4P4KA

Structural basis of chronic beryllium disease: bridging the gap between allergic hypersensitivity and auto immunity
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
178
structure length
178
Chain Sequence
KADHVSTYAAFVQTHRPTGEFMFEFDEDEMFYVDLDKKETVWHLEEFGQAFSFEAQGGLANIAILNNNLNTLIQRSNHTQATNDPPEVTVFPKEPVELGQPNTLICHIDKFFPPVLNVTWLCNGELVTEGVAESLFLPRTDYSFHKFHYLTFVPSAEDFYDCRVEHWGLDQPLLKHWE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of chronic beryllium disease: linking allergic hypersensitivity and autoimmunity.
pubmed doi rcsb
molecule keywords HLA class II histocompatibility antigen, DP alpha 1 chain
molecule tags Immune system
source organism Homo sapiens
total genus 32
structure length 178
sequence length 178
chains with identical sequence E
ec nomenclature
pdb deposition date 2014-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00993 MHC_II_alpha Class II histocompatibility antigen, alpha domain
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4p4kA02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 4p4kA01
3MJ6A 1N5AB 3LPGA 3BKJH 4R96A 5DFTA 4KMTL 4OM0L 2DAVA 3QXDA 2XKNA 2OCFD 2ED8A 2XICA 1M4KA 4L4TD 3N1FC 1AE6H 1E4WL 1UCTA 1MF2H 2F53A 2OXGA 4KRPD 4NO2A 5B38B 1C16A 3RDTD 2YMXL 1W0WB 3JZ7A 5F7EL 5C0EA 4JO3H 4Y1AD 3HE7C 4G6MH 4JG0H 2OJZL 4HWEH 3ZKQD 5IB4B 1A3RH 5D7IA 4HK0A 4JANA 1S9KC 1JHLL 4OFYA 3DURB 4UOW1 3GMQA 4PJHA 3WXWH 1XIWA 5CSGA 3DXAD 2A6IA 1RQ5A 1SY6A 4LGRB 1JP5A 5BV7C 2G5BA 1OB1B 1RIHL 1YYMH 3QB7C 4JFQA 2R56L 5I15H 3O3EA 4XCNA 4XHJD 5C9KA 2JB6B 3RNQA 3BZ4A 4XPTH 4WFHD 4O2FA 2AVGA 5EU4A 3C6SA 4JZJC 3TH2T 3CLEH 2BRRL 3O2DA 4PJIB 4LSQL 1CGVA 1N26A 3PP4H 2X7LB 3P73A 4UIMB 3SHSA 2FLBT 5D7KD 2HJLB 3MFFB 1EDQA 4PJGB 3ARRA 3OB0K 1JN6B 3MV8A 4GKZB 5JW3L 2ZUUA 2VXSH 1T7WA 1MLCA 3TCLA 1J0HA 4NNPL 1HEZA 4IHOB 5FHAH 3QEGH 1FYTE 1VEOA 2X4TA 1YEJH 3PP3K 4D9QD 3VGHA 3UPRB 4GMTH 1B4JL 3OJDB 4HV8B 4CNIB 5I1KL 1A3RL 3CSYA 4WW2A 2E7LA 5HDBE 1I9EA 2YPLA 3WIFB 4Y89A 1AXIB 3GJFH 3HS0A 5EO1A 5EIIA 1D6VH 1DVFD 4JE4B 4PB9L 3W5MA 1CGUA 4CKVX 1FNLA 1JRHH 4P3WA 1QRNA 2APTA 1MY5A 1FNEA 2YD7A 3CLEL 4MWFB 1RVFL 2ZNWA 3KPTA 1J7VR 4PP2B 4M4RA 1LO2L 3RVUC 1ZA3A 4JLRA 1HHKB 2D9QB 4LEOB 5F7FA 2K9UA 4DVRL 1SQ2N 3RY6C 4JO2H 1AHWC 2BCKB 3CCHA 5BXFB 1NFDB 4P2OB 3O6KL 1FDLH 5EIQA 4OBSA 4F9LA 2F53D 3HZMA 3QEGL 4GAJL 3QG6A 3HKFA 3LV3A 2NX5A 5LKNA 1EHNA 4DGVL 3CAFA 3RWJB 3QNXB 4R2GD 2J6EH 3BAEH 3MNVA 5E8DH 4U1GC 4CVZA 3GSNA 4OFYD 3IAPA 5FGSA 1L7IH 1IAKB 3MRPB 3REWB 5I66B 1EHLH 1XIWD 5D1XB 3L5XH 4OD2A 4WEBH 5MEPA 1D6VL 1Q9KA 2CQVA 2Y9RT 3FFDA 4NZUH 3U7WL 4QRUA 4XPFH 4ODTH 1EAJA 4TUKH 3JV4A 4R90L 2ARJA 3QXAA 2YD8A 4OIIH 4KKCD 1TPXC 4UTBL 4IRJC 3QUZB 4WI7A 4JKWA 4Y19E 4DW2H 4A2LA 4HJJH 4F7CA 2K7QA 3U9UA 4UQ3A 4YFLF 5DHYA 2B0SH 2P7TA 3MV8D 4L8SA 1FFNB 5AAMA 3GK8L 1WTLA 2O61A 2DMBA 1IL1A 1JI2A 2ZCLL 3GNML 4NQTA 1SJEA 3MODL 2J6EL 3WFCL 2VDKL 3CFKB 3DECA 4G8EA 2P5ED 3IF1B 5EZJB 1S5HB 4WIQA 4KH2A 4PTUB 3SDYH 1FRGL 4FMFA 1S7QA 1L7IL 4FTVB 5DRZA 4K3EH 2YPLD 1IAIH 1UM5H 5HD8C 4QRRB 4WEBL 1U3ZA 1LILA 5F71A 3UDWA 1FIEA 1G7LB 2DIJA 5FYLH 3A6BL 3QPXH 2VDNH 4MD4B 2W65B 1E6OL 1WVZA 4NQCA 3VFGH 1QRND 3AREC 4XWGL 1NBYA 1N4XL 5A3IC 1OARH 2AV7B 2ZCHH 5IHLB 1XH3A 2RR3A 5KW9H 4WFFD 5L7XH 3LEXA 1RPQA 5MENE 3FQXA 4PJDF 5DJCB 1RUQH 3P4NB 2Z8RA 5IJKA 5GRYA 2APFA 3SKJH 3TNNB 1L7TL 1H5BB 5TE7L 5INDB 3IXAA 4PJAF 3QZWG 4EN3A 2I26N 2I07A 5DQ9A 1A7OL 4Z0XA 5CD3A 1CQYA 4IIQB 4O51A 1IGIH 2XNAA 3P2TA 2NX5D 3VWJA 4G8IA 3MXVH 3QEQE 2X10A 4KKAD 1WZMA 4OZ4A 1PAMA 3HNVH 3WJLC 4S0TD 5JUEH 3SDYL 1V5JA 1MRCH 4FQHA 1LEKA 2ENYA 2IFFL 2EDXA 1MPAL 4PJ9B 5DD6B 2ESVB 2DIAA 3RQ3A 3SGKC 3DYMA 5DMGC 3T04D 1NC4A 5ICXA 1X4ZA 3MRQB 4OZGF 1VGEL 2YHGA 2OR8A 3D18B 1JNLL 1HXMB 4XXDB 3GSOA 2NY5H 5CJQH 4YBLC 1U8KB 2NW3B 4YO0B 1IT9H 1FZKA 2ZCHL 4KDTA 5JOEA 4YGAB 5L7XL 4JN2A 3TBTA 2DWDA 2APBA 1RUQL 1FL3A 5GIRA 3KG5A 4S0SD 3MLVL 4M7ZC 2HT4C 2NXYB 2LU4A 12E8H 2EE2A 1I8LC 2W92A 4PV8B 3VCLB 5EU5B 4NPYB 1LDSA 4OLVH 1FYTA 3QUKA 1ZSDB 4UIKL 4ZO9A 4AZ8A 2AK4B 1TLKA 5DD1H 5FUZH 4ZFOL 4HIJB 3EOBA 4HJ0D 1HYSD 1BD2E 5IW3A 1KPUA 4ZMAT 1HHHB 3OWEA 4H8WH 4MLIA 4Z7WB 1D5MA 3MO1A 3X17A 3JWDL 3QJFA 1D5IH 4A6YA 4CW1B 2HP4A 3JTTB 1QLEL 4LCCB 2LV4A 1A6UL 4NQCD 4R8WL 4YXHH 4ZUVA 4L8DA 1EJOL 3B5HA 5CJQL 3O6FB 2A9NH 3QH3B 4M7KH 4CN4A 1LK3L 1D5XA 3NIDE 3VD4A 4K7FB 4YHOH 3ZE2F 1MCHA 3GSVA 1HXYB 4RGNC 3RHWK 12E8L 1BBJB 3GEWB 4KGLA 3CVIH 4F57H 4PGJA 1NEZA 1UA6H 4J8RA 1QSFE 4TUOA 4EN3D 5IB2B 2DKSA 4DCQA 5B39A 1F6FB 1Z0NA 3VWJD 2VLRB 4AH2A 1HSAA 1WZLA 3GMMB 5FUZL 3VDBA 2CLRB 5J0BA 3BE1H 3MRLB 4MNHA 3DHJA 3NABL 3DI2B 3OAYH 5CJXC 4YIQB 4OGXH 3LN4B 3QO0B 5CJ8A 4Y2DB 3B8YA 5CIPA 1T89A 1UWXH 4B7LA 3TPKA 1JRHI 1TZGL 1MNUH 4ODUA 2VAAB 1NBQA 4GJTB 1GHFH 4FHBD 4MX7B 1NC4D 4X4ZA 1OY3B 2GIYA 3HE7A 5H35B 4U2ZA 2EE6A 4NQXB 1MHPL 5SWSE 2A9NL 1XGPA 1WEJH 4M00A 5DT1L 3ALPA 1BWWA 1OQOA 5CD5D 1A9BA 4Y19A 3AS0A 3W11D 3PE9A 2V17L 3VD3A 3MLWL 1TZHA 1G9MH 1BFOB 1TJHL 4GAFB 3U48A 4LHUB 1R3KA 4F57L 3V6FA 1JPST 1JPFA 3MZTA 4OV6F 1BQUA 3BKMH 3BISA 1X5XA 3ULVH 2H2PD 5ID0A 3QIBC 5JZ7D 2DQHH 4JZOA 1FYTD 4JZJA 4QTHA 4ZOBA 3NCCB 1JCKA 3QPQD 3QDAA 4IJ3B 4P9HL 3UTOA 3BE1L 5KVMC 3D85A 1KJ3H 4OGXL 4P59H 1MFAL 4Y8AA 1IQWH 4PJXE 2ZPKH 4XMKH 1SBBA 4L8BB 1GHFL 4URTB 1RHFA 4WV1C 4HAFA 1XCTB 4L4JA 1KTDA 1V7NL 2VISA 2GUOB 4PRPE 5GJTL 3VRJB 3IFNL 3O9WB 3IU4H 3Q6GH 1MHHA 1EERB 4KVNH 4OCYL 1NCCL 1ZA6A 1XCQB 3D25A 2DQGL 5KANG 4CBPA 4UDTB 3F5WB 5MENA 3FT4A 4WWKC 5FIEA 1G9ML 1AQKH 4TYUA 4ACPA 4HIHB 1LO4L 1D7FA 1EK3A 1MLBB 3M1BA 4MHHI 4NP4L 5KS9E 3BKML 3ULVL 2VDRH 1RUPL 4WW1A 2DQHL 3U6RB 1YY9C 1XGYH 5I1IH 4ERSH 1J1PH 1I8MA 3QEQA 4K7PL 4DKEL 1IAII 2AQ2A 3HFMH 2YC1B 3MRMB 1QR1B 1KJ3L 4HSQA 1DQJA 3RY6A 43CAB 1AHWA 1QUNA 2HFTA 3LEVH 4RGNE 1IQWL 1DUYA 1U8MA 5JPMA 4XH2A 5DURB 4I0PB 3OXRB 5I1JL 3EDDA 4Q9BA 4PV9B 5EC2B 3FO0L 4MMXC 2W9EH 1AGFB 3HE7D 2C5DC 5DVLA 5IW1B 4OAWB 5B3JF 1KXTB 4XGZA 1S7RA 4Y5XB 3EO1B 1WFUA 4OSUH 3V6OC 4ZYKA 4Y19D 2H3NA 3ARUA 4AIZB 3U0PA 3FB6B 1E4XL 1DQQB 4QOKB 4I77L 5DJYB 1DEEA 2VJXA 3PGCB 5CUSL 3RTQB 4BJLA 3TIDB 3L9RA 3B5TA 4H26B 2L7UA 2CJUL 1OW0C 4XNYH 1RIUL 3MUHL 4XP1H 3BYTA 5KSUB 1KLGA 4XC3L 4IRJA 3DVNB 3HFML 4WI6A 4OV5B 5GSVB 3FCTA 3D85D 4XAKE 5C0DA 1BD2A 3IKKA 1BM3H 3C2AL 2EDEA 3D5OF 3SDDC 4X98A 1IGFH 2R69H 1G7MA 4Y4HB 3DVGB 1BJ1J 3AU1B 4X6EA 1KULA 1H15B 3QG7L 4L3EE 3BN3B 4NO3B 1MELA 2IPTH 4BFIA 1P84K 3RU8L 4ODXA 3PL6B 5KVGH 2P45B 2WNGA 1NGQH 4WHTA 4Y5VB 3KPNA 1S9XA 3UP1A 3RWFB 5MEND 1HQ4A 4FOMA 1IGML 1T0NB 3IDMB 1QEWA 4L5FH 2EC9U 2XN9E 2Y6SC 3UTQA 3JV0A 3LQZA 2DI8A 1QSFA 5CEYA 5CBEA 4S1QH 4BK5A 2DM3A 1KB9K 3AREA 4I4WB 4DEPC 3BEWA 4O02L 4HJGA 2V2WB 4XX1G 5FO7B 3RVUD 3RRQA 3QEQD 1OP5H 2DJSA 3GSQB 5FYJH 1BM3L 2KQMA 1J8HE 3CXDH 5LGHL 3V0WH 3SO5A 5D1ZC 1IGFL 1H3PL 1QQDA 1ZE3C 5F1IA 5C0JB 1HDMB 2PYEE 3CNKA 4YXKH 3OX8A 3QHTC 4JRXE 4GMSH 1XR9B 4P99A 1DBBH 2HFFB 5DUMH 2FDBP 2Y1VA 2Q86B 5SWSA 5ALBH 1R24A 1ITCA 1QHPA 2HH0L 3QEUB 5C9JB 1NGQL 3NACH 3WJLA 3KAAA 4GOSA 1A6ZB 5K33A 5I74C 5DJ0A 4L5FL 2HVKA 1OAYL 2NY2C 2VQ1A 2C3VB 1TQBC 2E9WA 3LRSB 3SGKA 1WWAX 3SGJC 1MRDL 2FL5A 3TBSA 3NGBB 5JHLH 4HS6B 4XPBH 3ECBB 4JREC 5KAQF 1MCWW 3B9DA 4F7MA 5DUPL 1J9CT 5D70H 4JKLA 5EO9A 1YQVH 3QDHA 4IRJD 3V6OE 4Z76A 5C08E 5IJVA 3MCLH 3IDYC 3QNYB 3VXRB 5F6HI 1H8OA 1A14L 1BD2D 1JV5A 3RA7H 4QCIA 3WFZA 3VXME 2NPLX 4PJXA 1I8KA 3KPMA 1I8LA 4ONHA 4YXKL 4UT9L 2FYYB 4OLYH 1EGJL 3AXLB 1ZT4B 1LWRA 1DBBL 1DBMH 5IKCA 4PRPA 4LSTL 2FJGB 3CVHB 4LHUG 4AG4L 5T3XE 4JY6A 5E03A 3VFVA 2MOVA 4X6DF 3NACL 4KQ4H 4U6XB 1J0YA 1XT5A 4U7KA 1NFIB 3FQNA 4ZAKB 4OKVB 4XVSH 1GGBL 4DZBA 2PW2A 4P48A 5HD8D 4TSAL 2V9QA 4PJ7E 5E8NA 3I9GH 5ERWB 1ZHNA 4AEFA 1OP3H 1WAAE 1K8IA 3GB7A 5KS9A 4P5MB 3O4OB 1I7UB 4MLSA 1JZ4A 5IIEB 1QSFD 1U3HB 4JM2C 1M7DB 4M43L 3ARED 4XHQA 2WK2A 5IWLC 3O2VH 3V95A 5A3ID 3IDGB 1KIUA 1KCRH 4ISVA 5DHVB 3D69B 1I7TA 2DD8L 1MJUH 4ZPTA 1K6QL 4KROC 3RA7L 1I1CA 1UYWL 4CMHB 3L7FA 2JE8A 1WBXA 1CXKA 2Z91A 4E0RB 4QXTA 3CFCH 4BZ1H 4OLYL 3GMLB 5I8OL 2Q7NA 4U3CA 4PS4L 3T4AB 4LPYA 4BFEA 1S5IL 3SDXE 3OR6B 1DFBH 5SWSD 4OQTA 4OFKA 4ELME 4K94H 1OAQL 4O2EA 3BPCA 3GBNL 4KQ4L 3LMJH 3D9AH 1ZLUH 3BEVA 2X4UA 5CJXA 3CDCA 3V6BR 4XPHL 4F7PB 1GGTA 1U93B 5HVGB 4KTDH 3I9GL 5F88B 4HCRH 3VA6A 4UNTA 1ORQB 2GY7B 5DMGD 5L0QB 4PP1C 3FB5A 1DBJH 4NRYB 2RAMA 3Q6FA 5I76B 3K2MC 1CGXA 2HRLA 4XNZC 1E6JL 2Z35A 1A6TB 2EXYC 1QFOA 4XMPL 2E5EA 2BNUB 4PGCA 1MH5B 3D3VE 4Z78B 3EYFB 3QUML 5GGSB 2NZIA 2EO9A 2X5PA 4D9LH 1CFSB 2FIRT 3ZKSD 3X12A 4NT6A 2DI7A 2HT4D 5K9KB 5BW7C 2JB5H 3STZA 3CFCL 3S35L 3ELAT 4BZ1L 3IAGC 5EZLB 3UJIH 4L3EA 3QIBA 4LK4A 3GMPB 5IEHA 4LF3B 1JWMA 4PRPD 1CL7L 1FC2D 2VDLH 1DFBL 3VFTA 3MYJB 5GISH 2P5WB 2X4OA 5C2UB 5SV4A 3VXSE 3LKNA 3VFWB 1QPXA 4NN6C 5SWQA 4NKOA 2H26B 3W0WB 2Q6WA 4HCRL 2XN9A 4HWBL 4U49A 1G6RL 1KJMB 2CO6B 4WV1A 4Q6IC 3TT3L 3KYNA 2R0LH 3MNWB 4QYOA 5JO5A 4LLDB 4AEHH 3GKWH 1MI5B 5F3BA 5I16A 1Z9LA 2D7TH 1A47A 2I9LA 1WICA 3WFBL 2QHRL 1WBZA 4DN4H 2HKHL 1J8HA 1FG2A 4WWKA 2FSEB 2OXHA 4RGND 4MNGE 4TOYL 2JB5L 3K8MA 1F3JA 2HTKC 1LO0L 2JJSC 4RDQF 2PYEA 4JJ5B 2VZVA 3FT3B 2F8XC 4JRXA 5E7FA 5EPMB 4NJ9H 3HNTH 5DC0A 1U8QB 3KXFB 3VGDA 3KHOA 5JMRA 2VDLL 3EOYG 1I4FA 2W0FB 3FONB 4JKKA 4AT6A 5MEQB 4OZFB 4F7TA 1FLRH 3BKYL 3IYLW 2X1QA 3UCRA 3PGFH 5JW4Q 2B20A 2ZKHH 2ZUTA 5KSBB 3NCYP 2R0LL 4HX1B 1MJ8H 3GMNB 3N1GC 1Q1JL 2FECI 2OMBA 1YNTB 2CR3A 2LTQB 3EDEA 3H3KA 4GKZA 1N2RA 4AEHL 1IAOA 3V6OA 5C08A 5DYOA 1I1YB 1CXIA 1SY6L 4XAKD 3P9MA 5EUOE 2BC4A 3VXMA 1BIIB 3UPRA 1FYHB 5LXGL 1H3XA 4P46C 3U30C 3U2SB 4MS8C 1ND0B 1UADC 1N59B 3PDOA 4L3ED 1OW0A 3QIBD 4ZFZA 1YPZE 2FIKA 3O2DL 3ZTJH 5JORA 3ARFB 1T80A 1ZVSB 4U1SA 3BWAB 4Z7WE 5BJTA 4N0RA 1T22B 3RIFF 1HZHL 3QQ9C 1X6LA 5C6TH 2QKIB 1QNZH 4R97C 1T21B 2NTFA 3VFMB 5B39G 3SDDA 4JGUA 1Z9OA 3RNKA 4PJ7A 2XN9D 4HMCA 4JFYB 1QFWM 2APWA 4P23B 1WAAA 4X5WB 3PGFL 4YHNB 3W2DH 4FQIH 1JPGA 3D0VB 1KCLA 1CGSH 1EEQA 3WV0A 4OIBA 1CWVA 5TH2B 3GSNH 1KB5A 4DUXA 1IGTB 5IHZA 3VH8B 3EO9H 2Y5EA 1J8HD 5FO9A 3B6SA 4WWKD 3WFEH 4JAMB 3H7BB 2VUYA 4OI7A 5E2WH 5J89A 4WEUD 2PYED 4K3JH 4H1LA 2CD0A 3OZ9L 3UX9B 2EIBA 4JRXD 3DBXA 5DS8A 1CQKA 3DROA 3V4PH 1IGYB 4GRMA 1YY9D 4MCZA 1U8IA 3LQMA 2YS4A 3SDXA 3P9WB 2X1OA 5D6CB 5GRVL 4ELMA 4P4RB 5KG9B 5KANI 2XKSA 3L1OH 5INCA 1NPUA 4RWYL 4FG6C 4P5KA 1HOCB 1KN2H 3PWLB 3ETBF 3HAEB 3QHZL 3ZDZE 5D1ZA 1T5XB 3GSWB 1SYSA 1T1YA 4HMEA 4NNXA 4O9HL 2XKUA 1WIOA 1F4XH 4OCXH 2FJFA 4OZIE 4XNXH 2QADC 3S37X 1EUTA 2EE3A 4P3DA 1MY7A 4BQ8A 3FO9B 3MMEB 1CGSL 5T1KB 3I50L 1SJHA 4TVPE 1KCVH 3V6ZA 2YKLH 5JOFA 3GSNL 4KFZC 1T5WB 1R3IH 1JHKH 4ZTOH 1FFNA 4UTAH 5C08D 1BF8A 4X6CB 2F19L 1I75A 3D3VA 4HHAA 4JDZB 5GJSL 1WZKA 3VXMD 1A7NH 4HUXB 4LP5A 4MA7H 4PBXA 1NCAL 3MRKA 5EU6E 5K9OA 3SGJA 4WWID 1OAXL 4MA1C 4NCC1 1WWCA 5C0AB 4XAWL 4U6TA 5EWIH 5CFHA 1HHIB 5T3XD 2EYSA 3VXSA 2R2EB 1YMHB 4YDIH 3VXNB 4GKNA 2XPGA 3SDDD 1BWMA 3ARDB 4PJBB 2HLAB 2L4OA 3MNZA 3INUL 3O4LB 3JTSB 3DTXA 2RGSA 3CDFA 1YUHB 2AV7A 2GT9B 2VXQL 1I3GL 5EBLA 3QIUB 3WNOA 5CZXC 4C58B 1QFPA 4JG1H 2QL1A 5DRNB 4ETQB 1CFTB 2YKLL 1OAKL 2HAZA 5C0FA 4N8CL 1CDIA 3VI4E 3BKCH 4JM4H 3FOLA 1NEUA 2BSSA 4YBHA 3SPVB 4UQ2A 1XGUB 3NPZB 1UXWA 2VLJE 3IDIB 3VGBA 4MNGA 1P6AB 1AO7B 2F58H 2Y6SD 1QBMH 1G0DA 4XNMB 2EYTA 2FWOA 4JM2A 1EHXA 1H3TA 3AB0C 3IFOA 3GHBH 1RZ8A 5HSFA 2DN7A 4FABH 4WDIB 5JA8B 4XVTH 5JA9A 1NGPH 5TGBB 3BSZH 4HFWB 3RWIB 3E8UH 1ES0B 1QD0A 1XGTB 1QPPA 2DOCA 4Z7VB 5D1ZD 3MLRH 5FO8A 1Q9WB 2V7NA 1ZHKA 4PJFF 3V7AE 5DEFA 4FRWA 3O3BA 1QA9A 1JMXA 4XPGH 4WY7H 3NFSH 5FYKE 1QLRB 2X70B 2J8UE 5KN5B 5JPNA 3Q5YA 1FNSH 2FH8A 5FUOL 2BXYA 1P4LB 1I7RA 3D3VD 5I8EB 1OF2B 3LN9A 1A7RH 5I2IB 5EUOA 2NLJB 3E0GA 3OV6A 2Q8BH 2NY2D 3O8XC 2F58L 3C5SA 3M8OH 3VFOA 3QI9C 4IMLA 3QSKB 4JFEE 5GRVK 5DJDB 1YPZA 1IQDB 4WO4C 3NH7L 1HHHA 4Z7WA 4Z77A 2XYCA 1RZGB 4XVJH 4KI5C 4G9DB 3ARGA 1PLGL 1TENA 2GHWB 3VXSD 2W9LA 4NC2B 3CUPB 4BSJA 5BW7A 3HZVA 4HEPG 4XCFL 2LABA 2ZOKA 2JK5B 1NC2A 3MJ7A 4HZLB 4ZFFB 3BRGC 1AP2B 3PJSA 3QHFL 3S4SA 1HXYA 1EJ6A 4Z18A 5FFLA 3KJ4B 1HH9A 3SQOH 5I18L 5KSVA 3X13A 5IEKB 2B4CL 4LLVB 4UT6H 5C0CB 4A6YL 1KV3A 3THML 3RWEB 3ME0A 4J7RA 3T09A 4JFPB 1AKJA 5FKAB 1MCPL 4Q6IA 3C9NA 4JM2D 5AYUL 3T0EB 3WXVL 5FF6A 3LN4A 5C0RH 1FIGH 3O0RH 4MA3B 3C8KA 1X5HA 4S11A 4JKMA 1R5IB 1QFUL 4K23L 1TJIL 4LL9A 1ZLVH 2VB5A 4KROD 5GQBA 5CILH 1GCFA 3I6GB 3JV6A 5F96L 4K9EC 4OCSL 1JNJA 1OD9A 3H8NA 3QXUA 4OZIA 1EEZA 3A67H 4ORGA 2BOCB 2JJSA 4PJ5E 1K5NA 1G6VK 5DHVH 1FO0B 4RFNB 1BVKB 5CAYB 5T33L 1PKQE 3K2UL 5L2JB 4DVBB 4E42B 4RA3A 5IOPB 1CICB 2A6JB 2Y4SA 2AAVA 4J12A 2FGWH 2YZ1A 4M93C 3U46A 5I75B 1FGVL 3GI9L 3EOTH 3IDNB 4GSDL 1IM3A 5DTFA 4KAQL 1MEXH 4KUZL 4X9FA 1WLHA 1T03H 5EU6A 3TZVB 4H20H 3ET9F 4LPCA 3BRDA 4PP1D 4WCYL 5F70A 3T0WA 4X4XA 1DLHB 1S7UB 1OTTC 4NFCA 1VFAB 4DUVA 2EXYD 1CT8B 1VEPA 3F65A 3S3JA 3ARGD 3SY0B 4LLQA 3CFDB 5BV7L 4BSWA 4Z0BL 1BQLH 1AGDB 2AW2A 5CCKL 2I24N 3A67L 4P46A 4G8FA 3MBEB 4FFWC 3DUHA 4LPTA 3VFSB 3TBWB 1NC2D 1R6VA 4LVHB 2XWBA 4JHZA 4P5TB 1C5CL 3S88L 3NIGE 2ZCKH 2A83B 1UM4L 4PRIB 2MCG1 2CGRH 4KI5E 4LSPL 5BZDA 2YPKB 4NQVA 4YLQT 5E99L 5JHDE 3CDGA 2X4NB 2FGWL 4PRAA 2KPNA 2G2RA 4OUUA 1EFQA 2VLJA 1MEXL 2PTTB 2UUDH 5JXAL 2DI9A 4YPJA 3VG0H 1VGKB 1T03L 4NUGL 3CJJA 2P24B 2X4SB 3VI3F 2Y07H 1FV1A 2YXFA 1CF8L 3HCVA 1AKJD 3Q3GA 4Z7QF 1RFDH 4KJYB 1CLCA 1TXKA 5FXCH 2YR3A 2JIXA 3ZE0F 3NTCH 2IANE 4Y2OA 3WUWA 4KRMB 3T1FB 1KENL 2HTKD 3HLAB 1F6AB 2HYMA 5D2NC 4F37F 3C09C 4TQEH 4D0CB 1YQ2A 3ILPA 4TVPD 1RZKC 4I5BA 4NM4L 4C56B 4MXWL 3KGRA 2J8UA 3PGCA 5GS0C 1MCEA 3LD8B 5HHNA 1FPTL 2IBGA 4H26A 1BHGA 1Z9MA 5HTSA 3BZFA 4PB0H 1KCSL 5EU6D 4XMLL 1JUFB 1TJGH 4JFEA 2M1KA 4NRXB 1O7VA 3ZT6A 3V7MA 5D9SB 3CFJB 4OZFH 3MRIB 5LCVH 3MUZ1 1G7HB 1XGQB 4HLZG 2V5MA 2X4PA 2OBGA 1F4WH 2OLDA 2HA1A 4FNLL 3BGFB 1WQVT 5DSCA 2MHAA 2E7MA 5FUCC 4H0HB 3VRLF 1CDYA 2RFXA 2AEIT 4X7CC 4JB9L 2R1XA 2C1PA 4P46D 4MS8D 4FQJL 1W8OA 5AZEH 4PJEE 1V05A 2BSRB 3FQRA 1VKXB 5E6ZA 3PUCA 2XWJA 4FXKA 3GSRA 3IDMA 4DTGL 2GFBB 5LGJA 1EMTH 4M02A 3QQ9D 5F9WB 3VJ6B 1ZS8A 4I4WA 4HG4J 2VLJD 5GGVY 3NCMA 4PB0L 2BFVH 1Q94B 1AGBA 3DRQA 1S7WA 3K1KC 3LCYA 2W60A 4HBCH 3RVTC 1NH6A 1F97A 2OQJA 1CG9A 1ZLVK 4F15B 1F8TL 4JO1H 1LNUB 3EYUH 1EFXA 4AEIH 5HPMB 3P77B 32C2B 3KPRB 2JIXD 1KPVB 1U92A 1QZ1A 4Z7OE 1H0DB 2EXWC 4KWUA 2OL3B 1AR2A 4YZFF 1LD9A 4YHMH 2HRPH 4PJ5A 4CU8A 3N85L 3LHPH 4FP8L 1DQML 2BDNH 5F7MC 2IPKB 2H1PL 2ZUQB 4DFIA 3BX7C 5ILTL 3V5DA 3NFNA 1PKQA 5FYKD 1EMTL 5IP4A 2AKRA 2FEDD 2P46B 3W9DB 2A6KA 5C86A 1DR9A 4YUEH 2PXYB 5DFWH 1WWBX 4DOHE 2BFVL 4KHXH 4ZOCA 5J4MA 5IGXL 5I1AB 3U4BL 1PFCA 4JFED 3WO4C 5D2NE 3RZCB 4PGBA 4NQSA 1PW3A 2ICWB 3EYUL 2VAJA 4TTDC 4K3HA 3HAEH 4QY8B 4POUB 3DV6A 1ZKAA 3SDAB 3TYGH 4YBQC 1IGJB 1G9NC 2FX9L 3F12A 2WINB 4LCIL 5E8PA 4RX4D 3SO3B 5D72H 4NGHH 2BX5A 2YA0A 3UJJL 4L4VE 5D4QA 3O8XA 4YHML 2DLHA 4OLUH 5IQ7L 2PYFB 1CU4L 4WO4A 4GUPB 5HYJE 1MCCA 1J0ZA 3F7PC 4LRNL 3BUYB 2IEPA 3OKNA 1BFSA 4JFDB 3BPNC 4EDWH 4L1DA 4EUPA 1QLFA 3MRJB 2F5BH 5JHDA 3MLZL 4H1LG 3BH8A 3E6HB 4JFFE 5IM7A 5FUCE 2HMIC 5DMKA 2H2SC 3OR7B 2RBLA 2VE6A 5I19H 2CKBB 3PIQB 2YEZA 2GCYB 2VZSA 2YSSA 5FCUH 5HYEA 5CZXD 4OQTH 4EOWH 5C92A 1BBDH 4JZNA 3AY4C 3H9HA 4ALAL 1EFXD 1PEWA 4R0LC 4YDVB 3SE9H 5ITBH 3AM8C 1UB5A 5EDXA 1P7KB 1KBGH 2IANA 8FABB 5D72L 2G5RA 3DHMA 3MRFB 4PRNB 3R0NA 3O3AB 4TULH 1G7PA 4R7DA 5D8JL 4CADB 4X4YB 4PJ5D 4X7SL 3TH3T 1INQB 5D2LE 3QAZC 4U0RB 4PRBA 4Q2ZB 1AFVL 1OCWH 2VL5B 4G80B 2P4AB 3TNMA 3BW9A 4X6BA 5DVNA 2YD4A 5HYSB 3STLA 3C5JA 1EO8L 4N1HB 2EO1A 4E41E 2K1MA 5E4IA 2F5BL 4JKPH 3MGOB 2DQDH 2XTJC 4EBQL 2EC9T 4NHUA 1LVEA 4R97B 4KTEL 2HWZH 5ANMB 2OK0H 2OR9H 1NAKH 4LLMB 3W82A 1AC0A 1K2DA 1OAZH 3DX8B 3M17A 4CN1A 1YJDH 3L5IA 3WE6A 4L3AA 5L8LB 3QRFM 4KZDH 4Z8FL 4LCWE 4AEEA 4PD4J 4OQTL 4EOWL 2CDGB 4PIRF 3KPSB 1GGUA 1P9MC 1IZJA 1BQSA 1S9WB 3FRPA 2X6MA 3ILQC 3SE9L 1RU9H 5C3LD 1NCDH 4OF0A 5I17B 1LEIA 4UAOB 3EO0A 4I3RL 4M61A 4UUJA 3ZKMC 4BFGA 1YECL 1NDMA 2RJMA 4ZPVA 3HB3C 4ZTPH 2ORBH 2LVCA 5ETUA 1LO5B 3O8XD 2GKIA 5J6GA 3F6IA 1X9QA 4C57C 1XF2B 3QJHB 3ULVF 4B5EA 1OCWL 1OM3H 4PJEA 4X99B 4WO4D 5E6YA 3VXQB 4QHMB 5L9DL 2DLGA 3A6CH 4LGSB 3PWPB 2D7NA 3LOWA 2CLZB 4JDVB 1KG0B 4KI5D 3EDKA 5F1NB 3T4YB 3RGVB 2VDPH 2E6PA 5JHDD 2E7CA 5LQBH 4QRPB 3CMGA 5IK3B 1EIBA 2HTLC 4GRLC 4OLEA 4RZCB 3S5LB 3H42H 4YAQA 4LSRH 4L3CA 2EDOA 4RMQA 4HUWB 4KZDL 5TDNB 2XRAH 1BOGB 5D6DC 5CP7B 1IEBB 4ODWA 5TFSL 1JZ8A 3BIKB 1YEEL 5K9JL 1T4KB 3I6KB 2GK0A 1FC1A 5AAWA 1BP3B 3IJHA 2OJEB 1T0MA 5GHWL 3NVQA 2N7AA 2MTPA 1INDH 2IAND 1U8LA 1RY7B 1WT5C 1K8DA 4LLWA 3T77B 2OI9B 5IG7A 4MB5A 3D39B 3P9LB 4UDUB 4ZO8A 1R3LA 2W0FA 2C1OA 4NYLB 1YDPB 5KVDL 5EZIH 4XCCL 4YR6B 1UKSA 2GSGB 1N64L 2Z31C 3CFBA 2HJFA 4LFHD 3ES6A 5EU7C 1AD0B 3UBXA 1FL6B 2R4RL 4NOBA 1BGXL 5BRZE 4LSRL 5FGBC 5ACLA 2WQ8A 4JHWL 1QO3A 4MQ7A 1N3NB 3RWGB 3KNBB 4FZEL 4OJFH 4NBZB 4OF6A 4UT7L 5D2NA 3PWJB 4D0BA 4U05A 3ZDYE 5K9QG 4EIZC 5DD5L 4ZOAA 5J06A 5IVXE 2XTJE 5CBAB 2DLTA 1FO0H 1M05A 3MXWL 4ZNEE 5AZ2H 1TTFA 3NA9H 2R0WH 4L4VA 3WS3B 2UZIH 4J3WA 4BKLB 1UKTA 1NDGB 4ZUUA 1OTTD 5HYJA 4PG2C 2ARJQ 2YUWA 3WS6C 4J3OC 5E2UL 3U9PH 4JFYA 1DBAL 5L2KE 4ZFGH 4G42A 3GBMH 1GZPB 2QJDA 3IKCB 2P48B 5ISZB 4HUUA 4JFFA 3G9VA 5HHOB 2P8PA 4H1LH 3VGAC 5BS0B 4XWOC 4JFXB 4FFWD 4PJIF 1IAMA 4OJFL 5I71C 1OQXA 5T3XL 3L3KA 2DQFB 1X5GA 3DIFA 5IHUL 2C4FU 1C08B 3IVKA 4JAMA 1T1XB 3ARXA 1WBYA 3TO4C 5LVEA 4JRYE 4BH8B 1UCBL 3ARBC 3FO2B 4LGPB 5AZ2L 4BH7A 2E6JA 4S1RH 1MHCB 2AJXL 3CFEB 4DQOH 1UWEL 1FP5A 3RAJH 2DQCL 3SKOB 5CHNB 1AC6A 3O6LL 5D2LA 1NMAH 4GXUN 1CK0H 1MFBL 1KB5L 5C7XH 4XNQB 5C8JA 2G75A 4E41A 2VLLA 4BQ6A 3DMMB 4ZFGL 5BZWA 5EORH 3L3OB 5T5NG 1A4KB 4QWWC 2DQIL 2P44B 3TA3B 4F33B 4LKCA 3SCMB 1B0GA 1XF5B 3TIEB 4R4BB 3DO7B 1T04A 1YNKH 3N50A 4LCWA 3VG9C 1AGCA 1H3GA 3BO8A 4D3CL 4QXGH 1NFDF 5GS0D 1ZVHA 1OSPH 4RISH 1YYLH 4WGWB 5KOMC 3TBYA 1Y0LA 2QHLA 3I2CH 5EU7E 3QULB 3FB7B 1MHEA 4UV7H 5D7LE 4X9IA 4L4VD 2GTZB 1A02N 3TEUA 1KTKE 4O4YH 1W8NA 1YN6A 3TVMA 4DKAA 5JW4M 5J11C 2Z8WC 5HYJD 3IXTA 5IFJB 1IM9B 1REIA 5CSZA 3MGTB 1HQRB 7FABH 2X4RB 5EOCH 5HGAB 3BIAX 1YMME 1MWAB 4KK6C 4LLUB 1S9YA 3DUSB 2CH8A 4JFFD 5HYQA 1KJ2H 4G8GE 1FAIH 3T3MF 4RQQA 2H41A 2DM7A 4JQXC 2P8LA 1YNKL 1XR8B 3OKDB 5C71A 4L29A 2BOBA 4XRCA 3RKPA 3HI5H 1I9JH 4G6KH 3WUWG 1T3FB 1ZWIA 5IMLA 3PV6B 3UC0H 2YPVH 4KVCH 1CE6A 3EYVB 1C5BH 4JY4B 3I2CL 1JWSB 3UAJC 1RK0B 3PWVA 2NXZB 4G7VL 4LAQH 3TN0B 5J1TC 1GXEA 1NLBH 1NUGA 4WDIA 2EICA 2XACC 1M6OB 2X40A 1J1OL 4O4YL 5HHXH 5L6YL 5IB1A 3RVTD 4EDXA 4EI6A 1MAKA 3AY4A 4GKOA 4JFZH 4DUWA 4R0LA 3ZT5A 4E41D 1CIUA 3AM8A 3DX7B 2AV1B 3MOBH 4KTYA 1QSZA 1RZIA 2RHEA 2DMCA 3TJEH 3MV9B 2EXWD 1FAIL 4NM8L 3DV4A 4PJDE 5BRZA 3GBLA 2C4XA 3QFJB 3B43A 2VDQH 1MSPA 4LCWD 5JR1H 4PJAE 1EH9A 4FQXC 3HI5L 1I9JL 4G6KL 2DYPB 3E6FA 3MJ8A 1GOGA 3L5WB 3S97C 3VFUB 1S78C 3QQ4A 2D7MA 2OL3H 4KMLB 2B39A 3HHRB 5HGDB 5F9OL 5IVXA 2JCCF 2QSCL 1X5KA 2AQ3A 1X5YA 5GS2D 4ZNEA 4HUVB 4QRQA 3VGFA 1WCBA 1NGZA 5ALCH 5HHXL 3MYZA 3E2HC 2NY3C 1P4IH 5F8QC 3RBGA 4YXLH 3TVMD 3HMXH 1FFOA 1IGCL 5DJ6B 3L7EB 2DTML 1P9MA 4MDJB 4OZGE 4RIRB 4TTDD 2Q1EA 4RBPH 1UEMA 1IVLA 1KT2B 3IRPX 3MPCA 4YBQD 5L2KA 1S9VA 3PNWB 3KDMA 2YA1A 3DJ9A 1A6VH 1QFWH 1NGXB 2MCPH 4XXCC 2BJML 3IDXL 3U0TB 3NIFE 1PD6A 1IFHL 4N9GB 1G7JA 4OFVA 4AQ1B 5TDOB 3GFUA 3HC0B 1T7XA 3EYSL 4NQDB 3V2AR 4N0FB 1P6FA 1ONQB 3D48R 2I60H 3TC9A 5CEXA 5ESVB 3IT8D 3S36X 1KNOB 4JRYA 3KR3H 1A3LH 4GRLA 2HMID 3DWTA 1S7VB 2XA8L 3GRWH 1F11A 2R29L 3OXSB 2A73A 4X83A 2APVA 2VN7A 4TVPH 5D6DA 1SMAA 1K3IA 4KI1A 5CEZH 3QYCA 1R3HA 1KLFA 1I85C 1NJ9B 3HG1E 1MVUA 2XV6B 4LSVH 4PJHF 2D03H 1QSEB 1T20B 3WJJC 3CMOH 1MCSA 1WT5A 3L3IA 4RMTA 3ZE2E 4HMDA 5BRZD 4GBXB 5H2BA 2E27H 4P2RB 2FBJL 1NL0H 4X9HA 2P8MB 2E7HA 2FH6A 1QBBA 2A9MH 1FAKT 4EXKA 1MCLA 4HIIA 4MVBC 3JWOC 4LU5H 1AQDB 2UWEB 5C2BH 4MJID 4CMMB 3FMGL 3JVGC 2Z31A 5IHBA 5KTEH 3QXTA 3NCJL 3S34H 3VXTA 2FO4A 3OG4B 2XTJD 4MDIA 1U91A 3BHBB 5D7LA 4HG4K 3B2VH 5BVPH 5FGBA 6FABH 3OG6B 5DUBA 5E5MA 4XCYB 3QUYB 1CFVH 1PKOA 3G08B 3VXPB 1CD0A 1QKZH 4EUPG 3PXHA 3HRPA 4ZNCD 2AJSL 1LK2A 1BZ9A 5T1DL 4HFUH 4MCYA 1AGEB 4MAYB 1MOEA 3ILQD 4I3GA 4GAYA 2CDEB 4P4KB 3OAUH 3MLTA 3EGSB 3ZKMD 1U8NA 5DK2B 5L2KD 4NKIL 3LQAC 3CX2A 4J3UA 3X11B 3HC3L 1DSFH 3P0VH 4GQ9L 3HB3D 3BD3A 4G8GA 4WI4A 3HE6B 4QHLB 4NN5B 1TQCC 3OL2A 5AYQA 4ZUWA 1NL0L 4LBEA 2NY7H 2MPAH 4NJAH 4KQ3L 2YD9A 1KCUH 3O6MH 1W0VB 1INEH 3QXWA 5EFIA 3ZSSA 3RUGB 4PG2A 2X09A 3QXVA 4HS8L 3WS6A 2Q8AL 4G43A 1FNAA 5F8RC 5CP3H 3OB8A 4U6YA 1F4YH 2MQ0A 1HWGB 3O2WH 1S8DA 2ZUWA 5ID1B 1EX0A 2HTLD 4JRYD 2VIRA 4GRLD 3U1SH 4M7LH 4LVOB 1KIQA 6FABL 4F2MB 2OZ4A 3LSOB 1CFVL 1U8PB 2DL9A 5DJAA 3LKRB 4HUKB 3HZYB 4LFHG 1HHJB 3KLAA 1A6AA 1CLYH 2A1WH 1KGCE 3UYRL 2ZSWB 3C60C 4K07A 2D4FA 3TO4A 1PY4A 1MCDA 1YY8B 3P0VL 1OWWA 3ARBA 3KYOB 1RHHA 1S7SB 4PJDA 2ADJA 2G9HA 3RPIA 3FRPG 1Z6JT 1ZK9A 4G6AD 3F6LA 3TYFA 1FJ1B 1KCUL 1YEKL 3ZTNH 2EYRA 1INEL 4PJAA 4JDTL 2V7HB 2DJUA 4I18C 1YC8A 3G5YB 1IBGH 4MD0B 4ZDHA 1U95B 4LKXA 1NSNH 1F4YL 4GW4A 3O2WL 2Z31D 2E8ZA 2HVJA 4PJ8C 1CBVL 4NKDA 3K80A 1VFBB 1IEAA 4N0YH 5C09E 1U8HA 1OSZA 1U8JA 1J0JA 3ORJA 2Z4QB 3QT2A 3HNSH 2AEWA 2FHBA 2Y5TB 5D7LD 1ADQA 2QR0B 4EVNA 1UJ3B 3F7VB 1RJYA 2R15A 5FYKL 4OZHB 3WNPA 4M48H 4OZGA 2CDFA 3UROR 5B3JE 2QV2A 1A1MB 1A6WL 5F3HB 4KY1L 1YMMD 2H32A 5C07E 1CDBA 3K3QA 4WU7B 4G7YL 3Q1SL 3B83A 4GS7C 4U6HA 4JO4H 4GFTB 2IG2H 4RAVB 1FE8H 3OKOB 3Q2CA 4G8GD 4OBRA 2H6PB 4HWZA 1A1NA 4RGMB 1MIML 4JHAH 1A3QA 5J1SC 4NO5B 1D6EA 5EBGA 3BPOB 1M7IA 1J05B 1L6XA 1DBKL 4AMKH 4PR5B 4U1IA 2FEEI 3VGGA 3MRHB 2IQAA 3ZL4L 2VC2L 1R5WB 1FVEB 4XWOD 1CLZL 4POZC 4JQXA 5I1EL 2OTUA 4R4FH 4WGVB 1IC5H 4UV4L 5KBNC 2DQJH 1U3YA 4PD4K 1G0YR 2VXUH 3UBXG 1XF3B 3HG1A 2GAZB 1YNLH 5FB8B 1QFWI 5IQ9A 4M5ZH 5EOTB 2ICWI 3BPLB 3VXUB 3TO4D 3VWKC 4LASL 2IG2L 5TF0A 4UNVA 2WIIB 5C0BB 3ARBD 4J3XA 4U6VH 4M6NH 4R4ND 5EU3B 1WF5A 1G1CA 4L8CB 4R3SB 1CFQB 4JPIB 4XBGB 2ADGA 3EYOA 1DN0A 4PRHB 4KZEH 3ULUC 5I8CA 3O45B 1JF1A 1TVHB 3QBTB 1J1XL 3KYKL 3PQYB 3WHXA 4XBPB 2O5ZL 1KN4L 4CVXB 3UO1H 4L9LC 2VQTA 4QWWD 1BQHB 3QDME 5IW6B 4TUJB 5TDPB 3OKKA 3V8CA 1NCBH 1ETZA 4C4KT 1VACB 4JQIH 5I6XB 4R4FL 5I1CL 4FFYH 5ABDE 2DQJL 1D9KC 1T2XA 3LEYL 4FQXA 4HK3J 3AMKA 4EUPH 4U1JA 4X7DC 5FM5M 4J1UA 2W07A 4ZUTB 2GJ6E 2ZOLB 43C9B 1MCNA 2C7UA 1KUMA 4OGZA 4LNRB 4LPWA 4I3SH 2R0ZH 4Y0GA 4QHUA 3AGVA 4U6VL 5FA4A 1A4JB 1J0IA 2Q7YA 4CVWA 1W2KT 2DDQH 1T0PB 2YN5A 3CFIC 5BQ7B 5C6WH 15C8H 4X7EC 5EG6C 5MERB 5IB5A 3SDCC 3FAWA 3QISA 1JGUL 5KVFL 2Q3AA 4AM0B 3WSQL 2VUOA 4JVPA 3V4UH 4X4ME 4JPVL 4KK6D 5I0ZA 4K8RH 5ESQB 2QQLH 5DQJA 4N9OB 3OKYA 1QSVA 3P0YL 1JWUA 4XXCA 4JPWH 1NCBL 1U3JA 3BMWA 4MD5A 5HY9A 2ADIA 5ELIA 1VPOH 1RULL 4S2SB 1KLUA 4FFYL 3BP7B 1MWAH 3WEXA 3S8WA 1E4KC 3G04B 1B0WA 5DRWB 3HG1D 4KXZH 3ALWA 1FL5A 4X6DE 4K9EH 2QQKL 4FXGB 3WFHA 5KSAB 2CUIA 1TVBB 3UAJD 3HI1A 2Y06L 2AJ3B 3C6LB 5GGTA 3MUGA 4ZXBC 3VFRA 3BXNB 1I1FA 4KRLB 3SN6N 5IVOA 3H6JA 2C3GA 4K71B 3X14A 4ZD3H 1PG7W 1VEMA 5EBMB 1MCWM 4XP9L 4MQSB 2PR4H 5BVJB 2BVQA 2VXTH 2EH7L 3MJ9A 5HDQH 3WJJA 4DKFL 2I9TA 5DD0H 2QQLL 4YHYB 2AXGB 5F72S 4LMQE 5DGRA 2GJZB 1JK8B 5C09A 4UOJA 1LO3H 4MAUL 2JJUA 3OKLA 4V2CB 5EC1B 4GRWB 4GLRH 3Q0HA 4R6UA 1FSKB 3TBVB 2WWMC 4FMKA 2BHUA 5JDSA 3P11H 4BA8A 2GW5A 3P4MB 1XF1A 4LVNC 4OLWH 4FQXD 3MCKB 3MV7E 3NMEA 5DD3H 3ULUE 4CDHA 2XOTA 3QWOA 1VENA 4GKSA 4B41A 1DP0A 3C5ZC 1LDPH 2FB4L 3JVGA 1OHQA 5C07A 4WU5A 4K9EL 1YN7B 1KACB 4YHIB 4APQB 4RAUA 1PG7L 3OKMA 5AD0B 1T2QL 4JY5L 1M71A 1RI8A 2VZTA 3FQUA 2NY3D 4GG6B 3U79A 4JJHA 1MFDL 1CGWA 2OMNA 4PG9A 1V3MA 3TT1L 2X9XA 2Y7QA 3D87B 4BSVA 1VFOA 3FO1B 4ZQKA 3FFCB 3NN8A 1Q9OB 4U1LA 2XG5A 3DX9B 4BQBA 5D1QC 2WUBH 3OPZL 2FR4B 2VABB 5DD0L 4G3YH 4H25B 5B22A 1OT2A 1Y18B 4PJCE 3IU3A 2IADB 2KZWA 4OFPA 2BVPB 3MA7B 3HPJA 1WIPA 4ZSOE 1NUDA 3PV7A 2MNUA 3S9DB 3GMOB 5DD3L 4AENA 1B2WH 1IC4H 3VG9B 4G9FE 1UZ8A 2R23A 4LQFL 5E2TH 3G5XB 1KGCD 3L3JA 3HR6A 3WN5C 3QCUH 4PBWD 5E2JA 1E27B 1ED3B 2A77L 1UVQA 2XZAH 4N8VA 3NCFB 2Z92B 2LVEA 1BAFH 1K9TA 3BGMB 3LS5L 35C8H 2X41A 4OFDA 1QBLH 3ZLQC 1FORL 5GS0H 3W39B 3LB6C 5HGHA 1Z3GH 3W5NA 4EI5B 3C60A 1WC7A 1BIHA 2NY1C 1IE5A 4P57A 5C09D 3WIHH 4HDIA 1RIVL 3HMWH 3QDMA 1U2CA 4RFOL 5GGRB 3S7GA 5CWSA 3LKSB 1GGCL 1MAJA 4IOIB 4XP4H 1F3DH 2WBJB 2EKSA 4I18A 1VDGA 1B2WL 4MVBD 1F90H 4TSBH 2AXFB 4TVSa 2XWTB 4HIEA 2GJ6A 3GUTA 5FGCB 4PJ8A 1ZANL 5C07D 2KZ1B 1JNHA 3E1F1 2SEBB 3V5HA 5EO0A 4FQCH 3O41B 5ITFB 35C8L 1IC1A 2YUVA 2PCPA 1RZKL 4ZFOB 2Y36H 4PGEB 1J5OH 5FKPA 3WL9B 5DJ8B 5GS0L 3G5VB 3ALXA 3HR5A 1R3JA 1TETL 3P4LA 1HH6B 1P1ZA 5I73C 5E94A 4MNQE 2EEBA 4WUUE 1JHTB 4F7EB 1D5ZB 3BMVA 4X4MA 3P4OA 3FOMB 4XPAL 2Z9TA 5CZVH 2ITCA 4ELKB 4TPRH 1EAPB 3DI3B 5KSBF 1CE1L 1T7ZA 4NZRL 3Q5OA 1AJ7L 2IQ9H 3BESR 4XP4L 1PY9A 1T7YA 4CL7A 5GGRY 2D0HA 5I9QB 4XBEL 1FVDB 3VU2A 3MRBB 3H3BC 4AK1A 1C1EH 5E24E 2VLKE 4GQPH 4NQEB 5CHNA 3FB8A 4KKLC 1I9RH 4JVUA 4OFIA 1GJIA 4X6DA 2AEQL 4WI8A 1LEGA 4HQQH 3NZHH 5MP6L 4X0KA 3CSGA 3B9EA 5ACZB 4FQCL 3RPKA 4W6XB 4ODHH 3CH1B 3RIAK 4XZUB 3BP6A 4RMUA 3UTTB 5F9JB 2OTWA 5TQ0H 3TA3A 5F6IC 1BJ8A 5ICZA 2HJKA 5EBWB 1NBVH 1IKFH 3GZKA 3C60D 4QXUH 3VWKA 2VL4A 5CZVL 2BVOB 1HI6A 1RURL 4TPRL 3RL2A 5DHXB 4M6AA 3QDMD 1Q9LB 4M6OH 3DUUA 2O5XL 1T1WB 2ERJC 3WNKA 1JGDA 2HFGL 4KXZI 3CC5A 1MJJA 4ZUSA 1IZKA 2DKUA 5JW5B 2F5AH 3MV7A 5FECB 2YK1H 3NFPA 1C5DB 4LOUC 1B88A 1C1EL 2B7DT 3G5ZA 5F89B 3LAFA 2GJ6D 1SEQH 5ICYA 5A16A 2VXVH 1E28B 4PJ8D 2EDYA 1RUMH 4HGWA 4Y5YB 2FD6H 4L9LA 3AROA 1U9KA 1PZ5B 4Q9RH 4O5LL 3RX5A 2R2HA 1OGAB 1FG9C 4ODHL 1NCUA 1WZ1H 4WI2A 4FQ2H 3ZKXC 1D9KA 4HKJA 5E4EC 4NNYA 1LE5A 5J13B 4NQUA 4PLOB 3GO1L 4C83A 1UXSB 3BP5A 4GLRI 1FBIL 3QRGH 1UG9A 2NY0B 4AL8H 4OLZH 3GI8H 1DUZA 3T0VA 1OAUL 3QQ3B 4PJCA 4LSUH 1MFNA 3H0TA 1ZXQA 4ZSOA 2ZUXA 2NR6C 1KPRB 3EFFA 5DEZA 1DCLA 1JYXA 1Q72H 4HH9B 4S1SH 5D7SH 4DZ8B 5MEOA 3SDCA 4U1KA 4PRDB 4I2XB 5MI0B 4FFZH 3U0WH 1G9NL 3DGGA 4G9FA 1MQ8A 5BO1L 5HHQA 5DEGA 5DI8B 2XZCH 1FZMA 3JBG7 4HXAH 1DDHA 1KTRL 2J88L 2VXVL 3CDYA 2IFGA 4JFOB 1YEDB 3GMRB 4F3FA 5DLML 1BZ7B 4LQ1A 3EJZC 3EOAA 4POZD 4DGIL 4NWTL 1WZ1L 3QUMA 2D7OA 2K7PA 3I6LE 3MRDA 4D8PB 5BS0E 1GL4B 2YD1A 1E4KA 1FN4B 3LN5A 25C8H 5E5RB 2NQCA 3TA3D 3S3SA 4I48A 4PJBF 4YC2B 2R0KL 4NFBA 4NUJA 4YE4L 1FZJA 3LKQA 2FRGP 3QRGL 4KV5E 3SE8L 4U1MA 3U36A 3VWKD 3GI8L 3D0LB 3SJVB 2VTFA 1G7QA 3MACH 4ZXBA 4N1EA 5E8OA 4YK4C 4D0DB 3KPLA 4X8JB 4ZG1A 5JNYA 4NSKA 3BIBX 1KIRB 3JUZA 1E4WH 5IVZB 3GGWB 2B4CC 2V2TA 1MCFA 4X7TB 1SEBB 3ULUD 3MV7D 1LP9B 2VZUA 2YMXH 3ZKNC 5F7EH 3WLBB 2OJZH 3ZHKA 3TV3L 2FGZA 2WMPA 3MRNA 3RWCB 4YH6A 5T1LB 1JHLH 3QZWB 4K3DL 1RMFH 3RWDA 2BNQB 4YHZL 4OT1L 4NO0A 1Y6MR 5AEAA 5TQ2L 1KT2A 3R4DA 4N0UB 2VZOA 2R2BB 4PJFE 3FAXA 5IB3B 2BHYA 4PGDA 1D9KD 2R56H 25C8L 2VSCA 3OF6A 4FZ8L 1HHGB 1I8IB 4Z7VF 4MNQA 4RCAA 4WUUA 5IBTL 5E9DE 3BQUC 3I02A 5E00A 1E4JA 2BRRH 2R1WA 4LSQH 1KJVB 1EEUA 4LPVA 3RX8A 1LE9B 4Y4FB 4UILL 1AIFB 4QRSB 3O3UN 3T8XB 1VADA 3MACL 3RZWA 4DN3L 3QDGB 4U4BA 3AAZA 1T89C 5JW3H 3MR9A 1ZLWK 1N8ZA 3SDCD 2J8OA 5T1MA 1A9EA 2R1YB 5D5MB 5HHPB 5J56B 1MCOL 4NNPH 4G9FD 4ODSL 4QNPF 4WRLA 2VLKA 5D1QA 3VFPA 1BLNA 1PYWB 1B4JH 3HZKA 5I1KH 1GC1C 2ID5A 4ORZC 3R06B 4LCYB 1KEML 3OHXB 1RMFL 3I75B 4M3KB 4Q6YA 1Y6KR 2BVUA 1P7QA 3VFNA 2ZNXA 3UTSE 3LY6A 4H5SB 2H9GA 4KJPC 4PB9H 1QACA 4RNRB 4MSWB 5CKGA 1PEZA 3WN5A 4UU9A 5H94B 1RVFH 3F7YB 2JJWA 1LO2H 4GW1B 2HFEA 4NKQB 4NBXB 1XGRB 2IALB 4ZXBD 4DVRH 4GXVH 3O6KH 4Q0XH 5GGUA 2MQCA 4U7MA 2F74B 2J5LC 4OUOA 3BZEA 4GAJH 1NGYA 1DANT 4LLYA 5A1AA 1I1AC 4DGVH 4PLKC 4KK5C 1FNGB 4Z7UB 3B9KC 2IAMB 3W9EB 5E2VL 5DMIL 2W9DL 2WWMD 4NO0D 3TM6A 2EDKA 3BH9A 4IRZL 3ZZ1A 3UZQA 3NCEB 3U7WH 2PF6A 3LPFA 3QUXC 3OF6D 5DDHA 4BFBD 4R90H 3MRGB 4Y16C 4MNQD 4WUUD 3SOBL 3V5KA 4RFEA 3KS0J 3C5ZD 3DYOA 4GRWH 4W6WB 3L6FB 3RGHA 1FCGA 1OTSC 4UTBH 3KPPB 1GGIL 2EEAA 5HJ3A 5IV2B 5I30L 3HRZB 5A40E 1KTLB 4K2UH 5ENWA 4FQQB 4GXVL 3H9SB 4Q0XL 5DJZA 3CZFB 3GK8H 2J4WL 4PY8J 5F7DB 2UY6A 3MREB 1IKNC 5LBSH 4X9BA 2ZCLH 5E6IC 2VLKD 1MIEL 4O2CB 5D1QD 3GNMH 1D5BB 3HUJB 3MODH 2ZG2A 4HZAA 3WFCH 2VDKH 2AK1H 4IRSC 5DRXA 1F00I 5A2IH 5FK9B 2DRUA 4QHNB 4Y4KC 4UMGA 1A1OB 1S7TB 3BVNA 1FRGH 2GI7A 5EOQH 4PY7A 1K85A 2AGJL 1NFKA 1P7QD 2RCSL 3L3DB 5BS0A 2ILLA 5DJ2A 2GSIB 2NY6B 3A6BH 1E6OH 1RK1B 2DLFL 1NMCC 2F54B 4XWGH 1S7XB 1N4XH 2V6HA 2FNBA 1U8OB 5D7JC 4X5XB 2M8XA 5KVEL 2OZ4L 2ATKA 1SVZA 2NZ9C 4I0KA 3N06B 4F58H 5JIPA 1P2CB 4MJ5A 4NRZA 1MUJB 4K2UL 1HNGA 1ERNA 1UB6A 1I7ZB 3PGDA 2IPUK 2PO6C 1L7TH 3MROB 4L4TB 5TE7H 3VI3E 1TCRA 3LDBB 4P49A 5FHBH 4Z7QE 4NDMB 3LB6D 1PX4A 2H32H 2ADFL 4YDJB 4KRPB 3OJMB 5LBSL 4XCEB 1A7OH 2D31B 2VYRE 3DX6B 3RDTB 4Y1AB 2AK1L 3ROOA 2NY1D 3ZE0E 3QDJE 4G6FD 1DE4A 5DJXA 2ARWA 3RVWC 1WJ3A 1JTPA 5EOQL 3IETB 1MVFA 3FTGB 3PWNA 1ZGLA 2IFFH 1MPAH 2B1AL 4PJFA 3DXAB 3KHQA 4MZ3A 4IMKC 1ZT1A 2H6PA 3IFPA 1FVCA 1VCAA 1K4CA 5LAXA 5E9DA 2AEPL 2NY5C 5I8KL 5I1LB 3QNZB 1VGEH 1UEYA 1JNLH 5H37H 2ZWLT 5EA0L 1ADQL 3FHQA 2FLRT 5GPRA 4JGJA 4PLJC 2NW2A 2XXMB 3NPSC 3SKNB 4F58L 3S96A 3IJYA 3MLVH 4ESKA 2BY3A 5BOZG 4NHCL 2R9HD 1NAMA 1UH4A 3LKOB 2E8YA 2JCCB 5FHBL 4N8VG 4HKXA 3DGCR 5GS1C 2QSQA 4X6FA 4UIKH 5E1AA 5TE6L 1LMKA 4G5ZL 1HILB 3O81A 3G6AB 2IH1A 1NBZA 4H8WC 4H88L 4F9PC 1GZQA 3VRLE 5FOJA 4YGVA 2E9JA 3X3GL 3JWDH 3I6LD 1ORSB 2GITB 3UTSA 5BS0D 2GTWA 4NC1C 5DK0B 1P4BL 1QLEH 4V1DE 1QFHA 1A6UH 1DVFB 4R8WH 2VO5A 4WNQA 4J3VA 1X5AA 1EJOH 4KKLD 4BUHA 3PHSA 2X2YA 1PQZA 4OB5L 3U82B 1JZ3A 5JIHA 4R96B 1LK3H 1HCFX 3GIVA 3QXDB 1I9IH 4LSSL 2XKNB 5FYLE 1TZIA 3VXOA 1BVLA 5C0GA 3LS4L 2LE9A 1AXSA 1BQHA 2RIKA 2YBRA 2XXCB 2F53B 4NO2B 3V0VA 2CMRH 1HINL 4QHKI 3HPLA 5FM8A 5C0EB 2BMKA 4R2GB 4HKZA 1G7IA 2O26U 3IDJA 3NABH 3NZ8A 4P9ML 4HK0B 4JANB 5KAQG 2A6DA 3GMQB 4YZFE 5J6HA 5FGCE 5J1AA 4NOFA 4PJHB 4FQLH 2EH8L 1TZGH 1XIWB 2BSTA 2A6IB 1H3UA 3O11A 2G5BB 2A74A 4G6JL 5D96B 2HN7A 4JFQB 4Q97A 3N9GL 3O3EB 3D2UA 4LOUD 4XCNB 3RNQB 3BZ4B 5E9DD 3RI5F 2B5IB 1ZHLA 3FJTA 1OGTA 4O2FB 1MHPH 4XP6H 5EU4B 3C6SB 1Y6NR 1H3VA 2XA3A 4YHLH 5DT1H 5CSBA 2BNRE 5ACMA 3VE0A 5IF0A 1JPSH 3P73B 3FQWA 2V17H 1T1ZA 3MGAA 1I9IL 3MLWH 2QEJA 4YPGA 1NANH 1TJHH 4MZ2A 4ENEC 5GSRA 5ESQA 3MV8B 4IM8A 3PABA 2XQYG 1U2HA 1MLCB 2CMRL 3L3HA 3BQUA 3TCLB 1V8HA 3VD5A 1HEZB 4DWHA 1XF4A 2X4TB 4S2SA 5C0IA 5HPOA 5FDYA 4PUBL 4P9HH 1QR4A 5FA3A 2ZUSA 3KPQA 1KIPA 1SBSL 2P5EB 3PHOA 3CSYB 1Q38A 3QIWC 1MFAH 4WW2B 1Z5LA 1H8SA 2NR6D 4M8QB 2YPLB 4JEGB 4FQLL 2H8PA 1N6VA 2EIEA 3UTSD 3L95A 3HS0B 5EO1B 1URLA 5EIIB 2AJ3A 1V7NH 5GJTH 5HI5C 3IFNH 2MQ3A 3FHAA 1QRNB 3ABZA 4XP6L 1FNEB 4ZODA 1FZOB 4YHLL 2DWEA 4OCYH 1NCCH 1UACL 4E5XB 2DQGH 1JPSL 2V9RA 4TRPL 3EUUA 1ZA3B 3EJZD 4JLRB 1CCZA 4LEXL 1CD1A 5E7BA 5F21B 3UTZA 3GJFA 3JWOH 2V2XA 3CCHB 3QEHA 4ZO7A 2IJ0C 3GSUA 1LO4H 4PBVC 2HLFD 4NC1E 4NP4H 2VITA 4YDLC 2DIBA 5EC1A 5B8CB 5J12C 1RUAL 1RUPH 2UYLA 4NN7C 3HZMB 1RJLA 3B2UD 3V79C 3QG6B 1JI1A 3LV3B 2NX5B 5GGTL 4DKEH 4K7PH 3H3PL 3QDJA 5ESAA 5T5NF 2Q76A 3MNVB 1YEFL 4CVZB 3GSNB 4JCLA 3MLUH 3MRRB 1PBYA 5CMAA 4OD2B 1R5VA 3MJ9L 5I1JH 1JTTA 2DQUH 4WENB 5MEPB 1Q9KB 3FFDB 3FO0H 1GOFA 4QRUB 3D2UD 3ROLA 3ZKND 4WHYG 3VRIA 3JV4B 5HVHB 3MRCA 2ARJB 1I1AA 3QXAB 3EHBC 3B9KA 5HHME 2M26A 4OD1L 5I1DA 5AG8A 2MJWA 3CU1A 5HVFB 4A2MA 1Q0YL 1BFTA 1E4XH 4IS6A 3K81A 5JLZB 1N5YL 4F7CB 4I77H 3JWOL 4OKDA 2UY7A 3AC0A 3U9UB 4UQ3B 5CUSH 4R26L 5DHYB 3VI4F 1PX3A 2P7TB 4L8SB 3KWWA 5FOBA 3QUXA 7CGTA 3LIZL 3LZFH 4WUKL 2CJUH 5CKAA 4Y16A 5CJBA 2O61B 3BQUD 3IGAA 1RIUH 1IL1B 2PNDA 4XC3H 1SJEB 5I1GL 2BY0A 5IR1A 4G8EB 1K4DA 2CPCA 3C2AH 4LAJH 3PHQA 1XZ0A 3MLUL 5DRZB 2IH3A 2DQUL 4KPHL 3QG7H 4KGJA 3LQAL 4V1DA 1IKNA 5E6IA 4J6RL 3BN9C 4NQCB 1CXEA 5D93B 3RU8H 1NBYB 2NY4D 4IRSA 4QF1A 4Y4KA 1RZ7L 4PGZA 3OGCA 1XH3B 1UQSA 2O5YH 4H0IA 1ZHBA 3LEXB 3RL1A 1IGMH 3LKPA 3FQXB 2AI0L 3F8UB 2NMSA 4LCUA 1CFNA 4WTZA 3BUTA 4R7NA 3LZFL 4OM1L 4KJPD 3IXAB 1DQDL 1NKOA 2A2QT 4EN3B 5GGRA 4O02H 2I07B 4OCRL 4PREB 1CGYA 5DQ9B 4Z0XB 5CD3B 4O51B 2XNAB 3FRUA 5D7JA 4B0MM 3CSBA 3VWJB 1HIML 4G8IB 3TP4A 5BOPA 3QDJD 4P2QE 2HKFL 5E70A 3EIFA 4OZ4B 3REVA 3KS0H 5E08H 3B4NA 1C7TA 5LGHH 5CINH 2ITDA 4U1NA 4FQHB 1LEKB 2PO6A 1H3PH 4HWNA 2AERT 3WFDH 4TSCL 1Q8MA 1NC4B 4QO1A 3FN9A 3KYMA 3RWHA 5ICXB 1I1RA 1I1AD 4PLKD 4KK5D 3GSOB 4P2OC 2HH0H 3B9KD 3QFDA 2BNRA 1FFPA 4HKBA 1FZKB 2YN3A 4W81A 1QHOA 3ZDXF 2O5YL 4WHDA 4JN2B 3P0GB 3TBTB 2DWDB 1L9MA 1FL3B 2PW1A 5GIRB 1OAYH 3CD4A 1A2YA 2NNAA 3QUXD 4IMKA 3TPUA 1MRDH 4Y16D 2BY2A 2IWGA 1ACYL 1FYTB 5EUKA 3QUKB 1OTSD 5D1XC 5DUPH 4M1DH 3ESUF 5E08L 1A14H 3EOBB 3U4EA 5CINL 1KPUB 5L88L 1JGVL 1D5MB 2DQTH 3MO1B 3WFDL 3GSXA 3PWUA 3QUZC 4UT9H 1WTGT 1F4AA 1U41A 1EGJH 3QJFB 4V2BA 4V1DD 4A6YB 5GS1A 1F6LL 5E6ID 4LSTH 3OJVC 5EULV 5LGKA 4AG4H 4ZUVB 4L8DB 5TPWL 4IRSD 4Y4KD 1U58A 4HPYL 1NANI 1AI1H 2X1PA 1QVOA 3ZO0A 4F9PA 1D5XB 4U1HB 1GGBH 5IFAL 3ULUH 5SV3A 4TSAH 5FYLD 3GSVB 1P7HL 4PJIE 1B0RA 4NZTL 2Z93A 1NGWA 2MKWA 1C7SA 4J8RB 3SGDH 4M43H 1MCBA 4PJGE 4DCQB 1IEHA 5B39B 3TFKC 4M1DL 5D7JD 1EHAA 4AH2B 1HSAB 2DD8H 2NZ9D 4OQ1A 1K6QH 4NKMA 4MNHB 3BDXA 2CK0H 1UYWH 5AUMA 2XZZA 5CIPB 2PO6D 2DQTL 3I3DA 5IMMA 4ODUB 2EDHA 5I8OH 1GSMA 4PS4H 4K94C 3HE7B 1S5IH 1EXUA 1A64A 1OAQH 4YHPA 3BP4A 3HN3A 1XGPB 1H5BC 5FYJE 2BNRD 3GBNH 1AI1L 2CLVA 2AJZA 4WJ5A 3RVWD 2HT2C 3ZSTA 1ITBB 2AABL 2VSDA 1A9BB 4Y19B 1C12A 1ZOXA 4IIQC 4XPHH 3ULUL 3T65A 1HSBA 1TZHB 5BV7B 5IMKA 4NWUL 1R3KB 5IESL 5KOVC 3T2NL 3V6FB 1JPFB 1ZT7A 2EEDA 2BZDA 4KKBC 4U31A 4XB7A 5ID0B 1KF9B 4HW6A 4JZOB 1SYVB 1NFDE 3MV11 1E6JH 4JZJB 4MYWB 2VDOH 4QTHB 4XMPH 4PJ9C 1LGVA 4PLJD 3QUMH 2D7PA 3D85B 2CK0L 2X05A 5DR5L 1UWGL 2QSTA 5FCSH 3FL7A 3GJEA 1BX2A 3S35H 2C3XA 1U36A 5T3ZE 1W72A 3B5GA 1CL7H 1KTDB 2VISB 3IJSB 4LHQB 5KZCD 4P0DA 4Z5RA 1E4XI 2NXYC 5IT2H 1X7QA 1MHHB 3CX5J 1EPFA 4YHKH 1ZA6B 2EIZA 3QIWA 3D25B 3OSKA 1ZLSL 5IMOA 3T3ME 3I85A 4DJMA 5MENB 1W0YT 2AJYL 4MMZC 4HWBH 3CPLA 1G6RH 2VWEE 1YEIL 3IFLH 2WAHA 3TT3H 4FS0A 4WW1B 1IARB 4YNYA 3R0MA 5DZLA 2VDOL 3JV5A 2P49B 3UMTA 3ARSA 1AD9A 4P2QA 3ARGC 2OSLA 1I8MB 3QEQB 3FQTA 4XT1C 3WFBH 2QHRH 5A2FA 2HKHH 4RGOL 4LCCC 3TO2A 1JGEA 3CIQA 3D6GA 1DQJB 4HS3A 4QT5A 1AHWB 5IROC 4TOYH 1CS6A 3O6FC 5B4MC 1DUYB 1U8MB 1LO0H 4XH2B 5JPMB 3OTTA 3AS3A 3RWCA 1JZ7A 4C59B 5JIIA 3K4DA 4FTVE 2ZSVA 5F7NC 4ZS7H 5J9PA 4KDVA 3DSFL 4HPOL 2FZ3A 2ICEA 4QRRE 1OLZA 4XGZB 1S7RB 2CIKA 2HG5A 4PTTA 4X80H 2DLIA 5HHMD 5IT2L 3HC4H 2VERN 4YHKL 4PJEF 4U1GB 3KPOA 4ZYKB 2H3NB 5DQDL 1JPTL 3U0PB 1NCWH 1N5AA 3UPCA 3BKYH 1DEEB 2XQYK 1LE9A 4M6ML 3IFLL 1GH7A 3L9RB 3CSPA 2DBJA 4Y2DC 1Q1JH 1TPXB 5F1OB 1KLGB 2BSED 4IRJB 5B38A 1SY6H 3DLQR 5F9DC 1W0WA 5C0DB 1BD2B 1NQBA 5IVNA 3MBXL 5GGSY 1PYWA 4ENED 5LXGH 4X98B 1G7MB 5IB4A 2RQ8A 4X6EB 2FX8H 4P2CG 3I75A 3DURA 3O2DH 3QO1B 4Z7OF 2IGFH 4ZS7L 1X5LA 2MWCA 4BFIB 5DMJB 2R8SL 1OB1A 1HZHH 2ESVE 4X80L 3SE3C 2HT3C 4ODXB 2V5TA 4DK6A 1UC6A 1U6AL 2JB6A 1NUFA 2R4SH 3HC4L 4H5SA 4WHTB 3QIWD 3KPNB 3VMNA 1S9XB 1DLFH 1HQ4B 1H3WM 1NCWL 3RJQB 1QEWB 1N6QH 4PJIA 3T0BA 2VZ1A 2X7LA 4IJ3C 5HBBA 2GEEA 5TF1L 3UTQB 4UIMA 3LQZB 1QSFB 3MA9L 5CEYB 5CBEB 5HI5D 1CN4A 2HJLA 3MFFA 4PJGA 3AREB 1JN6A 3BEWB 1N7ML 3JXAA 2W59A 4HJGB 4P2QD 3WIIL 1RUKL 5FM5O 1LHZA 1CVRA 4IHOA 1JZ5A 1UM6H 1AXTL 1T66C 5CZKA 1CR9L 3O9WC 2AK4E 5F97E 3OJDA 3WBDA 4HV8A 3N0PB 4CNIA 1A22B 1QQDB 3CK0L 3OZ9H 5F1IB 2FX8L 3OX8B 4Q58C 1T2JA 1L0YA 1XEDA 2IGFL 3WIFA 5SWSB 1KFAL 1R24B 2DTSA 1NEZG 4RRPA 2R4SL 1YEHH 4RWYH 1TVDA 4FXLA 3QHZH 1DLFL 4O9HH 2WIMA 4MWFA 1RZFL 3SGDI 2OP4L 1N6QL 1GGYA 2HVKB 4HF5L 4PP2A 5SX5H 2X9WA 2VQ1B 4OLXH 1HHKA 4LEOA 5T5FL 3ISWA 4DK3A 2WANA 5K59F 3I50H 3P3YA 2FL5B 3TBSB 1UKQA 2BCKA 5BXFA 1NFDA 3EHBD 4OGYL 4P2OA 4U3HA 4I0PC 4YBLB 4F7MB 5EO9B 2F19H 5C0NC 4Z76B 3RVVC 5IJVB 1UM6L 2EECA 2UWEF 1JV5B 5GJSH 4QCIB 4AJ0A 2VLRE 3RWJA 3QNXA 1NCAH 4M7ZB 4PJXB 1I8KB 1OAXH 2OM5A 3KPMB 4ONHB 1A1OA 1A7PH 5A2LH 3BT2H 1FNFA 4XAWH 4J4PC 1IAKA 3MRPA 3REWA 4YWGL 5I66A 5IKCB 4PRPB 5D1XA 3C08L 4I9WE 3RTQC 2FEDC 4JY6B 3UPAA 3VFVB 2GSIA 5L8JB 1YEHL 1BEYL 3K74B 3FQNB 1RJCA 4TN9A 4DZBB 2PW2B 3INUH 2LU3A 1VHPA 3QUZA 4OLXL 5E8NB 4XTRC 2VXQH 1I3GH 1ZHNB 1K8IB 3GB7B 5KS9B 3MLYL 3BN9D 1EEYB 3MOQA 3DO3A 1OAKH 1BJ1H 4OD3L 1JNNL 1JFQL 4N8CH 4Y4HC 4ISVB 4M9PA 4NCC2 3RUGF 5IFHL 1I7TB 2ZUYA 4ZPTB 3L7FB 4RGNB 3CFKA 1WBXB 3PL6C 1CL7I 3UJTL 3IF1A 5EZJA 2Z91B 1S5HA 4Y5VC 1A7PL 2ZJSH 3BT2L 4QXTB 3QWRA 4PTUA 4FTVA 2F15A 4QRRA 4Q9QL 1G7LA 4BUGA 5FYJD 4ONGL 4O2EB 3BPCB 4MD4A 4LPUA 4OF8A 2W65A 4MQTB 3U83A 1RZJC 3BEVB 1DQLL 2X4UB 4HD9A 1JL8A 3OAZK 3QNZA 3RIFK 1YEGL 5E5UB 1GPOL 4K7PX 4NZDA 1F3RB 3FB5B 5DJCA 1BVZA 3P4NA 3Q6FB 3WMSA 2WLZA 4YFDB 4P2OD 3TNNA 2Z35B 1H5BA 5INDA 5FUOH 2DL2A 4PGCB 3K4ZA 3MOAL 4MHHG 4HC1A 4IIQA 3X12B 4NT6B 4CJ1A 1T7VA 3F7RA 3STZB 2ZJSL 3F58L 3G6AA 5T3ZD 3GHEL 3NH7H 4L3EB 3QIBB 5IEHB 1JWMB 5D1XD 4PJ9A 3KJ6L 5DD6A 2ESVA 4WTZG 2J1KA 1PLGH 2X4OB 4M03A 4OZHF 2EC8A 1NAML 3LKNB 3MRQA 3NGBC 2ZP0T 3D18A 1HXMA 4XXDA 5SWQB 4B50A 3ZE1F 2E9IA 4N5EC 2VKXA 4NKOB 1U8KA 2R2CA 4XCFH 4YO0A 2NW3A 5BMFH 2Q6WB 3QUZD 2XN9B 2YD3A 5E0QA 4WV1B 1HNFA 2CSPA 3QHFH 4QOKE 2W0LA 3KYNB 5JXEC 5HGBB 4QYOB 5JO5B 1L6ZA 4KK9C 5F3BB 4PV8A 3VCLA 5I16B 5I18H 4O58H 2AXJA 4NPYA 5EU5A 2I9LB 1WBZB 2B4CH 1J8HB 1ZSDA 1FG2B 1OT1A 4HIXH 4WWKB 4A6YH 3ZDYF 2AK4A 4DGYL 3THMH 4BQCA 4HIJA 1F3JB 2PYEB 3RY5A 5IVXF 4BZ2L 2G60L 1MCPH 5AYUH 3QWRD 4ZAKC 4JRXB 4OCMC 4UINL 4FTVD 3WXVH 3ZYOA 2I25N 3HTLX 3TFKD 3EZJB 4QRRD 5E95B 1QFUH 4K23H 5JIKA 1I4FB 1TJIH 3O4OC 4CW1A 3JTTA 1AH1A 5SX5K 1MRFL 2EKJA 4HBQA 4LCCA 1U3HC 4JN1L 4AT6B 5F96H 4F7TB 5IROA 4OCSH 3O6FA 3QH3A 3SEPA 5BMFL 3BKJL 5DGQA 1X6NA 4K7FA 2Y23A 1JBJA 4CMHC 5T33H 1VFMA 3K2UH 1BBJA 1AE6L 1N2RB 3QCVH 5CIPH 1IAOB 5IB2A 4O58L 2HT2D 5C08B 5DYOB 1MF2L 3EDJA 1FGVH 3GI9H 3P9MB 2DBLH 4GSDH 4HIXL 4KAQH 4KUZH 5ADPH 4JO3L 2VLRA 4G6ML 5F93C 4JG0L 2BC4B 3VXMB 3GMMA 4OCLC 2CLRA 1WFNA 3MRLA 4HWEL 4WCYH 2P5EA 4KKBD 4YIQA 1GC1H 3PDOB 4ZFZB 3QO0A 5JORB 4Y2DA 4OI8A 2FIKB 4M8QA 4U1SB 3WXWL 4PJ9D 5BJTB 2ESVD 2VAAA 2ZUVA 5CJOH 3FT2B 1YYML 5I15L 5L0QC 5BV7H 4MX7A 4Z0BH 1RD6A 5FYKU 5H35A 4XPTL 1N0LA 2NTFB 4NQXA 3SDDB 5CCKH 1FZOA 2DMKA 2XIDA 1OP9A 3RNKB 2BRQA 4PJ7B 4WI3A 3PP4L 4E5XA 2VDMH 1C5CH 3S88H 1JPGB 1S3KH 5F7LB 1UM4H 2Q3ZA 2K3TA 1BFOA 2BVTA 4LSPH 2NXYD 4LHUA 3SE3A 3ZT7A 3QCVL 1KB5B 5I0DA 1B6UA 5E99H 2EDFA 5B8CA 2VXSL 5IHZB 1OOAA 1IILE 2DBLL 5ADPL 4KRNA 5FHAL 5FO9B 3B6SB 5JXAH 1YEJL 2AK4D 1QG3A 4GMTL 4NUGH 2CO7B 4W6YB 4BQ9A 1R0AH 2CXGA 1CF8H 3VXRE 4H1LB 2FO1A 1GC1L 3DBXB 5DS8B 3DROB 2ATPB 4DEPB 4GRMB 4MCZB 1U8IB 3SDXB 3MRRA 2EDTA 4ELMB 5CJOL 3ARWA 4L8BA 1PZUB 1XCTA 2X1XR 5INCB 2GUOA 3VRJA 4P5KB 1JRHL 3O9WA 1KENH 5D1ZB 3O6FD 5B4MD 1SYSB 1T1YB 4NNXB 3M45A 2FJFB 1XCQA 2VDML 4UDTA 3F5WA 1S3KL 4P3DB 3AFLA 5JLZA 1SJHB 4JO2L 4NM4H 4MXWH 3V6ZB 5JOFB 4HIHA 1MLBA 1FPTH 1FDLL 3D3VB 1GOHA 3OQ3B 3U6RA 5I74B 1O7SA 4HHAB 2VLRD 1KCSH 4L9DA 4XMLH 2NY2B 5E8EB 3MRKB 3WNMA 3MRMA 1TQBB 2YC1A 5K9OB 1R0AL 3BAEL 2MMXA 1PSKH 1QR1A 3T3PF 5E8DL 4GRWF 43CAA 4Y2DD 4JREB 4I0PA 1EHLL 4I9WD 1UZ6E 3L5XL 3OXRA 5B21A 2E3VA 4PV9A 2EYSB 5EC2A 4NZUL 3IDYB 4FNLH 4XPFL 3VXSB 4ODTL 1AGFA 4TUKL 1MJ7H 4OAWA 5IW1A 4GKNB 1V3JA 4OIIL 2XPGB 1CDHA 4Y5XA 3A6OA 4JB9H 2LTQC 3EO1A 5HI4C 3MNZB 4FQJH 3DTXB 5EBLB 3RHWF 4AIZA 4DW2L 3FB6A 4J4PA 1DQQA 4HJJL 4QOKA 5DJYA 1KCKA 4DTGH 5GRXG 3RTQA 4GG6F 3TIDA 1EZVX 4LHUD 2B0SL 2HT3D 5C0FB 3FOLB 3B3IB 3R8BB 3S35X 4F80A 2BSSB 5F1KC 4UQ2B 3ARFC 4PREA 5KSUA 1UXWB 2GYSA 4MNGB 3DVNA 1Z9SA 4OV5A 1KJ2B 1PSKL 5GSVA 5M94B 2D7QA 1F8TH 2EYTB 2FWOB 3EAKA 4JM2B 4K3EL 2A0LC 3IFOB 1A0QH 1RZ8B 1IAIL 1UM5L 4Y4HA 3DVGA 3AU1A 3JSSA 4P23C 2P43B 2WP3O 2X1WL 1H15A 5FYLL 3R8QA 4NO3A 3MLXH 3QPXL 2VDNL 4KROB 1T66D 1MJ7L 3VFGL 3O9WD 3PL6A 3K46A 2P5WE 5FO8B 3N85H 2V7NB 1DQMH 4FP8H 4Y5VA 1OARL 1ZHKB 2H1PH 5B38G 5DEFB 5ILTH 3RWFA 5C1MB 5KW9L 3O3BB 4HH8A 1QA9B 3WHE0 1T0NA 4HT1H 3W0WE 5JPNB 5J3HC 3SKJL 3CX5K 3NIFF 3LPWA 1I7RB 3ULSB 2V2WA 1IGIL 5EUOB 5FO7A 1MI5E 5IGXH 3U4BH 3C5SB 1J10A 3MXVL 3VFOB 3GSQA 4IMLB 4ODVH 5JTWA 3HNVL 5JUEL 3GJFK 4ONFH 1YPZB 1MRCL 1A0QL 3GDBA 1QP1A 3FZUC 5DURD 4XNZB 4I0PD 4Z77B 5C0JA 1HDMA 5C0ND 2FX9H 3RVVD 3MLXL 3ARGB 3ZMRA 4PLNC 1XR9A 2CRIA 4LCIH 2YD6A 3KXFE 2HFFA 4OCNC 1HWHB 1CVSC 3UJJH 2Q86A 2NY5L 2CUHA 3QEUA 5C9JA 3HZVB 4D9RE 2ZOKB 1IT9L 5IQ7H 2AP2A 1CU4H 2BHZA 1NC2B 3MJ7B 1A6ZA 5TE4H 4U1HA 4LRNH 4J4PD 4HT1L 4QOKD 4OTXH 3PJSB 3S4SB 4MXVF 3RTQD 2C3VA 3LRSA 4QRTB 4F37K 3MLZH 1HH9B 3WHE1 3KYAA 5KSBE 5KSVB 4HS6A 3X13B 3ECBA 4NN6B 3I84A 4OLVL 3K8LA 5BCAA 3S37H 4XTRD 1J11A 4ODVL 3QNYA 4RRPG 5DD1L 3TVMC 3VXRA 4TTGA 4ONFL 1AKJB 1MCIA 3FN0H 5H8DA 4Q6IB 3C9NB 3QQNA 5FF6B 3SGEH 4ALAH 4M4PA 3ARDC 5JXEA 3NCBB 4H8WL 1HYRC 2PETA 4Y4HD 4OCWH 3C8KB 2FYYA 3QIUC 4XC1H 3AXLA 1ZT4A 3ZHLA 1D5IL 2FJGA 5E56A 4YXHL 3CVHA 5D8JH 3A0OA 3JV6B 3PL6D 3F62A 4X7SH 4OZIB 1EEZB 4ORGB 4U6XA 4M7KL 1AFVH 1K5NB 1NFIA 3DRTB 1J12A 4ZAKA 5TE4L 4OKVA 2BERA 3LRGA 4JPKH 4OTXL 4YHOL 3U4AA 2FHFA 3VDAA 1EO8H 5ERWA 2L0DA 4P5MA 1I7UA 2IBBA 3CVIL 3OMZA 5IIEA 1UA6L 1X5IA 4EBQH 5JW4R 1U3HA 1M7DA 4KTEH 5DF0A 5JQHC 5JOPE 3GM8A 3IDGA 5FGRA 3U46B 1SYVA 1IM3B 1YJDC 2Q20A 2VKWA 5DTFB 5DHVA 3D69A 5TJWK 1W72H 1O0VA 3S37L 5EU6B 4Z8FH 1JMZA 3FN0L 4X4XB 3O3DB 3ARQA 2KH2B 4OCWL 4E0RA 4I3RH 1MNUL 1YECH 4XC1L 3GMLA 4LLQB 4KUCF 3RX7A 3T4AA 4BSWB 3IJSA 1RJZB 3OR6A 1WEJL 4P46B 4G8FB 3U30B 2J2ZA 3KLHC 5L9DH 3LH2H 2XWBB 4JPKL 4F7PA 1U93A 4RMSA 2FCBA 2ED9A 5F88A 1ORQA 3G6JF 5BZDB 3TJHD 4NQVB 4NRYA 3CDGB 1JYNA 5B3NA 5I76A 4PRAB 2G2RB 4OUUB 2VLJB 1A6TA 4ETYA 4N5ED 1W72L 2BNUA 1MH5A 2ICCA