PRHE 3HE6B 4RAUA 3VCLA 3UTTE 5DS8B 1XF4B 4LKXA 3ARGB 5I75C 3QDAA 1D9KD 4FQXB 4NYLB 5D1ZD 4AIZB 5FGCB 4PG9A 3HI5H 3AVEA 2WIIB 4WNQB 3QULB 5C0IB 3AAZA 1B3JA 3B9KB 3UTOA 5D7SL 5EOCJ 1IAKA 3TN0D 3BVNA 1UM5H 5JUEH 5HVGB 4X6DA 1XCTA 5SWSB 1P7QA 2JJTC 3NCBB 5E4EC 5BXFA 3NCFB 2DD8H 3OPZL 4TUOB 5I0DA 1I1AC 1DLFL 3WIHL 1K4CA 5DZLA 3DV4B 4YIQA 1HKFA 3EHBD 5F96H 1HSAA 5FGBA 5LAXB 4WI2A 1BQHA 3WUZA 3JV4B 1UEMA 4NN7B 1QO3B 5HGHA 3MUHL 3BN9C 3MYJA 5F21B 5T1KB 3P4NB 4YDKL 5I1IH 4FABL 4U6HA 4K94C 3TWCL 5KS9A 2AJ3B 1LP9A 1HDMB 3QWOA 1RZFH 3M17A 2A6IA 2CDEA 2L4OA 1KTLA 3DHJA 3BPCB 1NBYA 4RRPA 3EOTL 4K7FA 1YNKL 1X5XA 4FFYL 5CKAA 1BAFH 4EN3A 3U9UB 1I1AD 4ODUB 3LD8B 4ZOEA 4JPKH 5JDJA 2Z93A 5I73B 1IGCH 3WXWL 1MRFH 4PY7A 4UILL 2D31A 3LRSA 4DJMA 1SEQH 4P2OB 4GLRI 1ZLSL 5IESL 1MHEB 3BN9D 3PHQB 4X4MA 4MX7B 3LN5B 1FGVL 1E4WL 4NO3A 1QNZH 3HPLB 3BYYA 2BVOB 3QCUH 4HUUA 3VU2A 4ONFH 3BPOB 2I5YL 3BRDA 4K3EL 5DZNA 4Z0XA 1UQSB 3ARDC 2EO1A 2BNUB 4FQ1H 3ELAT 2YD1A 1R24B 1UWGL 2HWZH 1FFOA 3L3JA 1INDL 1NC2A 3ARUA 4MSWB 4XCYA 4PTTA 3G6JA 4XMKH 4HDIA 3RL2B 3FO2B 3EOAA 4JQIL 1AJ7L 2DI8A 3B83A 4YO0B 4PJ5A 4YZFE 4DQOH 1QSFE 4I0KA 3CSYB 5JPMA 3F7PC 1KPUA 4NM8H 1RMFH 4MNHA 4LOUC 3O2DL 4P59H 5IKCB 5ILTL 4Y4FA 4N90E 4UT6L 4HJ0C 3D69B 4YHMH 4IIQB 4OF7A 4Z7UA 1T0PB 1X5ZA 3PL6D 5SWZA 3QNZB 4AH2B 4HC1L 2YMXH 1INEH 1MFCH 3EFFB 4W6WB 4HZLA 5D7JC 3ARDD 2EDKA 4O00A 5C0GB 5C0AB 4WUKL 5TJWK 1Q9KB 2ED7A 1LO3H 3D85B 5I1AB 5IFAL 4Z0BH 4JM4L 3SKMB 4KH2A 3T0AA 5L9DH 2MWCA 4K8RH 1JGEA 4JRXE 4KXZH 3IJYB 3AREB 3BGMB 4HWEH 1QSED 4ZO8A 1W0VA 2Z91A 2ZCLL 4XNUL 1DR9A 1FE8H 5J9PB 1DANT 1YUHB 3FB8B 5DJCA 4LOUD 5F9DC 1FL3A 2J88H 3BSZH 5D2LA 3VXSE 1FZOA 2X1PA 4WFGE 3FB6A 3I75B 3GRWL 4I1NB 4NZRL 3TBWA 1U41A 3TBSA 4HJ0D 1KPRA 3EFDH 4ZOBA 2DDQH 4S2SA 2B4CL 2ZG2A 1BQHG 4R97C 1NJ9B 5D7JD 4ZNCD 3HR6A 4MQXC 3AMLA 4F9PC 5FA3B 5DQ9A 5DEZA 1RY7B 4NQXA 2PO6D 3UX9B 3NABL 2EDNA 2YD5A 3K81A 4QRUA 5D7LE 4ZUTB 3G5ZB 2C4FT 5KAQG 2WP3T 4P23C 4KMLB 2ARJQ 1HH6A 3KLDA 5IVZB 1NKRA 1JPFB 1KTDA 3N1MC 3KYOA 2EIEA 3VXPA 5IHLB 1MUJA 4WTZA 3ARVA 4JO4L 4MNGA 1RIUL 4HBCH 3I6KB 4RRPG 5C9KA 1JYXA 3VXOA 3IETA 5HYJA 2HFEA 3LB6C 4NRYB 4XGZA 5FFLA 5J11C 3U7WH 1BFVH 1G6RH 1RJYB 2OCFD 1T1YB 2MQCA 5KVEH 1I7RB 1D5XB 1IC4H 3HI5L 3UTPD 2FO4B 1A4JB 4GG8A 3OTTA 1UCBH 4JFZH 4OI8A 1JUFB 4MQXD 1K4DA 1YA5A 4HPOH 1UM5L 5CFHA 4H1LH 1J05B 2X42A 4NQDD 4OM0H 4YFLI 3L7FB 3F5WA 2FH8A 4TUJB 4OGZA 2XZQH 3GMRB 2DD8L 4P23D 4XPBH 4OLWH 1OCWH 2GJZB 1UKSA 3GGWA 1H3VA 4AEIH 1KJVA 2BSTB 4FHBD 5F96L 3RGVD 1G9NL 4MNQB 2XV6B 4C56D 1LHZA 5D7KD 1A6PA 4OJFH 2UWEE 3BUYB 5DD0L 3MRQB 4DZBB 5JHDA 3VFMA 3GSWB 4HH9B 4EEEA 3CDYA 3ZTJG 5I1IL 4NPYA 1YMME 5JOPE 1IAII 4MJIE 1A6WH 1WT5C 1RZFL 5CHNA 4NCC2 4ODSH 2NXYB 4YDVA 3VH8B 1WBXB 1OSPL 3QDMD 5E5UB 1RFDH 1BAFL 3TBVA 4JDTH 4BH8B 2BNRB 1N5YH 2ITCA 5JQHC 5IMMB 1IGTA 4JPKL 5HHVH 1IGCL 1MRFL 2D7MA 3QIWA 1SEQL 5DYOB 5EZLB 3BZEB 1QFWH 1MJJB 1T1ZB 2RCSH 3VFWB 2MCG1 1WIPA 5KANG 4F7MB 1QNZL 5EOTB 1U8OB 2R2BB 3QCUL 2CMRH 3ZDZE 1RIHH 2VAAB 1FC1A 2R0LH 3HUJE 1I8MB 4NQVB 5E5MA 3CZFB 3DRQB 4FQ1L 2EH8L 2HWZL 4D0CA 1EEYA 3HRPA 3WNNA 3HMWH 3RWFA 3DURA 4XMKL 4V1DE 3WIFA 4JPWH 1FZKB 4QRPB 3DO7A 4M62H 4X0KB 5IHUH 4DQOL 1EBPA 1R3LA 5A2FA 3WHE1 2XN9A 3FB5A 4P49A 1R3IH 5FA4A 4PR5A 3TA3D 4NM8L 1RMFL 2EDQA 1G7JB 1S7QA 4U33A 4XCEA 4P59L 3T0EB 3IS1X 5IM7A 5HPMB 3DGCR 1RJLA 3RX7A 4JFQA 1NCTA 3CPLA 4MB4A 4YHML 4B0MM 5C0DA 3MNZA 4DZ8B 2XFXB 3ZE1F 3OKOA 2YMXL 3FQNA 1INEL 5E08H 3CGTA 5HGDB 5E2UH 3FN3A 4KAQH 3L5WA 5LQBH 1LO3L 2MQ3A 1B0RB 4Z0BL 4UAOC 3VA2C 1CWVA 4FQPA 1KJMB 2HJFB 5L9DL 4K8RL 5C6TH 3V0AC 4LLMA 1TITA 5I66B 2J5LB 3FO9A 2KQMA 3TVMC 4P2CG 3ZE0F 2P5EA 1YEGH 1FE8L 3FB7B 5I1EL 2YC1B 1CGTA 5I71B 3BSZL 2J88L 1YNLH 4KUCF 5EO0B 1FFRA 4R6UA 5L8LB 3EFDL 3QUKA 5JR1H 5LJYH 4PJ7E 5I16A 4CU6A 3D0LA 5KG9B 2EDYA 5FXCH 2V5RA 4YDLB 1MHCA 2VYRE 3MLYH 5EUKA 3LQZB 1RZIA 1ZEAH 1AHWB 1J1OH 1TZGH 2DQFB 5AYQA 1V7MH 4GAJH 2J2ZA 1TIUA 3TO2B 3TVMD 4HBCL 4F7TB 2VDLH 1Q1JH 5CZVH 3MSPA 2QSTA 4M8VA 3PQYA 2JCCE 1FL6B 1NKOA 1BFVL 5EC2A 1G6RL 3U7WL 4ENEC 4G9DA 1FL5A 1ADQH 3R8BB 4D9RD 2VLMD 3QQ3B 5KVEL 1GHFH 2XQYK 4WIQA 4P4RB 3DBXB 2X4QB 4Y1AD 4JFZL 1ITCA 3CFBB 4HPOL 3F7RA 3AUVA 3WS6C 4TNVF 4OM0L 4GJTB 5DQJA 3O2VH 4W70A 5ITFA 5EU6D 3OAZH 1U2HA 2XZQL 3HZKB 1MCPH 5ACLA 4J3WA 4XPBL 4OLWL 3ZKXC 3DUHA 1OCWL 2GI7A 3GSVA 4AEIL 2OTPA 4ODHH 3FZUC 4OJFL 4ZNEA 1BZQK 1KTKE 2EYRA 3UYRH 2IBZX 3GMQB 1ZVSA 1J8HB 2AK4D 5CJ5A 1K2DA 3MGTB 4ENED 1AD0B 1AQKH 1X6NA 4P5TC 4KDTA 4ONOA 3SCMA 1A6WL 1T20B 5B8CB 2J6EA 1FNEB 4ODSL 1ETZB 3REWA 4R3SB 4NT6A 3MV9A 1RULH 2EDBA 2P8MA 5D7IF 4M9PA 4OUUB 1RFDL 2IMMA 4JDTL 5FDYA 2GTWA 2EDHA 1MI5E 4P46A 1N5YL 3EDFA 1KF9B 3A0OA 4WFED 5EOQH 1TJGH 1YC8A 3ALWA 3VW3L 5HHVL 5IWLA 3SDAB 5DMGC 3FZUD 1U3JA 1IM9A 2PCPB 3KLSA 4MS8D 4YHYB 1ZWIA 2VLLB 1KCLA 3BO8B 3O3AB 5HD8C 1KULA 4HBQA 2DL9A 1QFWL 4FXGA 4ORGA 5IW6A 2RCSL 2Z0BA 1AXIB 2HKHL 5AD0B 4P3DA 4P5TD 4HFUH 4O2CB 3ARSA 1KB5H 2CMRL 5CP7B 4U1MA 1T2QL 4HIIA 4UDTB 1AO7A 1HCFX 3MRKB 2R0LL 4M61A 4TVPE 3AC0A 2BY2A 3UTSE 3V5HA 3HMWL 5DHYA 4HLZH 4OAWA 5F6HI 1I1RA 3E1F1 3VWKA 4JPWL 2W91A 3QHFL 4QOKB 1DBMH 4M62L 5IHUL 1T04A 5DMGD 5MI0C 3D9AL 5K9OA 2ERJB 3LPFA 3VE0A 1JWSB 5IJVA 5ICYB 2OL3B 1KIPA 3HNVH 4L3EE 5HD8D 1UB6B 3OV6A 1U8NA 3N1GC 1CXIA 1EZVX 1EEUA 1TPXC 1HEZB 4OCNC 1I7UA 1E6OH 3OX8A 1ONQA 3IF1A 4J1UA 1MHPH 1QTYT 2WBKA 5HPOA 5A2KH 5E08L 4LK4A 1PJ9A 4I13B 1CFQA 3JV0A 1KBGL 4D3CH 4KAQL 5LQBL 3T77A 3MR9A 4M3KB 4JZJA 2BRRH 2BRQA 4EXPX 4Z7QE 5I8EA 5C3TA 4JFDD 3IDGB 4ZFOB 1I1YB 4K9EC 5C6WH 2AV1B 1XF2B 1CGXA 1ERNA 1Y18A 3U7AA 3B9AA 5J12B 1YEGL 1JVKA 4G6FD 4MJ5B 4WDIA 1ZT1B 3GM8A 2E9JA 1ZS8B 4KRPB 4HT1H 5IMLA 1YDPB 5FUCE 2X5PA 4HUXA 1HHHA 1N0LA 4L9LA 5FKPB 1HHJA 2AXJA 2BOBA 5JR1L 3D3VA 1K3IA 5F7YC 1DFBH 3S97C 4GG6A 3FCTB 4PJAF 4NUGL 3RWEB 1GGUA 4ELMB 1IKNC 4A6YH 3E3QC 2J4WH 4KXZI 5HY9A 1U92B 1XH3A 1LEIA 2GYSA 5IJKA 3MLYL 4P99A 1IM3B 2GT9A 3B3IB 1ZEAL 3DJ9A 5JPNA 3P4MA 1J1OL 1TZGL 1MQKL 1V7ML 3EJZC 2DF3A 4GAJL 5C2UB 1NFDB 4LNRB 3MRCB 2RFXA 3JV6B 5E6IB 3W11C 2VDLL 4LDEB 1Q1JL 4QRRB 5CZVL 1S9XB 1S9WA 1I3RB 4NC0B 3AGVA 1OARH 3L9RB 4JZNA 3HR5A 1GHFL 1KG0A 4G8GA 1ZVYA 4GRLC 1MVUB 4R0LB 5GJTH 2X10A 1MY5A 1I1FB 3VRLE 4RIRB 1A6UL 2O93L 3O2VL 3QIUC 3U0TA 4U0QB 1UH4A 3MRHA 4WW1A 1MCPL 1Q94B 3WNMA 2CXKA 4RAVA 4D0BB 1GGCH 4MQTB 3AB0C 2X1OA 1NCUA 3EJZD 4ODHL 2PXYA 5E7FA 3KDMB 3QUXC 3I02B 5FYKD 3UYRL 2CKBA 3W11D 3R1GH 4LHUA 3CU1A 4OTXH 1YYLH 4MAYB 3MJ6A 2I9LA 1AQKL 4GRLD 2IANE 3FQTA 1BPVA 4PJCA 1RULL 2CJUH 43CAB 3KJ6H 5EZIH 3O11B 1KJ2H 2DTSA 2Y07H 1A1OA 3OGOE 2GHWB 3QIUD 5E00A 4Y4HB 3BP5B 4RMRA 3NFPB 3W9DA 4TOYH 3SO3C 4UINH 4LCWA 4C57C 3WN5A 4ZFFA 4Y4KA 2YD4A 1TJGL 5C0EA 5JW5B 5D2NA 4KVCH 1I3UA 2ZSWA 1OP3K 1GOHA 5EUOF 5ETUA 3L7EB 2F58H 3QUXD 1ZK9A 1D6VH 4CADA 5D1QA 4IJ3B 3FT2B 4ZO7A 2HA1A 3BHBA 3H9SD 5MENE 4OB5L 3EYFB 3MRGA 4NN6C 3TPUB 1AXTH 4KV5E 4Q9RH 4FZEH 2X4SB 4ZAKA 1HXMA 1WZMA 4HFUL 1KB5L 3GSQA 2JLLA 2QSQA 1YC7A 4AEEA 3ZMRA 3WHXA 5EN2A 3EUUA 3T4YA 1YY8A 4ZPVA 3O2WL 3SDYH 5FGBC 1OSZA 5HYSA 2VQ1A 5IHZA 4L4VE 5F9AC 5FCUH 4CW1A 3TFKC 5A16B 1QFWI 4OKVB 3T3PF 1DBML 3QHZH 3S96B 5EBMA 2P42B 4MJ2A 4RWHA 1NAKH 1AGBB 2P49B 3HNVL 3RNQA 3VFRA 4HS6B 2EC9T 3RZCA 3K46A 2C3VA 3P4LA 3U2SA 1GCFA 2PYEE 2GUOA 4GW4A 3DROA 3DXAB 4HHAA 4EN3C 3NIFF 1DQJA 1T80A 1MHPL 4WO4B 1RVFL 2BVYA 2VXVH 1GAFH 4P48A 5IVOA 3FL7A 4D3CL 1KN2H 2HT3C 5GGRA 4WEMB 2BRRL 2ENSA 4PGBB 3MA7A 3TFKD 1DLHA 4HX1A 4G9FB 3HG1A 2O5ZH 3V52H 4NUJA 2ADIB 4BZ1H 1P4LA 1B0GA 1KLFA 1BVLB 1VADA 4ODTH 4FMFA 1YMHB 3SDCB 2OK0H 5AZEH 1HIMH 3KS0J 5HJ3A 2OR9H 4HT1L 4PRAB 1P53A 4M5ZH 1X4XA 3C9NB 2BNQE 4XNQB 4EN3D 1ODAA 4GRWB 1DFBL 3HS0A 4XVSH 5HHPA 4LHUG 2APXA 1WSST 2H9GA 4A6YL 2F74A 2DLTA 2J4WL 2FZ3A 3B8SA 4BKLB 3VXTB 1T21B 5MEPA 4F2MB 3RVVC 5EG6C 3QFJA 4KRMB 1ZSDB 5CBEA 1FYTD 1N6VA 1ZHBA 2WNGA 4YE4H 3WUWB 4RSVA 3G5XA 2IALB 1F11B 4Y4FC 5CGYC 4TSAH 2VDNH 4RNRA 2VDKH 5MEOB 3VXUE 2NY3B 2HTLC 2AKRA 1G1YA 5I1LA 3BXNA 1OARL 2V2TB 2VLJA 2YUWA 1NC2D 4OF6A 4YBLB 3RBGA 4ETQB 4DOHB 1I8IB 4X83A 1NGWA 1NGXB 3P77A 4PJ5D 1S9VB 2VLKD 4OD2B 5DK0A 1DBJH 3FT3A 4L4TE 3AXLB 3PWNB 3V4VH 3RVVD 2APTA 5EIIA 3PIQB 3QIBB 4KZEH 3OMZA 4TNWK 4UB0H 4Y4FD 5CGYD 5TQ2H 3RVTC 5DJ8A 4F58H 3IU3A 2BXYA 3IDNB 3SHSA 3CVHH 1KGCD 1EAPA 1YQ2A 4JY4B 5SWZD 5HYSG 1ED3A 3VG9B 2ICEA 1XR8B 4PJIB 5DJZA 5FIEA 4Y2DD 2HTLD 4OTXL 2BDNL 3FFCB 1YYLL 3WFHB 3DYOA 1Q38A 5FV1L 5SWSE 3F12B 3GSXB 4NKIH 2R1WA 2XKNB 4TUKH 2WV3A 3U30C 3ZYOA 1N2RA 2FB4H 4XP1L 2H2SC 3ZE2E 1N3NB 4ACPA 5EOCH 2CJUL 3CCHB 3KJ6L 4QHNA 4NKMA 3O8XB 4LPUA 4JFYB 5EZIL 1BJ1J 3RVUC 2Y07L 2P8LB 5IVXA 4ZS7H 4TOYL 1TCMA 4BFIB 4UINL 1MHHB 5K33A 1W8OA 4I18A 3K4DA 4MZ3A 3RVTD 4KVCL 4YC2C 2MNUA 1JE6A 2F58L 1D6VL 4UUJA 4PJDA 1GIGH 3EZJB 2C7UA 3C6LC 3UTTA 4FZEL 5EPMA 2VITA 3CH1B 2KL6A 3OKEA 1RZ8B 5TPWH 5EU4A 2H2SD 4G42A 4LKCA 3SDYL 4M8QA 3RVUD 3RWIB 1DDHA 1BD2A 1EV2E 1T5XA 5E4IA 5HYJD 4XPHH 4WY7H 4M9OA 5FCUL 1CCZA 1X4ZA 2MTPA 3U6RA 4LPVA 1IGFH 5JW3H 3MUZ1 5F1NB 3HTLX 2DLIA 3QHZL 4IS6B 3MROB 2FH6A 2C26A 2CR6A 3KPSA 1NAKL 1KPVB 2NY1C 3QDGB 4PREA 2IFFH 4XCNA 4TTGA 1S7XB 5DVMA 2IGFH 4L8BB 3RDTB 3C6LD 1DQQB 4RFEA 1NMCB 2X4PA 5ALBH 1PSKH 1OQOA 1ZHKB 4M3JA 5D6CB 4YXLL 3QXDA 2GSGA 2VXVL 1GAFL 5GQBA 1T5WA 2C3HA 1KN2L 3DV6A 1IGJB 3QIWC 2C3XA 4K9EH 2W59A 2AXGA 4X99B 1W0YT 2KZ1B 4X5XA 1ZANL 2AJUH 4G8IA 2O5ZL 3IXAA 2VZOA 3V52L 4ZSOA 4BZ1L 2HVJB 2OSLA 5BMFH 3KPOA 3H9HA 4ODTL 2NY1D 2BY1A 4O2FB 2OK0L 3RWCA 5AZEL 3KPPA 3ZL4H 1HIML 2YPKA 5GJSH 4XMLH 2OR9L 1K85A 5C0AE 3UPRB 1NGYB 5D93C 2O5XL 4F9LA 3ULUE 4M5ZL 2AK1H 1GGYA 1A3QA 4OZFA 2CUHA 2BERA 1A1NB 4YAQA 2R2HB 4UDUA 3MJGX 1DQLH 3IDYC 4NQED 3LKRB 2ATKB 3QI9A 4PRIA 3FAXA 3NN8B 3SJVB 3MJ8A 3TJEH 3QIWD 4X4XB 3K74B 5BO1H 5F7MC 3P11H 1XZ0A 2W65A 3L5XH 5I8KH 1A47A 3BD3A 3HUJF 2NY0C 2CLRA 3QUMA 4XP4H 4TSAL 4G8FB 2FYYA 2AQ3A 2VDNL 3Q0HA 1B4JH 2HFFA 4NM4H 2VDKL 2CLVB 4CN1A 2C4XA 1KYOK 2C3GA 4JHZA 4HKZB 4XI5D 3KPLB 1MCKA 5MHSD 4Z7WB 4HIJA 3NCYS 4X6BA 2HLAA 3EAKA 5CEYB 4HG4J 4X4YA 4H88H 2HN7B 4LPXA 4J3SA 2BSSB 4N9OB 4O9HH 2XN9D 3V4VL 4PRPB 4KFZC 2XICA 4ZUSB 1DVFB 4KZEL 3PWUA 5F9WC 4JRXA 1WZLA 1U93A 2NY0D 4U1GB 2G5RA 5HHQA 4UB0L 3DX7A 3MXVH 4F58L 1JPTH 1FV1A 3KPQA 1VFAB 2AEQH 3CVHL 2OJEA 2Z8RA 1PY9A 3FTGA 2BFVH 5FYLE 3RVWC 3RIFF 3MRDB 5DXWA 3GNMH 4NKIL 1JYVA 1F00I 3QQ4B 3QO0A 4TUKL 1CR9H 2FB4L 4PGJA 3CSPA 5EOCL 2FJFB 4XAKE 1RHFA 4POUB 3MCG1 4ZFGH 2P5ED 2V6HA 4ZS7L 2EIZB 1VESA 3FT4B 1HINH 5BQ7B 2LAAA 2EIBA 1KN4H 1JNHA 2A74A 3VD9A 3N1PC 1EO7A 4F33B 1D5MB 3DVNA 1OGAA 3DRTA 5D8JH 5HYQA 1GIGL 1P4BH 4K3HA 1G6RB 4BZYA 4QY8B 2BNRE 5TPWL 2EKSA 2UZIH 3F7YA 1RPQA 3IAQA 4M1GL 1MWAA 5I1GL 4H1LB 2G9HA 3GMNB 4HK3J 3ARYA 3IAGC 5IR1A 1L7TL 4OZFG 4XPHL 3KXFB 4PRBA 3O6FA 4LL9A 1IGFL 5JW3L 4P5KA 2E7LA 3PHOB 3JV5A 4KDTC 3SCMC 1V05A 3W9EB 4KK6C 2UWEA 4QHUA 2IFFL 5F70A 3GK8H 4NO5B 2VB5A 4Q97A 1XIWD 2IGFL 1FVDA 5FCSH 4F3FA 1EHLL 2FJHB 3CMGA 3QJFA 1BBJA 1PW3A 5LBSH 5ALBL 1PSKL 1MY7A 1TMCB 2IAMB 5BS0B 5DJ6A 4NQSB 4QRPE 3QWQB 2VXQH 4WV1B 4P46C 3JWOH 1NCWH 1JMZA 4WTXA 4NP4H 2YWZA 4WENB 2Y9RT 4OCRH 1CL7H 5IWLC 1F6FB 3NAAH 4NZUH 2BVQB 4IMLB 2ESVB 1AXSB 1GGBH 4K9EL 3V5DB 1FNFA 5T5NF 3V6OE 3LEVH 2AJUL 5CD3A 3GMMB 5FM8A 1JTOA 1SVZA 5GPRA 3H42H 4Q58C 4OFIA 5BMFL 3SCMD 1BIIA 4KK6D 3ZL4L 3B43A 3HC4L 4P4KA 2AGJH 1QHOA 3MV9D 3N06B 1B2WH 5DK2A 2JB6B 4M7JH 2AK1L 3MCKA 3DPBA 1WC7B 2HMID 3ZTJH 1WWAX 1UZ6E 5KVMC 3G04B 1QG3A 5TE4L 5A2LH 3VWKC 2VABB 3BDYH 4HWBA 1J7VR 2DQUH 4M7KH 4EDXA 1FIEA 4IRZH 3SGKA 2APFA 3AS1A 1IM9D 1PGRB 1P4IH 1A6TB 5H8DA 2X4OB 1V3JA 5BO1L 1A2YB 1J11A 1R3KB 5DSCB 3O4OB 3P11L 3VFVA 3L5XL 2QKIB 5I8KL 1U3YA 2D9QB 1N6UA 3D0VB 4XP4L 1IT9H 3MFFB 1B4JL 1TLKA 1AO7D 4C4KT 5FYKU 2ZCKL 3MMEB 3QBTB 3R4DA 4GAYB 3WEXB 2GIYA 3OKLA 2ATPB 4JZJC 4E0RB 3VWKD 3EYSH 6FABH 5KN5A 3QEQA 1N5AA 4JLRB 4M93B 4OM1H 4H88L 4DGIL 4G5ZH 1YY9C 4CVXB 2EE9A 4O9HL 3V2AR 4C59B 1AGFB 4UV4H 2J8UF 5JOEA 2DM3A 3S5LA 1W2KT 5E8OA 4F7PB 4N8VA 2XXMB 4NGHH 3QUZA 4L9LC 3MXVL 3EYVA 1JPTL 5FO7B 3MNWA 2AEQL 3K4ZA 3E6FA 4ZG1A 1K5NB 1WAAA 4XBGB 2BFVL 3IDIB 2GSIA 5TGBB 2DQEL 3O3DB 1D9KB 5D1ZB 1QKZH 4Z7QF 3K7UA 2DQGH 4FTVB 3GNML 3TZVB 5FDWA 4NKOB 1ZTXH 5C0NC 4XPGH 4EIGB 1BWMA 5IJKC 1CR9L 1U8KB 3BIKB 3J8F7 4PJ7A 1IL1B 1DN0B 1M05A 2K1MA 1YY9D 5H94A 1OF2B 1DQMH 1JWMA 3MACL 1CLYH 4ZFGL 3VRJB 3MBEB 1N8ZB 1EJOH 1HINL 4AIOA 4I0PB 1KN4L 4X9GA 3BWAA 4HD9A 3OKNA 2R1YB 1C08B 1BOYA 3ZT5A 1RIVH 2W0LA 3D3VD 2GTZB 3BEWB 5D8JL 5I75B 2VDMH 1P4BL 2CDFA 1HSBB 1Q9WA 3R06B 4UBDC 3ECBB 3PE9A 4HFWA 4RMVA 2A6DA 3DI2B 1VSCA 5C0RH 1XF1A 5JOFA 3BJ91 5DDHA 1EEZB 1MPAH 3IDJA 5C0ND 4QRSB 1QA9B 2R9HC 2UZIL 4HUWA 3WFDH 5E4EB 5CBAA 4JFOB 4Q9QH 2N4IA 1RK0A 5KVDH 4EZMA 1I1AB 4DW2H 5J6HB 2PXYC 3LV3A 1FNSH 2CIIA 4Z76B 5IFHH 2HH0H 1MCNA 4QKXB 5JORA 1QQDB 3VRLF 3VFOA 3Q2CA 4CN4A 4Y16A 4BQ8A 4ZFZB 4G8GD 3ZTNH 2P45B 3ARZA 4KI5E 5MP6H 3GK8L 5IFJB 4UBDD 1CF8H 3KR3H 5EFIA 4LASH 5I1JH 5CIPA 1N59B 3BAEH 2QV2A 3KG5A 1GZQB 3NMEA 5LBSL 3VJ6B 2V5SA 3GIVA 2R9HD 4J4PA 1X5YA 4JAMA 1X6LA 2DQDH 2VXQL 4NZDA 1O0VA 3JWOL 4QOKE 3WN5C 4NP4L 4Y4KC 1DUYA 2W0FA 4OCRL 5D2NC 1K8DB 1QRND 2PXYD 1R5WA 5ANMA 1JI2A 3F7VB 4RGNE 1Y0LB 4IDLA 5D1QC 5EZJA 4L8DB 2FR4B 1P2CB 2NYYC 4MD5B 4GRMA 3WSQL 4ZAKC 4HUNB 3K8MA 4HS8H 1ZT7B 4U1JB 1VHPA 2FDBP 5IF0B 5C09E 1UXSB 2NX5A 2Z35A 2V2WA 2AGJL 1G7QB 1A3RH 2EXWC 3S5LG 4FQQB 1KIRA 1VEPA 1B2WL 2Q86A 3MRJB 1KB5B 1CVRA 2HT4C 4M7JL 3HNSH 4N8VG 4FQHB 3HRZB 3I6LE 3ARDB 3CDFA 4AM0B 3K1DA 4PS4H 1R5VA 4OV5B 4OIIH 5J13C 4LCWD 3BDYL 4Y4KD 5J7CC 3LS4H 1HK6A 2DQUL 4KV5F 4M7KL 5IB4A 4IRZL 1YEHH 1P4IL 2XWTB 4LGPB 3QXAB 4X98A 1CXFA 5D1QD 1UA6H 3VMNA 3SDDC 5IW1A 2NYYD 1HOCA 3RZCC 3CFDA 1CYGA 1I7TA 3KYMB 2KUTA 4ZAKD 4L8SA 4KTEL 1IT9L 6CGTA 1J0IA 2IH1B 2EYTB 5ICZB 1EXUB 4X9IA 2VZSA 4YQXH 4U7SA 4X7SL 2HT4D 1AGDA 3DYPA 2Q8AL 1F4HA 5D7JB 3D25B 4OF0A 3SKOB 1BM3H 1J0JA 3EYSL 4LPYA 6FABL 5DFWH 3NVQA 5IUSA 3RUGA 1IILE 1O7SA 4OM1L 1CFTB 2A73A 4G5ZL 1NFDE 1MNUH 5ESVA 4YXHH 4TPRH 3RWHA 3DVIA 1CE1H 4UV4L 4IRSA 3SDDD 3DNKA 3QNYB 3RWDB 3CD4A 3U7YH 3PABA 5FV2A 2MCPH 3RZCD 3L95B 4G80B 2GCYB 4XWOD 3CVIH 4NGHL 3SY0A 4FFVC 5GSVB 4KROC 5FF6A 2FRGP 3WDJA 3BFOA 1PKQB 1X5GA 1QKZL 3MGAA 2DQGL 4PJBA 3U46B 5GRVK 2WQRA 4R97B 5DC4B 2D0GA 2IBGA 4RX4A 3C60A 4XPGL 1OB1B 1UC6A 3HG1D 1UCTA 4A6YB 2P5WA 5DHVA 2LVEA 4JN2A 1DQML 3O4LD 1YEDA 5KSAA 5FB8B 2FGWH 5I6XC 2XZCL 3S35H 1BFOA 4DFHA 4FFVD 3OJDB 3GMPA 4KROD 1RIVL 5J11B 4QXTA 2VDML 5IMOB 1XGPA 1J1XH 2XTLA 2Z92A 5F1OB 4ZYKB 1JI1A 1UEYA 3REVB 4DCQA 5C0RL 3B9DA 1MPAL 3B9EA 3X3FH 2X4RA 1MCSA 3QFJD 1TCRB 4Y5VA 5DEGB 5IEHA 4QF1B 1RI8A 2P4AB 2UY6A 3PDOA 3WFDL 4Q9QL 2DQTH 5KVDL 4ZODA 2ZOKA 3V6ZA 4DW2L 1EAJA 4X7TB 4AEFA 1FNSL 3GKWH 5IFHL 2HH0L 5DRWA 5F1KC 2HYMA 4M6NH 4YHNA 4MLIA 4WU7B 5E8EB 5F3BB 1FN4B 2HVKA 3UXFA 1A6ZB 3QG6B 2J6EH 4FS0A 1SJEA 2VLJD 3CX5J 1KELH 1IVLA 2DM2A 3ZTNL 4I48A 4F15C 5IQ9B 3IDMB 1HQRB 1CF8L 3KR3L 4LASL 5I1JL 3BAEL 1GZPA 3HZMB 3SKNA 1F42A 4AENB 5T1LA 4HWZB 1S7SA 5I1CH 4B5EA 4QTIH 2NY2C 2DQDL 1IGYB 1Q9LB 4ZUVA 4I18C 3TBTA 1KJ2B 5I0ZA 3J7HA 2OMNA 4IDJH 3L3GA 2V9RA 4N1CA 1G7IB 4FQLH 3TESA 4GW5B 4PTUA 1JBJA 3QG7H 2QSCH 3D39A 43C9B 4MHHI 2CD0A 3DXAE 1CXHA 4MD4B 1JP5A 4LSUL 5HGAA 5D7IB 3LKPA 4HS8L 5T3ZD 1BFSA 4GAGH 1LO5A 3AU1A 5GSRB 3W0WA 5MENA 1A3RL 3TBYA 2LU3A 1RHHA 2CRMA 2DJUA 3HNSL 5AUMB 2P48B 2CO7B 3D18A 5DI8B 4G9FE 4OT1L 3JVGA 5EWIH 2IQAA 2NY2D 3HLAB 1T7XA 4OIIL 1XGRB 3GJFA 3BW9A 2IPUG 3LS4L 4Q6IA 3U36A 3CK0H 2X1XR 2H3NB 1YEHL 5HVFB 5BZDA 2BVPB 1GXEA 4JPIB 2F53A 2VDPH 5DO2C 3UTTD 4CVZA 3S4SB 5ADPH 1B4RA 4HGMA 3P30H 3OGCB 2RGSA 1OP9A 4GRWE 3K8LA 1M6OB 1T7WA 3M8OH 3ROOB 2H26A 1WF5A 1AGCA 4YQXL 3KS0H 4ONHA 3T4AA 5CSZA 5JQ6H 3Q3GB 4XZUA 5J6GB 1IBGH 5EBWA 1BM3L 4MQSB 4TVPL 5KSUB 3LN4B 1CD1A 4UAOB 4KRNA 4WRLA 5JIKA 3OAZK 1GVIA 3KPSD 4TPRL 4YXHL 4GKZA 1I85A 1CE1L 4LVEA 1CD8A 4X8JB 3IGAA 5I9QC 3U7YL 3GEWB 2MCPL 4JFXA 2D4DA 4F9LC 3CVIL 2HLFC 3MUGA 3WL9A 1QHPA 4DOHE 3C5ZA 5AG8A 4E41A 4OBSA 2FEDC 3T2OA 4HXAH 3C08H 4PJEE 5E2VL 1A7NH 4R7DB 3QI9C 4LLAA 1S8DA 1G0XA 1U8PA 2FBOJ 2N1KA 4XX1E 4HEME 2IG2H 1H5BB 1X5LA 2VDQL 4LLVA 4Y19E 1BIHA 4LLWA 4MDJB 5EU6B 5IHBA 1LGVA 4N0YH 3HC0A 1XEDA 1YN6B 3ULUF 2AS5M 4PJIE 3QEHA 2FGWL 5F7EH 3S35L 3FFCE 5H35B 4PJAB 3UDWA 1M71B 3SE9H 5F7DA 1ZKAA 2NW3B 1HNFA 2QADB 4R7NB 2AK4B 4R96A 3TYFA 2DLHA 3MLRH 5CLTA 1OTSC 1J1XL 4DAGH 2W9DH 2G60H 3DIFA 4PUBH 4NOBA 3QI9D 4XT1C 1OT1A 1T3FB 1PDKA 3X3FL 3S88H 5D71L 5EU5B 3WJLA 1IC7H 4HKBA 3D87B 1FCGA 2DQTL 4WFHD 3QDJB 1IQDB 1Q72H 2CKBH 2DM7A 4L4TA 1V3MA 1ZT4B 3ZKXB 3VFNB 1BJ1H 3P73B 3OBAA 4FOMA 4WEUD 4PGCB 2JIXA 1ZA6B 4M6NL 3O3EA 5DS8A 2SEBA 3D5OF 1NDMA 4OGAC 3ARGA 4MA3B 3VFPA 2JF1A 3GMLB 4NYLA 5E70A 3CVHB 5IMKA 1P7KB 1X5AA 2XTJC 2WIIA 4WNQA 4Q6YA 1EHNA 1AFVH 4U6VH 1MCOH 1OTSD 2D3VA 5DUML 3KLHC 3EYOA 3FONB 4IRJA 3I6GB 1AKJA 1HE7A 4MQ7A 3GUTB 2RHEA 4S1RH 4OZIA 4QTIL 1FG2A 1URLA 3ETBF 4JM2D 2Q3ZA 2NNAB 2VR9A 4JRXD 1ZV5A 2NMSA 5GS2H 4IDJL 3QDGE 3EO9H 3JV4A 1A0QH 1I4FB 4FXKB 4UTBH 4FQLL 1LK2A 2NXZB 4RMUA 3QG7L 2QSCL 2XRAH 3P4NA 4NWUH 5KOMC 4OGAD 1N0XH 3VGFA 4GKSA 3VMPA 4NC1E 2XTJD 1HDMA 3IJHA 5IV2A 5ACZB 2G5BB 1JV5A 4YK4C 4GAGL 3WFZA 3OJVC 4HMDA 3QISA 3KLHD 3BPCA 4UT7L 4H20H 3X13A 1R3JB 2DAVA 4ESKA 4O51B 3CFKB 1IEAB 1PEZA 3PNWB 3FMGL 4L29B 3CDGB 5E9DA 5EWIL 4ODUA 5C9JA 3SGDH 3O6FC 1FDLH 4ODXB 1RZGB 1TVHB 2E7LC 1DEEA 1BECA 2FGZA 2ZUYA 3G9AB 1KC5H 3CK0L 1OGAD 2FCBA 1UB5A 3N50A 3PHQA 3ZDXE 5MI0B 5DURB 2VDPL 3HPLA 4XBPB 5ADPL 4GKNB 2YRLA 3P30L 4Y8DC 3M8OL 1KIQB 4MZ2A 2Q6WA 3EGSB 3O45B 5F89B 3ROLB 1AE6H 1AGEA 2BNUA 5C0BA 5JQ6L 1R24A 3SJVE 4GQPH 3L3HB 4MSWA 1A6AA 3RVXC 3RL2A 2RIKA 4DEPC 2JK5B 3O6FD 3H3BC 4WHTB 4JO3H 3NCMA 1BF8A 2R0KH 4HK3N 1U8HB 5M94B 1KCKA 3VRIA 1ZLVH 1MLBB 5C2BH 3STZA 4XC3H 4JHAH 3N1QC 4P4KC 5F3HB 3DUUA 4PJ9A 2UYLA 3FHQA 3FQUB 5FUOL 4Z7WE 3D69A 3I50H 3DVGB 5LXGH 4N8CH 3C2AH 3JSSA 4AH2A 2A6KB 2VUOA 5JHLL 3KPNB 3FO1B 4HXAL 3C08L 4FQIH 2DIAA 1CXLA 1A7NL 3IB4A 3D85A 3E2HC 1XR9B 3G6DH 3SGKC 1QFPA 4PRPE 3SKMA 1QOKA 3NZ8B 4LCCA 1MCRA 3RVXD 5TDNB 1CT8B 2IG2L 2R56H 2H6PB 4FQJH 3QZWG 5CSGA 2G2RB 1JGDA 2ILLA 1OPGH 4N0YL 4I2XA 4M1CC 2VTFA 3MC0A 1UXWA 2WP3O 5TDPA 2RR3A 4MJ6B 1UZ6F 5F7EL 4OZGB 5I76A 3CFEB 4P4KD 1A9EB 2IPKB 2KPNA 3VD5A 3SE9L 4UQ3B 1MEXH 1F58H 3HFMH 4MXVE 1T6WA 2YWYA 4OZHF 1OAYH 3TV3H 4ZPTB 1U3HB 1NJ9A 2HKFH 3OR6B 3S3PA 3MLRL 2VQUA 4DAGL 2W9DL 2G60L 4GRLB 4PUBL 1BEYH 4APQA 4HJGB 3S88L 5H37G 5F1IB 4HIXH 2FX7H 3UBXA 1FC2D 2MKWA 4NRXB 1IC7L 4X6CF 5IVZA 3QIUB 2CDGB 3ZHDA 3QUZC 4M1CD 4WWKC 1Q72L 2CKBL 3I6KA 2X7LA 1XGTB 4N0UB 4H25A 1A7BA 4IMKA 2NY5H 1LWRA 3C8KB 2YUVA 5MEQB 5T3ZH 4HKXA 4IOSD 1I7RA 1AC6A 3H9SB 3BYTA 2FO4A 1AFVL 4U6VL 1MCOL 4KKLC 4HV8A 3QEQD 1J05A 5ENWB 1FNLA 4XPFH 2HFGH 5I2IB 1VEMA 3BP6A 3MLWL 5E8PB 3HPJB 2G75B 3GMRA 5B3NA 2IQ9H 2VUYA 4S1RL 3THMH 5C0FB 2GJZA 3H7LA 1QEWB 2BSTA 4H5SA 4MNQA 3QUZD 1RZ7H 3SO3B 4LAJH 4WWKD 3VCLB 5C71A 1H3WM 2BY3A 3EO9L 1A0QL 4UTBL 3OAYH 3GSWA 5INDB 1NFKA 4HH9A 4N9GA 4NWUL 4PG9B 1N0XL 4LVHC 3AAZB 3RTQA 5BS0E 1IKFH 3BVNB 3OXRA 4NN6B 4CRPA 4J3OC 5FYJH 1PZ5A 1F8TH 4KKLD 4X6DB 2F15A 5DEFA 3MJ9A 1P7QB 3SE4C 3KYNA 3QO1B 1BOGA 3T2QA 5K9QI 2ESVE 1K4CB 2CGRH 4YIQB 2ADFH 2BSED 1YPZA 2ICWI 1BQUA 2FHCA 5IMMA 3SKUD 1BQHB 4S11A 1I3VA 5D7LB 1BZ7B 2GAZA 5HGHB 4NWTH 3MYJB 1KC5L 1MAMH 2ED8A 2EEDA 4U6HB 1BZ9A 5L2JA 4JVWA 1RAMA 5SV4A 1RU9L 3SDXF 1U42A 3M17B 5FOJA 1G1CA 2CDEB 4P9HC 4K7FB 4J4PC 3MNVA 3T0XA 4X7FC 1I8MA 1L6ZA 1AE6L 4EN3B 3DRQA 4GXUN 3CJJA 1NGPH 4MGXA 1ZHNA 5ECJE 1REIA 4R90L 4X6FA 4ZUUA 2ED9A 4FQ2H 4KI5F 2EE6A 4PY7B 5ID0A 2D31B 3SE8H 3LRSB 2GFBB 3IFPA 3VFSA 4JO3L 3KWWA 2DQCH 4QLRA 1UH2A 2R0KL 5C0CB 4OFYD 3FRPA 4LVOC 1ULVA 3FQRB 5HHMD 4NO3B 2Y6SC 4JQVA 5C2BL 4M6AA 1TJIL 3DOSA 1KUMA 4HUUB 3T0EA 4OZFH 5HPMA 3UBXG 3TO4A 2A2QT 4DTGH 5C0JB 4BSWA 3I50L 3MODH 2YXMA 5LXGL 4N8CL 3C2AL 4DZ8A 2XFXA 1YMMB 1PLGH 4J4PD 3WE6B 1MFDL 1SY6A 4PJ8A 1FFOB 3BIBX 2BHZA 3PL6A 1FP5A 3L3JB 5ESAB 4FQIL 4M03A 1PKOA 1N4XH 4PTTB 1EPFA 3AFLA 4U49A 4HDIB 1A7OH 3G6DL 3EOAB 1B0RA 2X44D 1KLGA 1S7TA 1D5BA 2R56L 4FQJL 1NL0H 1LO0H 1MI5D 2VN7A 3IDXH 3QUMH 4U7MA 3VGGA 1OPGL 1KPUB 3K2UL 3EO1B 5I66A 4L8SC 3TEUA 4PP1C 4OBRA 4HPYH 3RPKA 1RZJC 2Y6SD 2NX5D 4LSPH 4NQUA 4TQEH 1NCDH 4Z7UB 5SWZB 4HCRA 1MEXL 1F58L 5CMAA 5F8QC 3HFML 1CICD 4QHMA 1WVZA 2JB5H 3OL2A 2XXCB 1OAYL 3TV3L 3ULUL 2HKFL 4YDIH 3QPQC 4UNTA 4QHLA 4X5WA 3TIDA 5HYIA 4YUEL 3GBLA 5LKNA 2PO6A 3UTSD 4IRSC 2B39A 1N7MH 1AD9A 4HIXL 2FX7L 2ITDA 3CH8A 3I84A 2Z91B 1IC5H 3V7AG 5DJCB 3TO2A 4PP1D 1FL3B 5KTEH 1I9EA 2VZTA 4F7TA 1FZOB 3FB6B 2LU4A 3CC5A 2Y5TA 4LLQB 1EZVY 4L3ED 5ERWA 1FAIH 4P2YA 2NY5L 3TBSB 5B39A 1X3DA 2IWGA 2DI7A 4WI4A 4LLYA 1NFDF 4PJXF 4DWHA 4XVTH 3C60C 3DBXA 4P4RA 2X4QA 5D1XB 1LEKB 3QPQD 2ENYA 4JG0H 3WS3B 2DKMA 4TSCH 4NQDA 3QRFM 4XPFL 2HFGL 4RMQA 3HZKA 1KTDB 3KYOB 5KSAC 2IQ9L 3VXPB 1F3DJ 1MUJB 2QHLA 3THML 4Z5RA 4P23A 3LZFH 1B0WA 4U31A 5HYJB 2HFEB 2XPGB 4H26A 1RZ7L 3K2MC 3RGVA 4XGZB 2AQ1A 3O81A 4R9HA 4PYGA 3UP1A 1INQB 3Q5TA 3RA7H 1J8HA 1AI1H 1FLRH 2CIKA 4YC2B 4TVSa 3MGTA 4GS7C 4GG8B 1IKFL 4PJFE 1SM3H 4MVBC 3C60D 1K4DB 1T20A 4RX4D 5B8CA 3FRPG 3V0VA 4Y5VC 5FYJL 4XXDA 3BPNB 1SMOA 1F8TL 4R3SA 4Y89A 2DN7A 3KHQA 5HHOA 2P5WD 3UPCA 1M1SA 4OUUA 2ZUSA 1X9QA 3VXRA 2CGRL 5KSAD 2ADFL 1KJVB 3CFJA 3H9ZA 5GGVY 1SBSH 5HHNB 1BX2A 3SDAA 5IBLC 5JHDB 4NWTL 1MAML 3O3AA 1A4KB 3LHPL 3SGEH 1YEFH 2Q8BL 4NPYB 3WO4B 2XWJB 3ULSA 2J8HA 2E6JA 2DBJA 5F8RC 4PY8I 4FZ8H 5CHNB 4LHQB 4YDVB 1FVEA 3NA9H 5CP7A 2E6PA 1N64L 4UDTA 4CU8A 3MRKA 1QFHA 4QRTA 4I4WA 3FOMA 3TBVB 2CRIA 1NGPL 2ITCB 1IAOA 4FQ2L 2V9TA 3SE8L 3TYGH 3QIWB 4Q74A 2DQCL 1FNAA 3MRIA 5IBLD 1VFMA 3VGDA 4PV8A 2YPLA 2OL3A 3SEPA 3DX9B 1QACA 3TA3A 2CLZB 1J1PH 4O2EA 1A7RH 1XCQA 2HG5B 5GRUL 5EIQA 1FNHA 3NIGF 3MODL 1K8IB 1CDUA 3U79A 5E5MB 4HWBH 3JVGC 2DWDA 4DN4L 3RHWK 2BVTA 3TT1H 3RWFB 3VWJA 1N4XL 4Q6IC 2B20A 4QO1A 1A7OL 5B39G 4WTWA 3JZ7A 3WNOA 3IDYB 3DO7B 3U0PB 1IAIM 5E8NA 3IDGA 3D39D 1I1YA 1NL0L 1LO0L 1R3LB 1V8HA 5E7BA 3W5MA 3IDXL 5LGHH 2XN9B 3FB5B 3P0VL 4PR5B 4LQ1A 3T0VA 3DVFA 5MERA 1S7QB 2Y36H 4HPYL 4ZXBB 1PKQE 4JY5H 5IM7B 2NY0B 4K23L 4LSPL 5CZXC 1ZS8A 4W6YB 3DECA 3W0WD 4JFQB 1YYML 5MEND 1NCDL 4HGKC 3RAJH 5C0DB 3MNZB 2PTVA 5FKPA 3T1FB 3D2UB 2DYPB 1QD0A 1SYVB 1ZGLM 4RGOH 2JB5L 2O26U 1P84K 4YPGA 4KUZH 4CDGC 2XG5A 5HVHC 3L5WB 3DWTA 3RWEA 4YDIL 4ELMA 3K3QA 5AG9A 1F6AA 2VO5A 1I85C 3S3SA 4LLMB 2WAHA 2E8ZA 1N7ML 5D7KE 3GBML 2Z8WC 4Q7DA 2F53D 1IC5L 1M7DA 3PP4H 3D1MC 4EI5B 3C5ZC 5F9WB 4CMMB 5CZXD 4QRRA 3C5JB 1V3LA 5DVKA 1FAIL 3QUKB 4YXKH 4PJGA 5I16B 4XVUC 4XVTL 1XGQA 5E2TH 4J2XA 2J8UB 4HUMB 4ONGH 5JMRA 3DMMA 4JKWA 5DVLA 5EO9B 5EUKB 5L6YH 5D5MA 2YD3A 4JVUA 1RZIB 2GK0A 3EDDA 1Q94A 3HE7B 4CL7A 4D0BA 2EC8A 3UDWC 1SJHB 3LZFL 4PJEF 5HGGS 4JZOA 5IIEA 4HIHB 3PQYB 3C5ZD 3RNKB 4I3SH 5EC2B 5CJQH 3BUTA 4G9DB 3RA7L 1FLRL 1AI1L 4OZ4B 1ORSA 4MAYA 2VXTH 5L2KB 3VDAA 3U4AA 1SM3L 4XVUD 3UJJH 1WEJH 3JWNC 4PJIF 3WJLC 5DQJB 3X17A 1PX4A 5ITFB 1WICA 1UVQB 43CAA 2FNBA 3O11A 4U0RC 2WK2A 4LSSH 3ARPA 2RJMA 2YN3A 4Z7OE 3BP5A 1I9JH 3ZKMC 5HGBA 1S7UA 4YDJA 4UMGA 4LLUA 5DUBA 4L8CB 5JW5A 1SBSL 3ARGC 5D7IE 5DTFA 3BKJH 1ZVSB 1EGJA 5GGTA 1BBDH 1E27A 5FO9B 2OTUA 2WBJA 1YEFL 1K2DB 4MWFA 1NSNH 4PRDB 5DJAA 3ARBA 4FZ8L 3BN3B 1QLRA 4IRJC 4RBPH