4P46D

J809.b5 y31a tcr bound to iab3k
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
217
structure length
199
Chain Sequence
FEAQKAKANKAVDHFVYQFMGECYFTNGTQRIRYVTRYIYNREEYVRYDSDVGEHRAVTELGRPDAEYWNSQPEILERTRAELDTVCRHNYEGPETHTSLRRLEQPNVVISLSRTEALNHHNTLVCSVTDFYPAKIKVRWFRNGQEETVGVSSTQLIRNGDWTFQVLVMLEMTPRRGEVYTCHVEHPSLKSPITVEWRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Effect of CDR3 Sequences and Distal V Gene Residues in Regulating TCR-MHC Contacts and Ligand Specificity.
pubmed doi rcsb
molecule keywords H-2 class II histocompatibility antigen, A-B alpha chain
molecule tags Immune system
source organism Mus musculus
total genus 40
structure length 199
sequence length 217
ec nomenclature
pdb deposition date 2014-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00969 MHC_II_beta Class II histocompatibility antigen, beta domain
D PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4p46D02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 4p46D01
3LKQB 5E4IA 2BSED 2XQBL 2Z35B 3H42H 1REIA 2A77L 3BP5B 2EDEA 1KFAH 3C6SB 2Z31B 5D7SH 3NAAH 4JGMA 2Q6WA 1T0NB 2ADGA 3SJVA 4KVNH 2FJHA 5DA4A 2A83A 3TVMA 2X05A 1Q0XL 4EQ3A 4WFHE 1TPXC 3QI9B 5ECJE 1I9EA 3KAAA 3TZVA 1C5CL 4FP8L 1DQDL 1MLCB 4XCFH 5IB4A 4HWBA 3O6LH 1OTTD 5D1QA 2Z8SA 5GS2H 1Y6NR 3ZHDA 3HE6A 5ANMB 4Y2DB 3V0AC 2VIRB 1LEIB 4GAJH 1U8MB 1MLBB 2ZSVA 5A2LH 4PS4H 2G60H 1T2JA 3BPLC 4BSJA 5MENE 4PJAB 1AC6A 4JVWA 5T5FH 1F3JB 5EU7E 2I9TA 4UQ3B 4GSDL 2AKRB 5J1TC 4LKXA 1O7SA 2R9HC 1JRHL 2NLJA 1GH7A 3L6FB 2R2BA 3IKKA 4K94C 5DLMH 3SY0A 3TP4A 4X5WA 1KIQB 1N26A 1PZ5B 2Z92A 1YEDB 4IBLT 1CICA 4Z7OE 3OJVC 4X4MA 3ZL4L 3GHBH 3MNVB 3WEXB 4X99B 4ZAKB 4R4FL 2VABB 1BREA 1UJ3A 4I3GA 4LLUA 5EBGA 4NUJB 1JNLL 1U8PA 4JFDA 2X4RB 3O3DB 3CFKB 5JA8B 2D7QA 1UQSA 1OTTC 3K1DA 3SCMD 3TYFB 3MJ8B 5D2NA 4U31A 2FBJH 4R90H 3VXSB 5J6HB 4R7NB 3FT4A 5I18L 3ILQD 1VFMA 2J88H 4XAKE 4N68A 2YR3A 3ARBA 3GRWH 5DJ8A 5E5RB 3MXVH 2D03L 2K3TA 3W9EA 3SKOB 3U30C 3A6BL 1CFVH 2EKJA 1KACB 3N1PC 2L7UA 4LARL 3D0VA 4N8PA 4NQCE 5DZNA 3ZKSD 5KJRL 4PJGE 1R5IB 4FQQB 1VDGA 3RWCA 3MOAL 1A7OH 2I60L 2XKNB 3OZ9H 3B2VH 5HGBA 5ALBH 5A16A 4HFWA 4MXQD 4MA7L 3IFPB 1QBLH 5C0RH 3ULUH 2FEEI 4PB0H 4PY7A 1H5BB 3DXAB 5ABDE 4N0RA 5E8DH 3LKNB 4O00A 3NTCH 4OZGF 5D70L 4P9MH 5DD0H 4OJFH 4NQUA 4RMTA 4XAWH 2ZUVA 1A1NB 4H26A 5T3XL 1FG2B 3MGTA 1FYTD 1VGEH 3NOIA 3SCMC 4YHIB 4AK1A 4ZOBA 5GGVY 2EE3A 2Y06L 1ED3B 4MJ6A 5HGHA 3VMOA 1F2XK 5DJDB 1GGIH 1IEAA 3FTGA 3IETB 3ILQC 4P57A 5C0IA 1K4CA 5FEBA 1BBDH 5TQ2H 2VDNL 1D5IL 3STBA 2I9LB 4YBQD 1FN4A 3PP4L 4XNZB 1E0OB 3FFCA 1DANU 2VDQL 4RQQA 1GRWA 1DVFB 4YNYB 3SE4A 4WUKH 4FQ1L 4LCWD 4XPBH 3UYOD 3ARFB 5DVLA 4MD4B 3TPKA 5IFAL 2RB8A 4M93C 4OQ1A 4U1SA 2XN9B 5D7IA 5JA9A 3AS2A 3I50H 1P5VA 4HXAH 2R4RH 2WSKA 4H1LA 3CFCL 2EEBA 4HKJB 1I1RA 3GO1L 5F1IB 4ELKB 5IKCB 3VH8G 1EAJA 3IDXL 4AEHH 1QVOA 3CU7A 4WEBH 4JKLA 5HI5D 2CDGA 3CFDB 3L5HA 1H3WM 3OR6A 5ITBH 5L2KD 3C6LA 3DMMD 4PLKD 3UP1A 1XGUB 1KPVA 5C8JA 3FAWA 4M5ZH 1QFWH 4NHUB 1Z5LB 4PJXF 3I6KA 5ESAB 2HKHH 4N0YL 4PP2B 3KLHC 1M1SA 2R0ZL 2XQYK 2DQTL 3GSNL 3EYOA 1JYVA 4GW4A 5LXGH 3C5SA 1A9EA 1SBBA 3IU3A 5D5MB 3G9VA 3W39B 2WWKO 1AGFA 5DUBA 3CFBB 2XI9A 2WINA 4LSQL 1G7LA 5IGXL 4RZCA 1OGAB 1CBVH 3CSBA 3QXDB 2ZCLH 3KPLA 4OCRH 2NR6D 4U7MA 4D0BB 1J05B 4P5MB 3TGXA 2PTTB 5I2IB 3BGAA 3Q6FA 4ZNEA 4HKBA 1HHHA 3L3GA 2PR4L 3MV8B 4RGOL 1T0PB 4HS8L 2HP4A 3WD5L 3MA9H 3QXVA 2BY2A 5IBLD 3DVGA 1GGCL 4I9WD 2ARWA 4HC1L 4OFKA 3DMMC 2H1PL 3KS0J 4JKWA 2IMMA 4XVTL 5DUML 4BSVB 3JWDH 4WUUB 3ZMRA 4QF1B 5K9QI 3MOBL 1BEYH 1KB5A 1IGIH 5JHDE 5CGTA 4HH9A 3WJLC 1GZPA 2Z4QA 3KPNA 4XXCA 5SWZA 3RL2B 2UV3A 4M1GL 4YAQA 5HJ3B 1MI5A 5HGAA 5IFHL 1NCAL 3I2CL 4G8EA 3MV9D 5BJTB 4S10A 5I9QB 3HAEA 4P4KD 2JB5H 2N1KA 5F7YC 3TV3H 4XPAL 3L3HA 1KJ3L 1T5WB 3FQTB 4PTUB 3PIQA 4PP1D 2NR6C 3KXFB 3JTSB 1P9MA 1VEPA 3K8LA 3KPSD 3MLYL 1TETL 1MRDL 4G42B 1XGYH 4U7KA 4U6XA 1WAAA 5IBLC 3WN5B 3OL2A 1FAIL 4CJ0A 12E8H 1KGCD 1MUJB 3LH2L 5JXED 1MEXL 2MWCA 2GFBA 3DX7A 1KJ2L 3ZLQC 4ZQKA 4OZHB 1X7QA 4FNLL 3PWPD 5C71A 1KPRA 1LDPL 1T1XB 4TNWF 3TA3B 4ELMF 2XICA 1H0DB 3V6ZA 3VXMD 5T3ZH 2I27N 2VITA 1FO0L 1R24B 1ZT1B 5KSVA 5ISZD 3CU1A 3QFDA 4PYGA 1XR8A 2C3WA 4LIQH 2Q87A 1DQJB 3D0LB 4ONGL 4JFYA 4OZGE 3VWJD 2V2TA 1NCBL 1KCUL 2PW2A 4XX1G 3N1MC 1NMBH 3QG7L 5I19H 4OI7A 1ACYH 2R69H 3WLBA 3DROB 3SGEI 4LF3A 5IVNA 4PP1C 4UOW0 3TLRA 3OAUL 4YJZL 3P30H 2X1XR 1AFVL 1P6AB 1FZKA 5JIPA 3QHFH 4TTDD 4JDVA 3O4LE 2APVA 3CLFH 5CUSL 5JXEC 4LCCC 3EJJX 1RZFH 5IW1B 3FT3A 1BVLB 3WFCH 3HG1B 4EN3C 4C56E 1X44A 1OT1A 5F7FA 4ZS6D 4CAGA 4NOFA 4HT1H 3MMEB 4P5TD 3B6SA 3B9KB 5EWIH 4KDWA 2F5AH 4LGPB 3EO0B 3SDAD 1A21A 5SX5K 1IGYB 4W6XB 3IXAB 3GIVB 2Z0BA 5FA3B 4XPFH 3UTZB 5BQ7B 3VWJC 4HUMB 2E9IA 2O5ZH 5F7WC 2GTWB 4JM2D 1S5IL 3AAZA 3BAEL 2E27H 3GRWA 4HPYH 4N0UE 2ZOLA 2PW1B 4M7LT 3KYKH 4QRSA 1ZT7A 4U6VL 3P0VL 4TTDC 3OKKA 3H0TA 4RMUA 5GS0D 5D8JL 4PJXE 2DLGA 1N8ZB 2ZOKB 3GSQA 4HJGB 4LEXL 4MWFB 3VGGA 3VXRD 2H8PB 4UMGA 4JPWH 1CE6A 5GS1C 2G75A 3INUH 3QNXB 5E94B 5IOPA 3WUZA 3BDBA 4PRHD 1PFCA 3LKOB 4ODSH 5TE6H 1OWWA 1U93B 2OK0H 4ZS6C 3MC0A 2EC8A 4P5TC 3VFPA 5D1XD 2R4SL 3P4OB 3QQ4A 3OKMA 4KTEL 3SDAC 3PP3K 1KC5L 4R97C 4NC1C 3QNYA 4YDVA 3RY6A 2W9LA 3O2VH 4YDLB 3BUYA 3SCMA 4J3XA 3WNNA 2GQHA 4RNRB 3QUML 4JPIA 4QHUB 2LVEA 4O51A 3F7QA 4BFEA 3QJHA 4JM2C 2MOVA 4ZOEA 1QACA 2APWA 1CL7H 5AZ2L 3QULA 2HAZA 2C5DC 1UYWH 3LQAC 4H20L 1TCMA 3LKRB 1K8IA 5J0BA 5EZIH 1ADQL 1AXSA 3OB8A 4TULH 5C09B 1A1OB 1LP9A 1EEZB 4WY7H 3Q5TA 5GS0C 2DI9A 3HR5B 5F1OB 1KELL 3O9WD 3RTQB 1PX3A 3L3DA 1Q0YL 3OB0H 4QNPF 4ZG1A 1KIRB 3LQZA 2XWTB 1U91B 1NLDH 5FYKL 1P4LB 3FRUA 4ZUUA 3GIZH 3NCJL 3TBSA 2HTKD 2HJLB 3MNWA 5CBEA 4JKPH 3NABH 3HI5H 4KKNA 4S1RH 5GQBA 2UVFA 3D2UB 4E41E 5D1XC 2LFGA 5T1LB 2XTJD 1FYTA 1NGXA 1AY1L 3VXNB 1JTPA 4K8RH 4FQJH 5C6WH 1S3KL 4JAMA 3NIDE 4MGXA 3CD4A 1CXEA 3H7LA 1OAQH 3ARPA 5KN5A 2FZ3A 3KJ4B 4U33A 4WO4D 3O11A 3WBDA 3BT2L 1OVZA 1W0VA 3S96A 1I1CA 5GIRB 4PJEF 1NAMH 2YUWA 1ZA3B 3EFFB 2IH1A 1IGFH 2P5WB 4I2XB 1T04A 4LLDA 2Y07H 4G6ML 1XT5A 4RX4D 3MRPB 2DQFA 4ELME 3MRIB 4Z7UF 1A3LL 4CMHC 4LCWA 1F3DH 1INDH 2AXJA 4FN0A 1U8KB 1PZUB 1K85A 3DHMA 2AJ3B 3O9WC 4ZSOA 1HYSC 3MBXH 3RUGF 3GSWA 1KIUA 1UADC 3FCTA 4XCEB 5HHME 5IIEB 3IAQA 3KHOA 4CRPA 4OBRA 1R5VA 4LFHG 3T4AA 4R0LC 4DCQA 1G9NL 3MRNA 5A3IC 1EHLH 1UM5H 4LU5L 1F2QA 4RFOH 3WIHA 1DN2A 3ZTJH 4G9DA 4O2CA 1J5OH 3ARGB 3UEZA 2FL5B 4WWKB 3QWOB 4NKIL 1YEJL 5L2KA 3DMMA 4FQ2L 2Y1VA 1ERNA 1QTYT 5C6TH 2XTJC 1L9NA 5JPNB 1NEZB 1ZEAL 3BRGC 4WFHD 1A2YA 4U6YB 3HMXL 4JGUA 1OAKH 5FUZL 5C2BL 5BV7B 2IH3B 1CD1B 4WO4C 4Q6IA 2XKUA 3C5ZB 5DEFB 3VA6A 2BRRL 1OSZB 1L7IL 3ME0A 4JZJB 1T89A 1N59B 4YGAB 3DVNA 1LD9B 5CSZB 3P4MB 4WENB 1K5NA 4UTAH 1LO5A 5DJXB 3G5VB 3NN8B 3TIDB 3EBAA 1TQBC 4EVNB 4OLYL 4XBPB 3VFWA 4X9IA 3JWOC 3WV0A 3AUVA 1BBJB 1S7WA 5MEND 3AM8C 1RJYB 1E4XH 4MHHG 4WU7B 3T0VA 5SX4H 2DQHH 2I24N 1AKJB 4G3YH 1FFRA 1S7VB 4BZYA 2A1WH 4P5KB 3LKSB 1YEEL 2X41A 4F57L 4HX1A 2R1XB 4NDMB 1I1AB 5IP4A 1QSEB 4JCMA 4XNXH 1I3RB 5C0DA 3QWRA 4AG4L 1OP9A 1MF2L 3NGBB 4AH2A 2P24A 2V7HB 3RKPA 4BZ2L 4CW1B 5KVEH 2DQDH 2W9DH 4F58L 4F33A 4XZUB 4AZ8A 4LQ1A 1RURL 1KENL 4PRAA 3ZKMD 5DD3L 4EUPA 5DQDL 5EN2A 3MV9A 5ICXA 4G9FE 5GJTL 2A38A 1A7NL 2NXZB 2IADA 4P4KA 5D71L 4XAKD 4M7KL 3UO1H 3PWLB 5DK0B 4G5ZH 2I5YL 4Z95H 5FK9A 3RJDA 1QFUL 1T2QH 3B8SA 5EU7C 4NQCD 5C07E 2AERT 1YQVL 3QFJB 1RY7B 3ZE1F 2E8YA 1CU4L 3KPSA 4HXBH 4YHOL 2OZ4H 3EYSL 1I9RH 1SY6H 3DX6A 3MLWH 1U2CA 2CD0A 4KZEL 4WDIA 5IF0A 3BVNB 3T0WA 5F7EL 5FB8B 3BWUC 3SKMA 2F5BL 3IJYB 1VA9A 3MV01 4MZ3A 2BVQB 3G5XB 3P77A 4M5YH 1FH5H 4OCWL 5I73B 1CVSC 3H3BC 3IF1A 3GBML 1S7QA 2XG5A 1DBML 5AWNL 3CUPB 3ZKMC 3N1GC 3RDTB 4JJHA 4QNPE 4ZFOB 1BPVA 4RSVA 5ISZA 1CGWA 2IPKB 5D6DC 4JGJA 4LVNB 1I9IL 4ZS7L 2VZSA 5MI0C 5IEKA 5TFSH 3X11B 4PY8I 1RVFH 1TTGA 1F45A 3GUTA 3K0WA 1IQWL 5C0CB 4HUVA 5C0AA 4TUJA 2KPNA 4J4PD 3A67L 1NAMB 35C8H 3F62A 1MHEA 2XA8H 5BS0B 1WFUA 1ES0A 4JQXC 4Y5XB 4HWEL 3GKWL 4YK4C 3GSOA 1PG7W 4IM8A 4Z0XB 1TTUA 1FE8H 4MCZB 2MQ3A 1S7UA 4JPKH 3I9GH 4OF5A 4FZEL 4KDTC 1WK0A 4X6DF 2YEZB 5GSVB 5MEOA 2HWZH 4XBEH 3E6FA 3KG5A 4O9HH 4Z7UE 4D9LL 4P5TA 4DKFL 2OL3H 3IKCB 2HJFB 1EK3A 1G7IA 3NFSH 4H88L 4JFXA 4BSWA 4LPXA 4XP9L 4KVCH 4ZO7A 4M62L 3RUGE 3Q6GH 3H7BB 2C7UB 1NL0L 4PRBA 1YN7A 3KLAB 4QXGL 3K2UH 2Z93A 2DOCA 3MGOA 3Q3GB 4JM2A 1IKFH 1E6JH 2RBLA 1AIFA 3MJ7A 4PPTA 2GKIA 1TCRA 1NKOA 4XCYA 1N4XL 3T08A 3PF2A 4PR5B 5DHXB 1A6TB 1KCRH 4WW2A 4YX2L 4YC2B 2FJGB 2JJUA 4J4PC 3SQOH 1YY8A 3KYMA 4H0HB 1JZ4A 4UDTA 1U6AL 4YHLL 1HOCB 2DL9A 1F97A 3VXRA 3O0RH 3F7VB 5F93C 3VGBA 3IDJA 4PREA 3N9GH 3P9LB 3V5DA 4JVUA 5J56B 4HIXL 4PLOB 4DGVL 5KSBA 1UCTA 4PRHA 4WI9A 1I7RA 4LLYB 2IFFH 3DPBA 1EJOH 4UT9H 5KAQG 2XWBB 4WHCA 4YHKH 3GMRA 4OQTH 4RDQG 3MLVL 4LBEA 3KYOA 3RGVA 4MAUL 4X0KB 3VXPB 3ZDYF 5CHNA 4UTBL 1CIUA 3ZE2F 5JHDD 3OG6B 2EXYD 2J1KA 3STZA 1JUFA 3PGDA 1MCEA 1IAOB 3RNKB 4NP4L 1EEYA 5LVEA 3BQUB 4GS7B 4JVPA 4KXZH 1BGXH 2O5XL 5IHUH 3QCTH 5F71A 1U58A 3KPMA 4MX7B 4FQXB 1SJXA 4GRWF 4P2QB 4KZDL 4HWBL 4I18C 1UXSB 5D7LE 1JF1B 1ZOXA 1IGTA 3G5ZB 4H8WC 4XHQA 1KB9J 3MA7B 5C0GB 4POUB 5L2JB 3LS4L 3L7FB 4NM8L 2YKLH 4GT7A 1UXWA 2WUBH 3O9WA 3QIWD 4LVEA 1VFBA 2FD6L 5TQ0H 5JW4M 5KSAB 4XP4L 1CFNA 3S36L 3FL7A 1MVFA 4QOKE 4H25A 3FO0L 1WT5A 3MRJB 3NA9L 2EO9A 3L7EA 1GCFA 1FNGB 4R0LA 5E24E 2B8OT 3O8XB 3TJHC 1I3GL 1YC8A 4M48L 1AP2B 3MRCB 3U6RB 4RAVA 3FONB 5DJ6A 1N5YH 1N0XH 2ZG2A 3O6KH 3ZE1E 5AYUL 2VLLB 3NCEB 2HTLC 3U9PL 2HFGH 4OM1H 4N5UA 4M6NL 1IAIL 2M1KA 4F9PC 4WO4A 5I74C 1CI5A 4DKEL 3SGJC 3VFRB 4QRTB 2FYYA 5J8OA 3OKLA 1ZT4B 1A47A 4JFQA 4LPVA 5I75C 4G6KH 5AYQA 2UZIH 1G6VK 1AXIB 5CEZL 3BXNB 1T22A 1TZIA 1ZLSH 3Q0HA 4RX4A 5DRZA 3KDMA 4JR9H 3VGDA 1X5FA 5L9DL 3AM8A 5JDSA 3QIWC 4JO1H 2WZPD 1S9VB 3O4LD 2WLZA 3CSGA 1F58H 2J5LB 3Q5OA 4P2RE 4MHHI 3QO1B 2Z91A 2IPTL 4QTIH 3LN4A 1NGYB 4G8IB 1KCSH 5GGQL 4HIHA 2CIIA 4C56D 3VCLA 3X3FH 4D0DA 3IJHB 2P43B 4KGJA 1U95A 4M7ZC 1J1XL 3CAFA 2CLRB 5C0BE 5C0FB 1HEZB 1L0YA 1ZANL 1IAKA 4F7CA 2PO6D 2AJVH 4QHLB 1T7VA 2R15A 4RFNB 3GK8H 4KKCD 4Q2ZB 3NFNA 2VDOL 4KK9D 4HPOL 4X6DE 1ZHBA 4LAQL 2YUVA 1P4BL 3RWEB 4ODVH 2Q6WB 4XP5L 4LLVA 4GAYA 4Z76B 1KBGH 2A83B 4N0CC 3TVMB 3KPQA 2UWEF 3P0YH 5E95B 4X6CF 5MP6H 2NW3A 1A5FH 1T0MA 4XC3H 5F89B 2F58H 5JORB 1EHAA 4UOW1 5JR1L 4U1HB 1W8OA 2Y25A 1Q1JL 5FHBL 4MB4A 1HZHH 1G7PA 4XNYL 2I07B 3QEHB 3S34L 1JHKL 4IIQA 2B20A 1PSKH 3WHXA 1Q38A 1NGQL 1UCBL 5HDQL 4IJ3B 3BPNB 2PO6C 3LV3A 1ZLWK 5H8DA 2NLJB 3FB6A 5CJXC 3N0PB 2R2BB 2BY1A 4KKCC 2AJXL 1A3RH 3SY0B 3U82B 1KYOK 1ZGLA 1FGNH 3P40A 5D6DA 4M6OL 2QQNL 1W2KT 3C09B 2CPCA 4D9QE 4HJ0D 2X40A 1JYNA 3TCXA 3ZDYE 4ONOA 2W9EH 4GRMB 2HT3D 5MEQB 2ILLA 4HQQH 2QQKL 1HHIB 2R29L 4NQCA 2VR4A 2X7LB 4LVOC 4PJGA 3O6MH 5EIVA 3SDCD 1TIUA 4WHTB 1DFBH 5A43C 3BPCB 5KW9L 1DBJH 3EYUL 3K4ZA 3WIIH 2QSVA 4N90E 3CK0H 2QHRH 2EIZA 1D6VL 1E6OL 4XHJD 3VGAC 4JQXA 4NPYB 3O2DA 1A6VL 4U1LB 5D2NB 4GRWE 4JN2B 1TLKA 5AUMB 4DEPB 4KI1A 4S1SL 2MCPH 4NNYA 1WC7A 4P3DB 2C9AA 1D7FA 4GMSH 3FO2A 1E27B 4KDTA 4PRDA 3QT2A 2F9BT 1IC4L 4E41D 1CTOA 2JB6A 1Q72L 2A6KA 1RIVH 4FXGA 3IDGA 4CNIA 3NACL 4MXWL 5ID0A 3BH9A 1B0RA 1JCKA 3B9DA 2D7PA 2DTML 3D0VB 2A9MH 3EDJA 2BK8A 3TCLA 4IRSB 4NO3B 3RVWD 1NC2D 4QTHA 1QBBA 1OARH 4M3KB 1NGWB 5BZWA 3RWCB 3V4UL 5FOBB 4TVPH 3WDIA 3TO4C 1TZHA 4LOUD 2IGFL 3STLA 1RUAH 1QRNE 2FB4H 3PWUB 2XIDA 4HJ0C 4GOSA 4XPGH 2C4FT 1KNOA 2QQQA 4JFOB 3QXTA 4PY7B 2HT3C 4ODBD 4OB5H 1C16B 1OLZA 5INDA 5I17A 4XBGB 4MA1C 3SDCC 5JW4Q 1RFDH 4YBHA 4H26B 1K2DA 5E6ZA 4J4PA 4F7TA 4U1GC 1T4KB 1JGUH 3GEWB 4IRJA 5KSUA 4GG6B 4XHJC 5HHMD 1UWEH 3L3OB 3GJFA 1J8HE 1C1EL 2YN3A 1KJVA 5HGHB 3D9AL 2PYFA 2VR9A 4ODUB 1CFSA 5T3XE 2VKXA 4RFEA 1M7DB 3FFCB 5EC1B 4K94H 3H42L 4M61A 1KFAL 2OI9B 1GC1H 1IAIM 5D7SL 3UDWC 1KULA 3OQ3B 3NAAL 4J3WA 4JFHE 1N64L 2OR8A 4KVNL 4LOUC 5D7IB 3IXTA 3REWB 3SPVB 2P1YA 2B2XH 5GHWH 4I8DA 2DMKA 3AXLA 4C54A 4IRZH 4H1LB 4KKAC 2CMRH 4XCFL 1LNUA 3N50A 3O6LL 1MWAH 4J12A 1K6QH 4PD4J 2AEQH 2VDLH 3C6LB 5F6HI 3HI6H 2BMKA 2ICCA 4I4WA 1JPST 4KTDH 1WBXB 2ZUYA 1KPVB 1XF5A 5EZOL 4GAJL 5C8JB 3DV6A 2BSTB 3QWQB 3QG6B 4PS4L 5IM7A 4YHMH 4Y16D 2G60L 2ICWJ 5J1AA 5C9JB 3ZT7A 2ORBH 3V95A 3NPSC 5EA0H 5HVHC 2JK5B 2XYCA 5DLML 4P9HH 5I0ZA 3IU3B 2VLRE 5EDXA 2CLZA 3ZYJA 4JJ5B 3EYFB 5J57B 5DUBB 2YZ1A 2UWEE 2WINB 1AGBA 4PJIF 5DR5H 3BH8A 4X6CE 3GHBL 5EU4A 3EO9H 2WWMD 2BNRB 4F9PA 1PKQB 4PJBF 3R0NA 4C4KO 4G9FD 4BKLB 3SGJA 3THMH 1KPUA 3GFUA 4N8VG 1MHCB 2QHLA 3U48A 5MERA 4IOFC 3SKUD 3TT3H 5FYJU 1S7TB 1BIIA 2FBJL 4R90L 2QSQA 3HPJB 5E8OA 2EDBA 4X7TB 5T1MB 3O2WL 4ZD3H 5C07D 4NGHH 2J88L 3I3EA 3GRWL 1BAFH 1FVEA 3MXVL 3QIWA 4HH9B 3E8UH 5E8EA 2Z4QB 3KPNB 1CFVL 3CH1B 3P11H 5CINH 1FGVH 1U8QA 5I6XC 1XF3B 2XY2A 2B4CH 4TUKL 4J2XA 1A7OL 3BKJL 3BOVA 3HAEB 2VZUA 4BFIA 3AFLA 4F2MA 3B2VL 5ALBL 3SEPA 4NN6B 3LSOA 6CGTA 4CDHA 1QBLL 5C0RL 1H8SA 1EZVY 3ULUL 1D9KB 1JF5A 4PB0L 2EIEA 3D18B 5E8DL 2WWMC 1UZ6F 3NTCL 1NBVH 3IDYC 4P9ML 5DD0L 3HCVA 1HI6B 1JP5A 4I0PC 2DIJA 4OJFL 2X10A 4XAWL 4YPJA 1FNEB 2NY3B 3F5WB 3ESVF 2EEAA 4OZGA 3DUSA 4R8WL 1U36A 1PGRB 3KLDA 5ESQA 5I1DA 1NMCC 4OGYH 3U7YH 1FL3B 2IANB 2D31B 4NO0D 3QB7C 1AC0A 4ZQKB 3HKFA 4L1HA 4Y7MA 1BBDL 4B41A 3EDEA 5TQ2L 3HNVH 3C60D 3O4LA 1T03L 1NEZG 3V6ZB 2QLVB 1TPXB 2WP3O 1S5HB 4EIGB 2FLBT 3MRDB 4WUKL 1I85C 3CCHA 4XPBL 1JFQH 1OD7A 1HQRA 2EH8H 4ODTH 1DBKL 3LKPA 5D7KE 3QIUD 5DQ9B 1RZIB 2H32A 4C56A 1GOHA 3SN6N 3VFSA 4PJHF 2PW2B 3I50L 5DHYA 1CXLA 4HXAL 4CVZA 2R4RL 2VLJE 2K9UA 4LF3B 1OPGH 3FO9A 3VXQB 5DUPH 5DD1H 3BPLB 2Q7YB 4LLQA 1QLFA 3RWFB 4AEHL 4F8QA 5ITBL 1A64A 2PO6A 3RX5A 3GMNB 5I1GL 1WWWX 1KF9B 1F6AB 2ITCA 3FQUA 1IM3A 3I3DA 5I1CH 4DK3A 4M5ZL 1D5ZA 4V2BA 3FT3B 5IMLB 1T1ZB 2HKHL 2H45A 3QUZD 4N0UA 5L0QB 2APXA 4QRPE 5LXGL 3HC0B 1YNLH 2IBGA 3KPRB 4MNQB 4JDTH 1QUNA 3C60C 4XNQB 4PJXA 1PG7L 4NKOA 1DJSA 5AD0A 5J89A 5IB1A 5ESVB 2ICEA 5J11C 4WTZA 1MWAB 4JZNA 1CBVL 4L8DA 3QIUC 2ZCLL 2OS7A 1L4IA 3B3IB 2FX7L 5HDOA 2P8LB 3V2AR 3BI9X 3AAZB 3PUCA 3IB4A 1U8JA 4IDLA 3GMOA 3WIHL 1D5MA 2RJMA 3MA9L 3U30B 2BVOA 2V5RA 4GKNA 5EU6E 1CN4A 3H0TB 4X8JB 1UWXH 5E00A 5GGTH 1JZ6A 3JWDL 1CE6B 1BEYL 1HNFA 2GCYA 1WEJH 1IGIL 4OLXH 1RZKC 3T3PF 1SJVA 2CUMA 3I3BA 2H6PB 3QUZC 1KUMA 2X4UB 5D7LD 4MYWB 3MLTA 1NDMB 1NSNH 3VRLE 4ODXA 4PJIE 4Z7VF 5AG9A 5LQBH 3VFPB 3SDCA 2JB5L 2ZG3A 3OKMB 2HVJA 1RIUH 3BUYB 4PJBE 4IOIB 4OCYH 4WU5B 3SCMB 3QO0B 2O93L 4P4RB 4QOKD 1YDPB 5F7HA 4O51B 1J0IA 3ZDXF 4CJ1A 5CD5C 3AVEA 3T65B 3PWNB 2J8OA 1WLHA 5BW7C 5KVGH 4N0FA 3S3PA 1F90H 3CH8A 3U0PB 5MEPA 1XGYL 3WS3B 4E41A 3W11D 1UB6B 5BO1H 2MKLC 2VLKE 1XF2B 5CZXD 2XACC 12E8L 3NIGF 4EXPX 1HSBA 1QFWI 3UDWA 4AT6B 1LMKA 4KC3B 3K81A 3VI3F 1Q9OA 2ZSWB 5GGRY 4M93B 5EZLB 4PRPE 2ARJB 4EDWH 3PNWA 3WKMH 2W0KA 4L9DA 5T3ZL 2IAMC 5JW4R 3S9DB 3MNWB 3TWCH 4HKXA 3OB0K 3WFEL 4MJ2A 4ELMA 4ZFGH 4LIQL 5DMGD 4N1CA 1I8LC 3IU4H 1UZ6E 4MB3A 3K1KC 5CS7A 5GPRA 2GEEA 4EDXA 5K9OA 4XPHH 1ZXQA 1NMBL 2Q76A 5I19L 1ACYL 2R69L 5FYKE 3P73A 2Y4SA 4IMLA 1UT9A 1BQLH 4NO2B 3UJIL 3P30L 1IRAY 5TH2A 2YPLB 5DQJA 4GBXB 3AGVA 3S96B 2D0GA 3BP7A 5E7FA 3W11C 3HC3H 2NY5C 2AJUH 2IH1B 1J0HA 2XV6B 3ZSSA 1T04B 3PDOA 3RP1A 1NDGA 1IZJA 3DURB 3K2MC 4KKLC 4GUPA 4LCWB 3WFCL 1EVUA 1UB5B 5C0BD 1EXUB 1AD9A 1V3MA 1N2RB 4KJYA 3WUWA 1ZHNA 4PJFB 1XIWB 3EJZD 3QNZB 3FCTB 4HS6B 2XRAH 3BISA 1R5VB 5EWIL 2BOCA 2F5AL 3T4AB 3FMGH 1YMHB 2OSLB 3HI1B 4WFGE 4G9DB 4PJHE 3RGHA 4ZO8A 3MLUH 1XGRA 3ROOB 4XPFL 2AJSH 3DMMB 4URTB 3S8WA 3LD8C 4ETYA 2O5ZL 4MJIE 1FNAA 4HWNA 2EDNA 3FQWA 5FKAB 2E27L 1MAMH 3ROLB 4XWOD 3TO2A 2NY1D 4XX1E 4HPYL 1J0ZA 2WAHA 3U79A 3QEQE 4Y16A 1JZ5A 5SWQB 3KYKL 3BP4B 3D39B 3V5HB 5HGDA 3FQXB 4HV8A 4J1UA 1LO5B 4LCUA 4JPWL 3ARDD 1TNNA 3INUL 3UTSE 3LOWA 3BJLA 3VFWB 5ITFA 1S7WB 5ICZA 3QDHA 4BZ1H 1BZQK 2OK0L 4QO1A 5DMIH 4FQPA 2K1MA 3EJZC 3MRMA 4MJ5B 2WANA 3S4SA 4G9FA 4W4OA 3K8MA 4IMKA 4OGXH 1URLA 4L4JA 1QQDA 1NCTA 3O2VL 4D9QD 1P7QD 3VG9C 3H3KA 4JREC 1UKSA 4CUCA 1JN6A 2YC1A 2P5EB 4FTVB 4HUUA 5DURB 1KTLB 3DWTA 2J8UF 1CL7L 1HHKB 2AXGA 2FGWH 2VDMH 4JN1L 3WIFA 1UYWL 4LP4A 3V5KB 2NY1C 4POYA 3OJDA 1WFOA 3TJEH 2UY6A 5KS9F 1S9YB 1MJJA 2D7TH 4TULL 4GKZA 4Q97A 4PRAB 4KK5D 5D4QA 3QEGL 4WY7L 5EUKA 3MV9B 5FDWB 5ICXB 3TBVA 3ARDC 3S88H 3MBEB 3JWNC 1WBZA 1ONQB 1LO2L 2BDNH 1MJ8H 4AQOA 5B8CA 3X12B 4Z7VE 5FK9B 4DUXA 1NLDL 5E56A 2NNAA 1TJHH 3MLRH 4JKPL 3MLSH 3NABL 2CDEA 3HI5L 1IJ9A 1PBYA 1RJZA 3SOBH 2GJZA 4PIRF 3QXAA 1XGTB 4NQEE 1W0WA 2M26A 3ZDXE 2PETA 1P7KA 1BJ1H 3HZMA 4I48A 1QRND 1PQZA 3UPRA 4K8RL 2VC2H 4FQJL 3FT2B 1FZOB 3EGSA 5DJAA 4LCCB 2ENYA 3H9HB 1OAQL 1N5AB 5B39A 4NO0A 4G43B 4JO2H 4FRWA 1L0XA 3TPUB 4EN3B 3NIGE 1CGUA 2KL6A 3PWPB 2E6PA 5CBAA 1CXFA 4IOSD 5EBLB 3C60A 5EU5B 1C5BH 1IGFL 3VXMB 2E9JA 3IVKA 2Y07L 4KK5C 1J8HD 3GB7B 1M71A 1INDL 3GI8H 3JWOH 5F72S 4PJEA 5B3NA 4MDJA 3QIUA 1OP3H 5SWSE 3VWJB 1DQLL 5T3XD 1G7MB 4MVBC 1CR9L 4Z7UA 1FQ9C 5ADOH 1OW0C 2QJDA 4JZOB 3UBXB 1EHLL 4TPRL 1UM5L 4RFOL 1LWRA 5HYFA 5M7QA 3RUGA 4YR6A 5IQ9B 1GZQA 4AQ1B 1J5OL 4PGEA 4QRQA 4R4BA 4LSSH 3UPAA 3PV6A 2GJJA 3GMQA 4HK3J 4Z18A 5C6TL 5DSCA 3L5WB 1YEFH 2OX5A 2DAVA 2O26U 2LAGB 5E6IB 5GS1B 4LHUB 1BF2A 1OAKL 1UH3A 3VFMA 3QUZA 1S7UB 5FV1L 4L4TB 5C3TA 1OAYH 3I6GB 2L0DA 3W9DB 1IQDB 4UTAL 4HD9A 2DM4A 4P5TB 3OXRB 4ZDHA 3FB8A 4JFXB 4ZTPH 4RMSA 3SDAB 2QQLL 4LDOB 4R97B 2YZ8A 2KQNA 4DN3H 3DETC 3FB5A 2RHEA 1U3HD 3MV11 5DD6B 1X3DA 1E4XL 4JRXB 1KEGH 2DQHL 3A6OA 4JM2B 1A8JH 5FYJH 5BW7A 4WWID 4PJAF 5F7LB 1AIFB 3MJ7B 4KGLA 2VLRD 3OF6D 4QHMB 2A1WL 4BM7A 5IEHA 4XCYB 1MFNA 1I8IA 1BFSA 4NUGH 4MNGE 2N56A 4TQEH 4OAWB 1CFTA 2DIBA 3VXRB 4R9HA 4DOHE 3B2UD 5DJ2A 2DQDL 5IBTH 2W9DL 2PNDA 3GNML 1YMMB 2DJ4A 3F58L 5D7LA 2HLAB 3CPLA 2AV7A 4JFFE 2D7MA 1A4KB 3BEVA 3RWHA 3KVQA 5AAMA 4O2EA 3EOTH 1AGEB 1K3ZA 2ZUQC 5D1XB 4OFYD 3UO1L 3GGWA 1IGCH 1WISA 1JZ3A 4G5ZL 2SEBA 2RR3A 4Z95L 2Y5EA 3STZB 4C83A 1S7SA 4Y19B 1T2QL 3RI5K 4AMKH 1U3HC 4QOKA 3I75A 4KFZC 4HEPG 5EO1B 3IDMA 4L3AA 3KPMB 4K23H 5C70A 5EUOB 4OM0H 3RAJH 1MRFH 4HXBL 1HIMH 3WYRA 3BUTA 2OZ4L 1N3NA 4OLUH 1SY6L 1MCJA 4MLSA 2WLYA 3MLWL 3G6JB 1CGXA 3MNZA 1WF5A 4JLRB 1FLRL 2J8UE 4PTTB 5D2LB 3S5LA 5EPMB 3RVVC 3MJ9H 1YUHB 1RV6X 1AO7A 1ZK9A 4ODWA 4XCCH 5I8EB 1NANH 2DD8H 3GI9H 4M5YL 4NIKB 2FSEA 3FN3A 1UXWB 3O9WB 3D3VE 1FH5L 3B2UC 1AGCB 3KNBA 1JIBA 1JV5B 3TBTB 1BZ7B 1G7HA 2DBJA 2BVPA 3VRJB 4M1CD 4H25B 1AQDB 1T6WA 4R0LB 2AABH 3EOYG 4JCLA 1NUFA 3D85A 1U8IA 4OUUB 1ORQB 3U2SB 4RAVB 3F12B 4U1JA 2CRIA 4UU9B 2XTJB 4PG2C 3VWKD 5DTFA 5TFSL 3FQRA 5D1ZD 1RVFL 3ELAT 2GK0A 4P2RA 4S2SB 5L6YH 4R3SB 3O3AA 3L3JB 1DUYB 1OTSD 5I8OH 1TENA 2JJTA 5D7KD 3L3IB 3KR3H 3VXUE 2HRPH 5I76B 3HRZB 35C8L 1BFOA 2CDFA 2XA8L 3B9VA 4NQXB 4U1NB 1RJLB 4N8CH 3ZE0F 3DBXA 1ROWA 3LN5B 4H1LG 4L3CB 4OIAA 1TQBB 2VLJD 4FFYH 5K9KB 4KQ3L 1FE8L 1WZMA 5C0BA 4EIZC 4OIIH 4JPKL 3I9GL 4DN4H 4K7PY 5CZVH 4PB9H 2HWZL 4XBEL 1YEKH 5A1AA 2OL3L 1VGKA 4DZ8B 4M1CC 3NFSL 5KVDH 2X6MA 5CEZE 1BHGA 3O6FD 1WSST 1RJCA 2XTLA 4KVCL 4X6DA 2C3VA 2D3VA 3Q6GL 2BCKA 3VFOA 4G8GE 4JY6A 4JFZH 1G9MH 5HVFB 1ZS8A 1FDLH 4QRPD 5F1NB 3K2UL 3VCLB 3ARSA 4E0RB 1DUZA 4TUOA 5J13B 2PCPA 3VWKC 5BRZB 3V0VA 4X6FA 1IKFL 5JLZB 1E6JL 5D1ZC 15C8H 3B9AA 3TH3T 5DHVA 4X6BA 5J6GA 5KTEH 3BZEA 1IAKB 5FA4A 4HULB 1OTSC 4HBQA 1JGDA 3MUY1 5D5MF 3SQOL 3GHEH 4Y5YC 1BF8A 3TN0A 3O0RL 4BFBD 4NRYA 3ARDA 2DYPD 3N9GL 1CDYA 4YE4H 4MJ4A 2ZUWA 1AHWB 1ZMYA 1A6ZB 1LE5B 5CIPH 4CDGC 3DGGA 4HJJH 1E4JA 1RK1A 4UT9L 1EJOL 2XG4A 4MXVF 4YPGB 5MENB 4G7YH 1FV1B 2VISA 4LLVB 5DEGB 4OD2B 4YHKL 1FCCA 5EU6D 4OQTL 1WIOA 1GAFH 1VKXB 1BD2E 5ANME 2X4QA 2N7AA 2WBJC 5IBUG 3JUYA 1MCBA 4XVSL 2OCFD 3O6FC 1I3UA 5IESH 8CGTA 2DDQH 1P7QA 4PJAE 1NJ9B 5IHUL 1BGXL 1JHTB 4RMWA 5E2TH 3VFTA 1CQYA 1G7PB 2FO1A 4KRLB 3LEXA 3HAEG 4CVUA 4HWUA 5FF6A 2XPGA 1MCKA 1RUMH 3WHXB 5ACZB 2RGSA 4CN6A 1A7PH 5I1KH 1CG9B 2ZJSH 5DS8B 5CCKH 4GRLD 2N4IA 3MUGA 4ZYKA 2VN4A 2YKLL 3CMOH 2WUBL 2XZCH 2OP4H 5TQ0L 2NYYD 4GMTH 3BWAA 5MI0B 3TFKC 1S9WB 2VLKD 3PWJB 2ADJB 2HT2D 4M43H 3P4NB 3ZSTA 2EXWD 2V17H 3MRFA 1HHGA 3P2TA 1WIPA 1A0QH 3FRPA 5BVPH 3JTTB 5I71C 1N5YL 1N0XL 1QRNA 2EIZB 4N1EA 3O6KL 4HLZG 4PRPD 4UOJA 4HIEB 4NBXB 4OZHF 2BC4A 1M05B 2HFGL 4OM1L 5IVXB 3OPZH 4KDVA 4NKDA 4PJCF 1FSKC 1WC7B 5GRXG 3ULUF 1BLNB 4PRDB 4Q7DA 3MRGA 5DMKB 3NBNA 5CILH 3IDGB 3O4OC 4G6KL 2UZIL 3ULSA 5E2VH 1ZLSL 1CT8A 1QSVA 5FYKD 1J8HA 3DXAE 4QTHB 5BZWB 4E5XA 3HR6A 2OXGA 4F7PA 3C5JB 2O61B 2YN5A 3U4AA 3OMZA 2IQ9H 4K9EL 4JO1L 1TVBA 1F58L 5EOQH 1X5JA 2HT2C 3BZFB 1NUGA 2QR0B 3N1QC 4HK3N 2FNBA 4QTIL 5TDPB 4ZUSA 3QXWA 1JMXA 5I17B 2PYEB 1KCSL 4ZPTB 5E7BA 5IHZA 3HZVB 2APTA 3Q1SH 5CEYA 2GSIA 2IQAA 1GSMA 1TVDA 5SWZE 3X3FL 2E6JA 1XZ0B 5FO8B 2BNUB 3OV6A 4MD0A 5GSRB 5CKAA 4J3VA 2CJUH 2HKFH 2P49B 1N6QH 1KJVB 1CLYH 1ZGLM 3VE0B 1MIMH 3GJEA 5E5MB 5H94A 2R39A 2RQ8A 4WFGD 2AXFB 2EYSA 1HQ4A 4L8SC 3ZE0E 2AJVL 3OG4B 4GQ9H 4HGWA 2I26N 1KLGA 4GW5A 4MJID 3RIAF 3T3MF 1QR1A 5IR1B 5K33A 1AD0B 4M61B 3RHWK 4JG1H 1WJ3A 2H3NB 3QEQD 4QGYA 5HHOB 1KBGL 4MSWA 3PHOB 3TNMB 5EC2B 3T0EB 2OMBA 2EDKA 5MP6L 4Y4KD 1A5FL 4XC3L 5FM4A 1U92A 2F58L 1KJMA 3OF6A 2A6DB 1NCCH 4HIIA 4I18B 1VB9A 3UTSD 5JUEL 2DM3A 2UWEA 5DVMA 3SGKA 4X6CA 1JWUA 5DK2A 3QAZC 3VG0H 1QP1A 2OQJB 2JCCB 5ILTH 1FVCB 1WZ1H 5D5ME 5I1IH 5CIPB 1CFQA 1WFNA 2YPKA 2BY3A 3KJ6H 3SE9H 4WRLA 4X4XA 2H9GA 4CVXA 1OF2A 5BCAA 2ED7A 2X4NA 5SX5H 2BERA 3FB7A 2FO4A 4YXKH 4Z6AT 1A3RL 4MXVE 5AZEH 3PQYB 1LK2B 1FGNL 32C2A 3MV7A 4WFEE 3T09A 4HS3B 4F7EA 4OFYA 2V2WA 4YXLH 5JHDB 4HH8A 1AGBB 5EIQA 5DMYA 1G9NC 1S8DB 4UAOB 1PY9A 2W9EL 4HQQL 2VXQH 4QYOA 5JOFA 3DI3B 2YPVH 4HIJB 4HC1A 2QV2A 2VZOA 3DV4A 3O6ML 3DX8B 4Y4KC 1MAJA 4HDIB 3NCMA 1DFBL 1DBJL 3WIIL 5MERB 4YDIH 4KRPC 1VADB 3CK0L 5ALCH 3VFNB 5I75B 3VFUB 2QHRL 5E2WH 2BP3A 2CR3A 1JNNH 4J3TA 5DRXB 4XWGL 4GG8B 1SEBA 2G9HB 2E7BA 1KCVH 5EULV 4MDIA 2MCPL 2BXZA 1OHQA 4LK4A 4YO0A 3I85A 5CP7B 3FOLA 4P2OC 3X14A 3P4LA 2FHCA 3ALPA 4NQED 5EOCH 1QOKA 4QRRD 3VH8B 1QSFE 2A9ML 3MLXL 3F7PC 3PL6D 4LMQI 5ACLA 1AI1H 43C9A 1OARL 1XR9A 4U1KB 4TVPL 1ZA6A 1SQ2N 1DEEB 3KXFE 4LNRA 4S1QH 5HHXH 4TTGA 4F2MB 1OAUL 1KEML 2CUHA 4EI5C 1RUAL 2FB4L 3VWKA 4XPGL 4Z7QF 5D1ZA 3DUUA 1HKLL 4RA0C 4M7ZB 4OB5L 4EJ1C 1EAPA 3MRQA 3CDYA 1RFDL 2DLIA 3KYNB 4OZHE 3MRLB 1KJ2A 2V9TA 5SWSD 1XF4B 4BK5A 1JGUL 1I1YA 4MAYD 3LRSB 4PLNC 4PJCE 2VERN 4UT6L 5ESQB 1MAKA 3ULUE 2DN7A 3KWWA 1G6RH 2A6JA 2VLJA 1FO0A 4PLJD 3U4EA 1VPOL 2GJ6E 3AMKA 1FZJB 4K3EH 2AQ1A 2DJSA 2GT9B 4F3FA 4LLWB 4K94L 4P0DA 1S9KC 5E70A 5FHAL 3O6FA 3PL6C 3VD3A 1GC1L 3EZJB 1JPSH 1SBSH 2W91A 2QADD 4F8TA 5JTWA 3BX7C 3QSKB 1HQRB 3OKOB 4PGDA 2FEDC 2RFXA 4HBCH 2B2XL 5GHWL 2LU7A 4M4RA 4B7IA 4NZRH 1T66D 4CVZB 4IRZL 5DC9B 4NRXB 2CMRL 1MWAL 3PJSA 1RI8A 4OLZH 1K6QL 2AI0H 2AEQL 1JTOA 3HG1E 3OKEA 4KKBD 2VDLL 5HHPA 1N0LA 3HI6L 4MAYC 4NWUH 1S9XA 2FIKA 1IILE 3DYOA 4YUEH 3FQUB 3DOSA 4HUWB 3C9NB 1G7QA 2WNGA 3FFDB 2EKSB 1I7UA 2XXCB 1FVDA 1ZHKA 2FHFA 1TNMA 3T3ME 2DJUA 4PLJC 1FNSH 1AR1D 3MREB 2ORBL 3MRRA 5EU6A 4HCRH 1D6EA 4YFLF 4Q74A 4UBDD 4PJXB 2G2RA 4P9HL 1I7TA 4M6AA 5EBMB 3BIAX 3L5JA 5GGRA 4HEME 1J12A 4ORGB 3BGMA 5DR5L 1TQCB 2QADC 4LHJB 3VGAB 3EO9L 3OAYK 4NQSA 4O02H 4EUPG 5C0EA 1UA6H 4JFFD 1IKNC 4RMRA 4PJIA 2ICWB 2J6EA 4HKZB 4MD5B 5F3HB 3QDME 3TT3L 3MRBA 2ATKA 4MMZC 2UY7A 4PJBA 1CD9B 4KKBC 2W65B 5HPMA 3SDDB 4X8XA 1ZHLA 4GRLA 4ZD3L 2DM7A 4YHNB 3CDGB 5GRVK 4NGHL 3UZQA 2DQGH 1CLCA 4O2FA 4L4VE 3S36X 3TO4B 4MNHB 3E8UL 3HS0A 1R3HB 2CK0L 4JHBA 1UWXK 5ETUB 3P11L 5CINL 4PJ8C 1FGVL 2VLKA 1FAKT 4FXKA 1OOAA 1AR1C 4QEGA 1NAKH 3CFJA 1MREL 3ZHLA 3SJVD 5LWYH 4IEFB 3IAPA 2B4CL 3RL1B 3QP3A 2P46B 4UBDC 5T33H 3QUMA 3T0XA 1CDCA 2COQA 4MA1B 3SDCB 1JTTA 3NFPB 4Y1AB 1OP5K 5ICYA 2HVJB 4FQIH 3D3VD 3QIBC 1D5BB 5J12C 1CYGA 1UWGH 2YXMA 4PRPA 1E4KC 2CGRH 4KHXH 1E4WH 2VMFA 1YECH 1NBVL 4Z7WB 1NUNB 5C09E 2EECA 1ADQA 1Y18A 3ZKQD 4N0FB 1EUUA 1MFBH 1Q94B 1ORSB 4L8SA 2XWJA 3P9MA 1S7RA 5IMKB 4ZXBD 4E41B 1JGEB 1XCTB 5HI4D 2AVGA 3PGFH 5DDHB 3R8BB 4U0RC 4UQ2A 5IW6B 2C1PB 4OGYL 1KXVC 4YDJA 3U7YL 3QUKA 3UC0H 1NC2B 1EHNA 1ITCA 5SV3A 2X9WA 6FABH 1GHFH 3L5XH 1VSCA 3HNVL 3TF7C 2YBRB 1LE9B 3BFOA 3PNWB 2O5YH 5F70A 3VXUD 1UZ8A 3V52H 3RWJB 4JHAH 3DVIA 3MRKA 3U46A 1WVZA 1JFQL 4TRPH 2EH8L 4Z7QE 4ODTL 1RMFH 4EQ2A 4X9FA 1IT9H 1NC4D 4IHOA 3T4YB 1B0GB 3N85H 3TZVC 3IAGC 3M1BA 4PBVC 1GOFA 3WLWC 1G6RB 3IJSA 1F3RB 5T3ZE 4X7SH 5K59F 1DE4A 1OPGL 3RU8H 5CEZD 3UJJH 2RCSH 5DUPL 5DD1L 3OBAA 3EYVA 5TH2B 2X70A 3HE6C 5JNYA 1W0YT 1ZVSB 4G8GD 4PJHA 2B1AH 4LIQE 3ARBD 3AS0A 4ZXBC 3NPSB 5HVHB 4U1IA 2WW8A 3UXFA 5IJVA 4FMKA 3T2OA 1INQA 4MJIA 2IALA 2NZIA 2A6IA 5I1CL 4PJ7B 1QA9B 1NDGB 1RZKH 3NZHH 2X4SB 4GUPB 1GGYA 5D7JD 2M2DA 1FFNB 3UAJD 1AD9B 3ZDZF 1YNLL 3WUWB 2DKMA 4JDTL 3GM0A 3S97C 1IEBA 1CICC 1MPAH 3U9UB 3NZ8B 4G80B 4Y4KA 4KJPD 4KUZH 3GDBA 4WEUD 1NEUA 4JRYE 3UTSA 2HT4C 3HMXA 4LKCA 3LMJL 2EC9U 3OR7A 3WO3B 1NMAH 1A6UH 4Y89A 1TJIH 4HUKB 5E6YA 4U7SA 2XNAA 5FO7B 3MCG1 1BD2D 3LVEA 5T5NF 4M9OA 3DRQA 3UPCA 3WFDH 2E9BA 2NY7H 1A9BB 3ARBC 1T20A 5JW3H 4J1UB 3WFHA 2GAZB 5DJZA 4NYLA 4WV1C 4LEOA 1HH9B 4OLXL 4RWHA 5DGQA 4GKSB 4WW1A 2DLEA 1CDHA 1RUQH 5ITFB 5F1KC 2ATPB 1KN4H 3MYJA 5D7JC 3LRGA 5C0AE 4DGIH 4NBYB 2NY4D 1A7BA 1NSNL 3CVIL 3UAJC 4NN7B 2YSSA 3BHBB 2HMID 4LRNH 4I0PB 3DX9A 3DO7B 3GBLA 5LBSH 4KJWD 3S4SB 5LQBL 4WNQA 5BOPA 2YD4A 4G9FB 1IL1A 4NSKA 3BW9B 3MRHB 1LO4H 3UTTE 1I8MA 1QQDB 2GY5A 2V5TA 4NQDB 4L8CB 3GMMB 1RIUL 3ORJA 4OCYL 3C8KB 4Z7VA 3R1GH 1CXKA 4R4ND 1XCQA 4UDUA 1TITA 4HUUB 5HYSB 5KVGL 3O3BA 5C07B 1F90L 3KHQA 2W0PA 1JL8A 5CP3H 1PYWA 4IDJH 3I84A 1I3VA 5BO1L 4AIZA 4DVBB 5DRWA 3R0MA 4NQEA 2XOTA 1TFHA 1MJJB 2Y72A 2CR6A 3GZKA 3PL6A 4OIBA 1HE7A 2EH7H 2I25N 2AGJH 3X13B 3PHQB 3QFJE 2R1YB 1P69B 1J0JA 3SE4C 3BEWB 2P7TA 4EDWL 1UGNA 1I4FB 3HHRB 4AENA 3WKML 2DTSA 4GAFB 1JNHA 1EGJH 2NY4C 2NNAB 4HWZA 3UROR 2D7OA 5IB2A 4M8QA 3TWCL 3DXAD 4PJ9B 4ZUVB 1V7MH 4KJWC 5EZJB 4POZD 4BQ8A 3OXSB 25C8H 1C7TA 3MROA 3O3EA 3IU4L 1T1WA 2GJZB 3QXAB 5IMMA 3H3PH 3MYZA 5SWSA 4MAYA 4XPHL 4I48B 1LDSA 2GW5A 1ETZA 1RHHB 5DJAB 3FQNA 1BQLL 4R4NC 4D8PA 1YNTA 4UIMA 2ZNWA 3BP6B 2AJYL 4KU1A 4YIQB 5CBAB 3HUJB 5HTSA 1P5UA 3HC3L 2X4PA 2B0SH 2AJUL 5B38A 4X6EB 3CVHA 5SWZD 5CD3A 3IVKB 2YWZA 5C0JA 4H0IA 3O3UN 4JY4A 1FFOB 4OV5B 4K3JH 1MHHB 1DVFD 1M71B 5J11B 4RISL 4NFCA 2NTFA 4UUJB 4A6YH 3FHAA 8FABA 5C0CE 3PV7A 3QIUB 3KPPA 4WJ5B 3ARFD 1MHPH 1HILB 2HVKA 2XRAL 4ENED 3NPZB 2JJVA 2BNQB 4ETQA 1HHJB 3MCKA 3FMGL 1QFHA 1OP3K 5GJSH 5KG9A 5A2IH 2UYLA 4QY8A 4U1MA 4POZC 5JW5A 2V2XB 2AJSL 5K59E 4OT1H 4OZFA 5E8PB 3JV0A 3MR9A 1ZTXH 2EDFA 4HK0A 1QLEH 3OJ2C 3TBYA 5HI3D 2X89D 1BM3H 1FP5A 4KK6D 1FPTH 1FFQA 2VAAA 1X5IA 1V3KA 4XP1H 1U8LB 5E2UH 5IG7B 4MNGA 3U1SH 4XCNB 4H5SB 2XXMB 3GMLA 3ULVF 1YN6A 1KCLA 3ZDZE 3MUZ1 3ISWA 4JQIH 2DL2A 4Z5RA 1FRGH 3WHE0 4AIXA 4CADB 1NFIB 4C57C 1OGTA 4OZIB 1C5CH 3FB5B 4BZ1L 1DN0A 2HFFB 3ARFC 1QNZH 4HHAA 5DMIL 5GS2D 1OY3B 4JFFA 4MCYA 1L9MA 4L29B 4DGYH 4ENEC 5HY9B 2YA2A 4OGXL 3WO4C 5IEHB 1OAZH 3ARVA 1Z2KA 3HLAB 4QXTA 3RI5F 2NW2A 3ECBB 4OV6F 4QT5A 3UBXI 3P3YA 2ZPKH 4EZMA 5CFHA 2OJZH 2FGWL 2VDML 1LO0H 3TNNA 3PXHA 5HI3C 1EEQA 4KV5F 4JANA 5F3BA 3BD3A 1I9JH 4LVHC 3CXHJ 5E2JA 1WFTA 2D7TL 2AV7B 3D1MC 2IAMB 2J8UA 1A1MB 1FIGH 4G7VH 5CSGA 1M4KA 5D72H 1VENA 4Y8DC 1YYLH 2FEEL 3RWHB 4O2EB 3S88L 1ND0B 1ZSDB 5KS9A 1MFAH 3V7AE 2BDNL 3ES6A 3D3VA 3G04A 1KTDA 1D5XA 1O0VA 4C83B 2BVEA 3BPOC 1S7SB 1TJHL 4JE4B 1QSFD 3MLRL 1KT2B 4NZDA 2MHAB 3MLSL 3MLZH 2XFXA 3KXFD 1N3NB 4LNVA 1ZLWH 1P6FA 4OKVA 2MPAH 4ZXBA 5I8CA 1NGZA 4QCIA 2EE2A 3G08B 5EFIA 3MNZB 2VC2L 2YS4A 4W68A 5JQHC 4JB9L 2DKUA 3U36B 5JO5B 2IEPA 1UVQA 4JO2L 3CC5A 4ODWB 1DSFH 5IWLA 1KB9K 4P3CH 4U6HA 5HD8D 5CMAA 3KNBB 1J18A 1C5BL 4ZFFA 1RK0A 4KAQH 3VXUA 2OJEA 2DWEA 4DTGH 1R3JA 5DYOA 3ULUD 3T0DA 2GITA 3SO3B 1Q9KA 2DLFH 3MUHL 3WSQH 3GI8L 3JWOL 5FKPA 4GG6F 1BZ9A 5L7XL 1NC4A 3LDBC 3CZFA 3LD8B 3WKNA 2GJ6D 1RULH 4P23B 4PG9B 4J8RA 1F4WH 5CEXB 4R26H 3FQRB 1WCQA 5HHVH 5ADOL 1LHZA 1ACZA 4XVUD 4ZUTA 2EDRA 3RWGA 3ILPB 4LDLB 5I1JH 4G8GA 5JMOC 4LSSL 2GIYA 5ID1A 4YFEA 3H9SA 1YEFL 1BFOB 1D5IH 4WV1A 3DIFA 1QR4A 4XTRD 3DBXB 2R2EA 1BMGA 3WN5C 2Z35A 5D7IF 1CK0H 4A6YB 3BP5A 4V2CB 3EHBD 5D7JA 5C0BB 1PG7X 2MQ0A 4AEIH 1OAYL 5HD8C 4P46B 3RPIA 3HG1D 1T0NA 5IFAH 1MCOH 1F6LL 3R06B 4ZTPL 3ULUC 3QI9A 3B9KD 4X6DB 2W59A 2BCKB 1DEDA 4JY6B 4DN3L 1FFPB 3KPOB 3LS5H 3VG9B 1MLCA 4JREB 2VNCA 1IFHH 4UNUA 1M6OB 1CE1H 4FFZH 1KEGL 2PCPB 1QKZH 5FYJL 3RY6C 3S35X 1BD2A 5ANMA 2A74A 2NY1B 2OTWB 2ZKHH 4XVUC 1LEIA 2VIRA 1E28B 3BESR 1U8MA 1MLBA 5HHNB 3IDIB 5FA4B 4NUGL 4YDKH 1J9CT 4N0YH 4QHKJ 4PJAA 1HH6B 4TQEL 2DQTH 1F3JA 1KYOJ 2AKRA 3ABZA 2FWOB 4XTRC 1JNJA 4PJ5B 1JWMB 3L6FA 3PHSA 3ESUF 4FABL 1LEKB 2EE9A 3UZEA 4KQ4H 1T7ZA 2W07A 5IBTL 3LZFH 1KIQA 4RRPG 1PZ5A 3EHBC 2OTPA 5I16B 3QDMD 1YEDA 1MH5B 4MXQC 3MNVA 3WEXA 1RZGB 1UFUA 4X99A 3L3KB 2VABA 4NZTH 4AL8H 3NA4A 1IGCL 1LK3H 4L4VD 4I3SH 1EO7A 2PR4H 2X4RA 3O3DA 4HS8H 4RGOH 4Q9RH 4AMKL 3TYFA 1IARB 3D69B 5J4MA 3ZT5A 3DRTB 3VD7A 4OM0L 3RAJL 1T5XA 1MRFL 3VXSA 1HIML 5FF6B 3IGAA 4XVTH 4OLUL 2FJFA 4DZBA 2FRGP 5JMRA 2BSRB 1HNGA 3X3GH 2B5IB 3SKOA 3JV5A 1TVHB 4NZUH 1J86A 3UTQB 3QDGB 1QLRA 3VFVB 4O58L 1T7YA 1H15B 4KV5E 3MUGB 4YBQC 5C09D 5T1KD 4XCCL 5GGSY 2YA1A 5EO0B 3I2CH 1Q9LB 1R5IA 1XGQB 2DD8L 3GI9L 4DFHA 1SYVB 3JBG7 2XKNA 5DRNB 2ESVB 1A14H 3CX2A 3RTQD 1DP0A 2AABL 5IQ7L 5IV2B 5HYIA 1H5BA 3DXAA 1CDBA 1YEHH 1HHGB 4Q9QH 4ZFZB 5DF0A 1ZLUK 5K9JH 4PGBB 1A1NA 1QRNB 1FG2A 4XNMA 3WFBH 2Q3ZA 5T1LD 5HI5C 3W5NA 4OFIA 2W60B 4YHIA 2Y5TB 1O7VA 4PLKC 5L6YL 3QWRD 1ED3A 1MEXH 5I8OL 3JWDC 5DJDA 5E4EC 4Z8FH 3IETA 3KR3L 2HRPL 2X4TB 3ARUA 4Q6IC 2I9LA 4N8CL 4LPWA 4J6RH 4LCYB 5T3ZD 1T89C 5AEAA 4FFYL 3UYPA 1DVFA 4NO5A 1Z6JT 4YNYA 2X9XA 3CX5K 4E5XB 2EYTA 4E42A 4F7PB 1U8OA 3O41A 4DN4L 5CZVL 4PB9L 3ARFA 5DJCB 4XH2B 1EVTC 1TVBB 1YEKL 5IHBA 3M45A 1FCGA 4GG6E 4JO3H 3RHWF 5C86A 2XT1B 4ZUSB 1JE6A 5ERWB 4YXHH 4JFZL 1G9ML 3MO1B 4LPCA 4HKJA 5F1IA 3QCUH 4ELKA 5IHZB 1FDLL 5IKCA 4HG4J 5CEYB 2GSIB 2IQAB 4R96B 1ZGLP 3ARGD 4JPVH 4CVWA 3CFDA 2FX9H 4WWKD 4XP6H 4NOBA 15C8L 3NCFB 5EU3B 2AP2A 4WTZG 5KTEL 4OF8A 2X89A 4JRYD 3GJEB 4NHUA 1Z5LA 5ESAA 4PP2A 4O4YH 1JPFB 4X9HA 2F8XC 5HYJB 3GHEL 5E8NB 1NCNA 5IB3A 1KLGB 3HNSH 4PRNA 3G5YB 2ZUQB 5FYLH 5JDJA 3BD5A 4P2YA 5EIIB 5AAWA 1IEHA 4YE4L 1NANI 5D5MA 3M07A 4HJJL 4YGVA 3CFBA 1RD6A 1RZ7H 4MSWB 4P4KC 2GY7B 1U3HB 1RAMA 3QXDA 5GRWA 5J3HD 1GAFL 1VACB 4BQCA 2VZ1A 1J05A 4P5MA 1U92B 2PTTA 2VLRB 5I2IA 1AKJD 3DTXA 2DDQL 3MCLH 5C0AD 1TZGH 1TXKA 4X6CB 1JWUB 2BX5A 2FECI 5DVNA 1B4RA 3GSNB 1A7QL 4Y88A 4PRIE 2VQ1B 5E2TL 4OFDA 4WWKC 43CAA 4BH7A 4BSVA 1M7IB 4IS6B 5A2JH 5DFWH 4X9GA 2E7HA 1H9VA 3EO1A 4QLRA 3UTTD 3WNKA 5BV7H 5JQ6H 1A7PL 2NY0D 5I1KL 2X4NB 2ZJSL 5CCKL 4JDZB 4JZJC 2BNRE 1PKQE 3CMOL 5BJTA 2XZCL 2OP4L 4GMTL 2NXZD 4PGCB 1MFCH 1RZ8B 5CWSB 2BVTA 5I1LB 4M43L 5FAAA 2CKNA 1T5WA 4FS0A 3W82A 2GTZA 1QSFA 2PKDA 4PTUA 4GW1B 5J3HC 2JIXB 4HGMA 1T1YB 3KXFA 2APBA 2C1OB 3JTSA 4QRUB 3QFJD 2GSGB 1A0QL 1MFEH 2R0LH 2BSSB 4R2GD 3VRIB 4G42A 4D94A 4K3GA 2DWDB 2Q8AH 5KVFH 2IBZY 2CRMA 4OGZA 5DFTA 3WN5A 3OPZL 3S7GA 2J6EL 1RZJH 2X1OA 3NGBC 4UB0H 2VSCA 4ISVB 3ZKND 1EMTL 4OZHA 3QXUA 5CILL 4N9OB 4LCIH 3E6HB 3SHSA 2NY0C 4PJCA 3F8UB 5E2VL 3S37H 1H0DA 2LE9A 3VD5A 43C9B 3QH3A 1R24A 3B4NA 5FM5M 3RGVD 5GRYA 2AV1A 2AAVA 1ZT1A 2IQ9L 3CFEB 5TPWH 4PFEA 2BRQA 3L1OH 2GJ6A 3DSNA 3VXTB 3VWKB 1DQJA 3D0LA 4KJQD 5EOQL 1CF8H 5D1ZB 5C9KA 5A2KH 4K8RD 2IPUG 3W0WE 4TVPE 5A40E 3WUWG 2DI7A 1KJ2B 4AJ0A 5FIEA 3Q1SL 3CDFA 1BJ8A 3QEUB 4Y5YB 2YMXH 3GSUB 4R2GC 1WTLA 2ZP0T 2E5EA 3KWWB 4WW2C 1JPGB 2CJUL 1N6QL 2CIKB 1CLYL 3C8DA 1SYSB 1I7ZB 4PJFF 1MIML 4UV7H 4NM4H 2VO5A 5IW1A 5KANG 2EDQA 1Z9SA 3EKCA 1MCLA 3ZKNC 4GQ9L 5J9PB 3HG1A 1BFVH 4N8VB 1HK6A 3TC9A 2F53B 3K46A 2X1PA 5I73C 1LILA 2WBJB 1P53A 5D6CA 3MMEA 3O6FB 5DT1H 3B9KA 1G1CA 2IWGA 4JG1L 1SJHB 3EO0A 1G9NH 1MCSA 3RGVC 1IGYA 4NT6B 3IXAA 1W72H 4QRPB 3GIVA 5BVJA 2HJKB 5FA3A 2CKBH 1RIHH 2WUCH 3UTZA 3GBNH 4KJQC 1IAMA 1GOGA 4LVNC 5BQ7A 1B4JL 2AK4B 2GTWA 5F44A 3HMWL 1NCCL 3GSXB 1J10A 2NX5E 1LQSR 5FUZH 1A3QA 3QA3B 3QUYD 1RUKL 3VG0L 1S9XB 3KPRE 4MNQE 3S4SG 2VE6A 2DYPB 3T77B 4MWFA 2ZOKA 4HJGA 5ILTL 3V6FB 2H8PA 5I1IL 2FHBA 1FVDB 1ZHKB 5HGGS 3HZYA 3QNXA 5E94A 3DYMA 3KJ6L 4JY5H 3QDMA 2M8XA 1D6EB 4KY1H 5F6IC 3H2WA 2CUIA 5HYSG 4YXKL 1U93A 5AZEL 5KVMC 5JIHA 1DDHB 1WT5C 4L4VA 5GGRB 4YXLL 3JV6B 2HTKC 1P84K 3MFFB 2NXYB 3P4OA 2C4XA 1HSAA 1I1FB 1YEEH 2VUYA 4QKXB 4OFVA 2VXQL 2YPVL 2ITDB 5HHQA 1R3IH 3BQUD 4RNRA 5KOMC 1FSKB 1FYHB 3O45B 3QPXH 3IDUA 3IT8D 1FHGA 3VGEA 4YDIL 4FQXD 5ALCL 3O4OB 1JNNL 2ZCHH 2ATKB 3LKRA 4ACPA 1JK8B 4F58H 5HPMB 3L9RB 3QDJB 5F9DC 3QUYC 1KCVL 4YC2C 5C09A 1A1OA 1A4JB 5T1KA 3JV4A 1LVEA 1QEWB 4ONFH 1EFXB 3HR5A 3VA2C 7FABH 1A7NH 1FL5A 3WHE1 4M7KH 3RTQA 5AG8A 5F88B 4TYUA 2YK1H 4ONHB 5KSAD 4AYFA 3TM6A 1SJEB 3OAZK 2XWTA 1U91A 1AI1L 4YHPB 3ZYZA 5HHXL 4S1QL 1XH3B 2HJLA 5DJ0B 3O8XD 2DMBA 3JUZA 4YHOH 3EYSH 5F21B 5TF0A 2GYSA 3QCVH 2HH0H 4RIRA 5T1LA 4LPTA 4MQSB 3VXNA 4KZEH 1NFDB 4DW2H 1F13A 4YHZL 4GS7C 4LQFH 4Y8AA 1CGTA 3B43A 3NCCB 4U3CA 5B4MD 1QPPA 1YA5A 2F74B 2F5BH 2XWJB 3P9MB 4L8SB 1S7RB 2XZQH 1BOGA 3VJ6A 5GIRA 1VFAA 4TSBH 4UQ2B 1G6RL 1ZA3A 3EFFA 1CGSH 5TDOB 2P5WA 1X9QA 3LN9A 2ICWI 4I2XA 1VEOA 2R0KH 1OB1B 3MRPA 3MRIA 2X9YA 1MRCH 1YJDH 4K3EL 1U8KA 4X5LA 1AJ7H 4N9GB 2AJ3A 1F3DJ 1UZ8B 5FGSA 5FCSH 5KSAC 2ZCKL 5IIEA 4XCEA 4NJAH 1DANT 4OSUH 5HVGB 1CTNA 1ZV5A 1SBSL 3UYRH 3K74B 3L95A 5EO9A 1J1OH 3PXJA 5HPOA 2YPLE 5DJYB 3RIFK 1KLUB 2A73A 4UINL 3E1F1 3ALWA 3ARGA 3JXAA 2FL5A 3T0BA 4HBCL 4WWKA 3NCYP 3QWOA 4NZRL 5GRJH 4K07A 5JPNA 1NEZA 5H37H 4U6YA 4JRYA 4OLZL 4EEEA 1ZAGA 2AI0L 2IH3A 3MUJA 3C5ZA 5DEFA 4IIQC 4NC2B 4NWUL 4PJFE 4YUEL 4JZJA 4KPHH 1INQB 4S0TD 1LD9A 5CSZA 3P4MA 1MFDH 5DJXA 2LQRA 3G5VA 3NN8A 4JFEE 3TIDA 4EKXA 3GSVB 3QEQB 3VI4F 1FNSL 4XBPA 1W72B 3D25B 4HCRL 2J4WH 1BBJA 3CVHL 2CKBB 4M6MH 1IEBB 5DK3A 3RQ3A 4K71C 1RJYA 5F9WC 3BKCH 1ZVYA 4QXGH 4Y4KB 1GXEA 3F6IA 1W8NA 2B7DT 4CU8A 3PWVB 1WV7T 4KRPB 1AKJA 1HXYB 1S7VA 4LKCB 2A9NL 1MIEH 4P5KA 3LKSA 4GXVH 3FOMA 4NWTL 3D39E 4O02L 2Q8BL 1FZMB 2R1XA 1F11B 4HW6A 4NDMA 3IDNB 4CBPA 4IRJD 1U41A 4P2OB 3C87A 4CW1A 3UTTA 4PJEE 1KIPB 4L5FH 1MVUA 2R1WA 4XMKH 5EBWB 4DGVH 4XZUA 2BOBB 5F7DA 4GKOA 5DJZB 4NYLB 4PUBH 5ADPH 2DQGL 4EI5B 2BY0A 1BECA 3B5GA 3FN0H 2AS5M 3MYJB 3PWLA 3S5LG 4JM4H 5DK0A 3BO8B 3ZYOA 5EUOF 1NAKL 5LWYL 1MQKH 4KROD 3OKDB 5T33L 3DX9B 4WNQB 5E1HB 5CGMA 2P5EE 3G6JF 3BGFB 4FTVE 5D2LF 3QFJA 4FQIL 2DM2A 1UWGL 1HN1A 4KZDH 2CGRL 4KHXL 3B83A 2DF3A 3ULVH 1E4WL 1YECL 1NQBA 5C1MB 3EOBB 3SE8H 1MCIA 3BVNA 1YPZB 4IRJC 1MFBL 1V3LA 5FB8A 2FR4B 5EH1A 3HPLB 1HWHB 2VDRH 3G6DH 1QO3B 5EOTA 2DKSA 1HCFX 1MCNA 2BVQA 2ED8A 3G5XA 3PGFL 5DRWB 5LAXB 3K8KA 4ZPVA 5KANI 1DQQA 3LHPL 3QQ3A 4PJDF 4PV9B 4QRRB 1P2CA 3TBWA 3UC0L 3S36H 4IJ3C 3FO0H 3T1WA 3BPNC 4YHYC 2AJZA 4IRSD 3CUPA 3RDTA 4MLIA 4FQHB 1GHFL 3L5XL 1BX2B 4M48H 2O5YL 2IPKA 1EFQA 2CK2A 3V52L 4JHAL 1JNHB 1OM3H 4BQ6A 1JVKA 5TF1L 3X11A 4RMQA 4KROC 1DL7H 4TRPL 3U9PH 1RMFL 3MROB 4K7PL 1IT9L 3HE7D 2VL5B 3N85L 5C0CA 5IMMB 4WGWB 4MAYB 3BDYH 2MCG1 1NAMA 3K80A 5HVWA 3VXME 4X7SL 3RU8L 1X5KA 3UJJL 2J7LA 2RCSL 1OL0A 1K8DB 4Y5XA 1HINH 2UVEA 1JZ7A 5I1AB 1EIBA 2B1AL 2EDTA 3SDYH 4L9LC 1JGLH 4Z0XA 4MCZA 2P8PB 3HZKB 2LU3A 3BKMH 2YEZA 3QUXB 5GSVA 4LASH 4EI6B 5C0JB 2WBKA 1HDMB 1RZKL 2Y36H 3W2DL 3NZHL 1CDGA 2HJFA 2QADB 4IRSC 5FXCH 2W0FB 3H7BA 2C7UA 5E1AB 2HN7B 2V7NA 2R8SH 1UACH 3KLAA 5GGQH 4K3DH 1MPAL 4Y2OA 2EXYC 4ETQB 1C08B 3MCKB 3Q3GA 4KUZL 1UJTA 1JZ2A 1C5DA 5MHSE 1AO7E 5C08E 3WDJA 1G7JB 3I02B 5JW5B 3MLPA 3PABA 3HE7C 5F9OH 2B1HH 4L4TE 4PR5A 1A6TA 5M94B 5INCB 3QUYA 1A6UL 2CLVB 2FJGA 1TJIL 4QHNB 3MR9B 4D0CA 3NCBB 4HK0B 1HOCA 3F7VA 3BRDA 3WFDL 4L8BB 3P9LA 1YNKH 4PJ8B 2NY7L 4LAQH 1V05A 4NC1E 1L6ZA 1NBZB 3RWDA 5CJ5A 2JJWA 4Y4HB 1FIEA 4LLYA 1T3FB 5JW3L 1MELA 3UCRA 4FG6D 4PRID 1U0QA 4K9EC 1CZ8H 4X4YB 3UJTH 4JRXE 3VI4E 4DAGL 5BZDA 4X0KA 3VXPA 2DQJH 3H9ZA 4CN4A 4MA8H 4Z5RB 3RNQA 1RUQL 3QIBB 1KN4L 4NNXB 4DGIL 4F37K 2EDHA 1IAOA 1R5WB 3RNKA 4LRNL 3BQUA 4Z78A 2VB5A 1Q1JH 3LPWA 2KQMA 5FHBH 2BNRD 2DBLH 4NJ9H 1LO4L 1OQXA 4LSPH 1WGOA 4FQXA 4H1LH 1JHKH 2GUOB 4DKDC 1YMME 1KLFA 3R1GL 1ZWIB 4U0RB 1JF1A 5EG6C 1AGDB 2D7NA 1WBYB 4QT5B 1JZ8A 3AU1A 4K2UH 3G5ZA 3MA7A 5C0GA 2NY6B 5L2JA 4IDJL 3FRPG 2AJXH 3L7FA 2C3HA 4JANB 2F54E 2VXSH 2IMNA 4GAGH 4M6OH 5KSAA 1D3CA 2ADGB 2J8UB 1SEQH 4Y19E 3SJVB 2FJHB 4XNUH 2AGJL 4U6TA 2QQKH 4WI6A 5EUOE 3O8XA 3TZVB 3G04B 2OZ4A 1AP2A 3BSZH 5IB4B 3DYPA 2VXVH 1SY6A 3MRCA 5IVXF 1EGJL 3G6JE 3CJJA 5D1QB 1T7XA 5D2LE 1D9KD 1D6VH 3T2PA 1A6VH 2DMCA 2VXUH 1V7ML 3HE6B 4NZJA 1FJ1A 25C8L 5CAYB 1O5DT 4OKVB 4ZXBB 1QFPA 3H3PL 4QCIB 2ZSVB 3FN9A 1BWWA 4QRTA 2NY3D 5E9DE 1ZT4A 4MXWH 2I9TB 5GRZA 4LKXB 3BXNA 2BJMH 3DSFH 4PJDE 4U6HB 1G1YA 3W0WD 1V7NH 3E0GA 4TVPD 5CGYD 1KB5H 4X5WB 4KK9C 5CMAB 2Z92B 2B0SL 3JVGA 3U4BL 5FUOH 1RK0B 1KN2H 3MJGX 1CICB 2OJEB 2XTJE 4XXDA 1EUTA 1S9VA 1R3JB 5DYOB 1IGJA 4K3JL 2CXGA 3ZE2E 1CLOH 1UJ3B 2BHZA 4A6YL 4LLUB 3QO1A 1YYMH 1U8PB 3HAEH 1MHPL 1NGYA 4JFDB 4XMLL 1JPTL 3VMNA 2AXHA 5E08H 1UQSB 2DICA 1WZLA 2E6QA 4ZUTB 5TE7H 3IJHA 1U8NA 5GJSL 3FT4B 4BH8A 2P45B 4B5EA 5E5UB 3QJFA 1HEZA 2YD6A 5C0FA 4OT1L 3ARBB 5DJ8B 5ID1B 3W9EB 2WQ8A 2J8HA 1DQTA 1GPOH 5F96H 1ZTXL 2NY3C 4WV1B 4QHLA 2QTEA 3C2AL 1QLEL 4NKMA 2OL3A 4HGKC 3K3QA 4Q2ZA 1J1PH 1BM3L 3EFDH 3UTPE 5D7JB 1WWAX 5IB5A 1FPTL 2JE8A 2NX5D 4XP1L 3OJMB 3RWEA 5CGYC 5E2UL 5TDNA 2FDBP 3RPIB 3U1SL 5HGBB 5A16B 4HFWB 1N64H 4Z76A 4ZOAA 5BRZE 2W1NA 5GGSA 3KPRD 4MNQD 2Y6SD 4HLZH 4JQIL 4RAUA 1FRGL 5F89A 4MZ2A 5JORA 3E2HC 3WS6C 4ZTOH 2H26A 1FORH 1QNZL 2JCCF 3DUHA 4U1HA 4LAJH 3MGTB 4XT1C 4DGYL 1NCWH 1BD2B 2A74B 2I07A 3QEHA 5EZOH 1OAZL 3RZCD 4MJ6B 2JJSC 1IEAB 3FTGB 4X5XA 5C0IB 2IF7A 4P57B 1BQHA 2NTSP 1C12A 1K4CB 4K7FA 2DQEH 1FN4B 4OQTA 2ZPKL 5FYJE 2OJZL 4RQQB 1LO0L 5GZOD 3RVWC 4LL9A 1X4YA 1I9JL 1GC1C 2GK2A 2NY4B 3OSKA 1FIGL 4G7VL 3VFGH 5L0QC 4U1SB 5D72L 4GRMA 1YYLL 5MEQA 5L8LB 1EEUA 1HHIA 5LKNA 5CSBA 2X7LA 2Y6SC 1MFAL 4MA3A 2QSCH 1QBAA 2PTVA 3QZWA 2YUZA 4WHTA 1T83C 1L7TH 3BPCA 2FATH 1QVOB 5IVZA 5D93B 3CFIC 2CDGB 3OR6B 1GGBH 4NPYA 4U1LA 4JO4H 4JN2A 1T5XB 2BHUA 5AUMA 3MLZL 3IGAB 2FJFB 4L9LA 3O2WH 4DZBB 2MPAL 4P3DA 1E27A 3RZCC 3I6KB 3OGCA 5F7MC 5T5FL 3WXVH 1PX4A 1A22B 3FO1A 3EYOB 4RCAA 4GW4B 1QLRB 3C5SB 1A9EB 4LSTH 2QL1A 1DSFL 3T2QA 4IRSA 4NO3A 4TUKH 4P3CL 1SVCP 4GH7B 2IJ0C 1NGWA 4P9HC 5FOBA 2C3XA 2KBGA 3BKJH 5GZOC 1AGFB 3A6CH 4KAQL 1G7LB 4RZCB 4DTGL 3PWUA 5L88H 3KPLB 4JFOA 1V8HA 3T8XA 2DLFL 3WSQL 3OHXA 2D4FA 3AROA 5IVXE 3Q6FB 1C16A 3BKYH 4X80H 3HE7A 4HKBB 4XBGA 1HHHB 3L3GB 1RULL 3ARYA 1F4WL 4R26L 1RQ5A 3AB0B 4XNMB 5HHVL 3S3SA 3DVGB 4KHTH 3KS0H 1T4KA 4OUOA 5T1DH 4R8WH 4GG6A 4WI2A 3L3OA 1QHPA 5I1JL 3MV7E 5E99H 2F8OA 3KLHD 1R3LA 3SGDI 1KB5B 2YPLD 4GBXD 5IBUB 4ODUA 4Y16C 3MZTA 1GZPB 2XQYG 4M02A 5SWZB 2ZUTA 4YAQB 1M7DA 3EIFA 1MI5B 2EDYA 4UIKH 3R8QA 1T03H 5EC1A 5HGAB 1JRHI 1RSFA 1FC1A 3Q2CA 1CK0L 2ZG1A 4NO5B 4G8EB 2B4CC 1MCFA 2EYTB 4E42B 4AEIL 1U8OB 2PYEE 3O41B 3OZ9L 5IFJA 1BFTA 3VW3H 3CLEH 3L3HB 1DBKH 1MCOL 1XIWD 4M9PA 3REWA 3SPVA 4PV8A 3WO4B 3PIQB 3REVA 4HF5H 3PG2A 2C26A 4JFED 3LS5L 1INEH 3C2SA 1IFHL 4KUCF 4W4OC 2E3VA 1CE1L 4FFZL 4IMKC 1Q9WA 1QKZL 4U6XB 3VDCA 1VGEL 2XKSA 5I1GH 2X42A 1FBIH 2ZKHL 3BE1H 1WBXA 5DZOA 3V0WH 2BSTA 2GFBB 3QG6A 3DX7B 4LVHB 1GGIL 4YDKL 4AY0A 4LRIA 1X7QB 1P7HL 5C9JA 1FC2D 4GBXC 5HHOE 1KPRB 3D39D 3T0EE 5IB3B 4PRIA 4PRNB 1K4DA 4OGAD 2P44B 4M7JH 2EDWA 4DWHA 2VITB 4OLWH 2JK5A 1DR9A 1PG7H 5F8QC 4KQ4L 5BOZG 1IM9D 3LZFL 4JJ5A 3EYFA 4YGVB 5KSVB 1F00I 3BPOB 1PY4A 3QFDB 2G5RA 1XR8B 1NFKA 5M95B 2CH8A 5DA0B 4JFYB 2VDKH 2V2TB 5B8CC 2VZVA 1XIWC 2F19H 4NZTL 4AL8L 2BNRA 2FX7H 1PKQA 1LK3L 3MOQA 3WLBB 5IUSA 2JCCE 2VZTA 4I3SL 4BKLA 4D2NA 3DTXB 3WIHH 4YZFF 1MHCA 4DVRH 4Q9RL 4NNPH 1FZKB 1KOAA 4WEBL 1WIUA 3S35H 4JDVB 3RRQA 5TGBA 1S7TA 4G6FB 3TH2T 1RHFA 3MGAA 43CAB 3HPJA 4BH7B 5T1MA 3PQYE 2P5ED 3FAXA 4FTVD 4ORZC 4X7TA 5DURD 1QFWL 1JHLH 3EO1B 2HG5A 3X3GL 4NZUL 3CH1A 3D6GA 1XF3A 4Z0BH 3B6SB 4OGAC 3OAYH 4KMLB 3LDBB 4YBLC 5KZCD 4Z7WF 3S6CA 1A14L 4RGNE 3MBED 1A6PA 5F1SA 2HFTA 3P9WB 2GTZB 1QSFB 1D9KA 4OCRL 3TIEA 3D18A 1YEHL 4B0MM 3RA7H 1HI6A 4I0CC 4Q9QL 1EO8H 1DBBH 5K9JL 4I5BA 1FNEA 2ZOLB 3NIDF 3WFBL 2GHWB 3H9YA 3F5WA 4QRSB 1ZT7B 4MQ7A 5J7CC 3OKKB 5E03A 4P49A 3GSQB 1FL3A 1J11A 1GIGH 2IANA 1X5ZA 2D31A 3G6AA 3W0WA 3X17A 2DB8A 2G75B 4Z8FL 4U49A 4EN3D 5IOPB 5CLTA 2KUTA 2QBWA 4PJCB 4J6RL 1OP5H 1S5HA 5LGJA 3QH3B 4EUPH 3MRDA 1J0YA 3WS6A 2AV1B 4NCDA 2ED9A 3WFEH 5FGCB 3TV3L 3QQ4B 4FHBD 2GJ6B 5DQ9A 3MBEC 3QNYB 1RZIA 4YDVB 4JO3L 2ZUXA 3QPQD 4JPIB 4YXHL 2JJSA 1Z9OA 3QJHB 2DLHA 3VXQA 1CVRA 3UJIH 3QCUL 5DVOA 2PF6A 2Q7YA 3QULB 4PJ7F 3RWFA 4UZGA 4NRZA 4JPVL 2FX9L 1K8IB 4XP6L 3GMNA 3VU2A 1H3PH 4PBWD 1AXSB 1F6AA 1LP9B 3UZVB 5E6ID 3PDDA 4LHUD 2OYPA 5MHSD 1AO7D 4LSRH 5C08D 5IMLA 2NX5A 1T1ZA 1U42A 1U3JA 3OTTA 4OTXH 4O4YL 3RKDD 4L4TD 3L3DB 3HC0A 3HNSL 1J0KA 3LQZB 1FG9C 5FYLL 3KPRA 4MNQA 5D6CB 3U0WH 1JI1A 5ENWA 4XNQA 3FRUB 4ZUUB 3TBSB 4QXUH 3IYLW 1T83A 5CBEB 5H2BA 3D85D 5ESVA 3FJTA 1RZ7L 1MWAA 1T21A 5BVJB 9CGTA 1FYTB 1NGXB 2Y7QA 3B3IA 4JRXD 4G6JH 2P8LA 3HB3D 4JAMB 3QPQC 2OMNA 4P2RD 3RZCA 5KN5B 2FZ3B 1KXTB 5E0QA 3MCLL 3O11B 1XMWA 1TZGL 1W0VB 3QHFL 5F9JA 2D9QB 2VN7A 5FM5O 3CLFL 4X8JA 2VE6B 5CZXC 5DO2D 4LLDB 5C2UB 1MCPH 1RZFL 5E6IC 2DQFB 3HZYB 5BV7L 5JQ6L 1JGVH 3QDMB 3HC4H 2EDXA 3MZGB 4DUVA 2H6PA 1YMMD 4U4BA 3RKDC 4S11A 2X4UA 4ZSOB 1NDMA 4M7LH