4P4RA

Structural basis of chronic beryllium disease: bridging the gap between allergic hypersensitivity and autoimmunity
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
178
structure length
178
Chain Sequence
KADHVSTYAAFVQTHRPTGEFMFEFDEDEMFYVDLDKKETVWHLEEFGQAFSFEAQGGLANIAILNNNLNTLIQRSNHTQATNDPPEVTVFPKEPVELGQPNTLICHIDKFFPPVLNVTWLCNGELVTEGVAESLFLPRTDYSFHKFHYLTFVPSAEDFYDCRVEHWGLDQPLLKHWE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of chronic beryllium disease: linking allergic hypersensitivity and autoimmunity.
pubmed doi rcsb
molecule keywords HLA class II histocompatibility antigen, DP alpha 1 chain
molecule tags Immune system
source organism Homo sapiens
total genus 32
structure length 178
sequence length 178
chains with identical sequence C
ec nomenclature
pdb deposition date 2014-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00993 MHC_II_alpha Class II histocompatibility antigen, alpha domain
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4p4rA02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 4p4rA01
4Z7UB 4ODVH 1A6ZB 3KXFD 5DHVB 43C9A 1KPUA 1C7TA 5IW1B 3NFSH 4P4RA 3B9KC 1AHWB 4Y4HA 4TULL 1BZ7A 4XBEH 4O2CB 4MQ7B 2Z4QB 2JIXD 3G6JA 4LP5A 4N9GA 2F5AH 5T3XH 3RX5A 3UYRL 2CJUL 2NX5D 3AM8C 1SJHA 3MNWA 4M5ZH 4OM1L 4HIEA 5I1EL 5J89A 4EIZC 3MLSH 4XPGH 1GVIA 4ZUWB 3IDUA 5FHBH 1CL7L 3DX8B 2MOVA 3QWRA 4HKBB 4APQB 2DQEL 3BQUD 1FZJA 5ID1A 1AHWC 2CR3A 1MVUA 2VIRA 4HWBH 3AAZA 4NRYA 4DKFL 1QA9A 5EWIH 1EHNA 2VDRH 3H9HB 4ODSL 2C1OB 4XAWL 5KVMC 3PGCB 3F6IA 4MAUH 4EVNA 4ENEC 1OB1B 4JPWH 2FWOB 3NVQA 4FP8H 3HNVH 3DV6A 1TZIA 2IGFH 1IAMA 1J0IA 1LILA 2UVEA 1KCKA 5IGXL 2FLRT 1QYGH 3HRZB 2CMRL 2H3NB 3NBNA 4APQC 3RVUD 1CE1H 4P3DA 1N5YH 5I8EB 2IALB 1RHHA 1QO3A 5D1ZB 3LEXA 3D39B 2APXA 1A4KB 3BZ4A 3S4SB 3FB8A 1GGCL 3ULVC 2B4CH 4FTVD 2YK1L 4QWWC 2FYYA 4DCQB 4F7TB 1BIIA 2A6IA 4HV8A 4KKAC 5ESVB 3C2SA 2WK2A 1XGTB 4OCXL 4CUCA 1AE6H 1NEZG 5CBEB 2ZG2A 5DQDL 2J88H 3U30B 4YDJB 2ENYA 4ZSOA 1UXSA 3ZT5A 4L4TA 3X3GL 5C0JB 5D1ZC 3L6FA 2WWKT 5CMAA 1WUNT 3FRPA 4LF3A 4PJ7A 5K9QI 1C5DB 4Z7OE 1FL3A 1IGTB 2VYRE 4HK3N 1KJVB 5JHDE 4DEPB 3WFEH 3BEVA 3GI8H 4G5ZL 2CLRB 4LVHB 3UZQA 2ICCA 3BO8B 3U30C 3HI6H 5ITFB 3V8CA 4JFYB 4S0SD 5TFSL 1LEIB 4X7DC 3K1KC 5EBMA 3U0WL 3KLHD 4PB0H 4NN5B 3SDCA 4AMKH 3IDGB 1DL7H 2I5YL 2VKWA 3INUH 1GPOL 1VGKB 4JANB 5D6DC 4PFEA 4PJDE 1I7RB 2NY7L 3MRJA 2JJSA 4QRRD 3EDFA 4H1LG 2MCG1 4DEPC 4F58H 2V7HA 2ZUWA 4LVHC 5E9DE 3BSZH 1KFAL 3LZFL 4HUWB 2CKBA 3MJ9A 1HHGB 5HHME 2AJ3A 4MA3A 5ERWB 1QQDB 4IJ3B 2EDOA 3X14A 1RIVH 4NN5C 1UXWB 1G7LB 1U2CA 4M7JL 5BZWB 1EBAA 5DVLA 2VOTA 3NACL 1K4CA 3TPKA 2GSIB 3G6JE 4IRZL 2X70B 2VDOH 4LSUL 2B1AL 4Z5RA 5LGJB 4KI5C 1F3JB 3AC0A 3RAJH 2J12B 3VXMD 5F1IB 4NWUL 3QZWG 1ZHNA 5IROA 1B0GA 3CXDH 4XH2A 3SGKC 3CFEB 5DMIH 4XP6H 1F4WH 4IJ3C 4OKVB 3IGAA 2Q7YB 4KMQA 3V52L 1MSPA 3X3FH 3AREA 4PJAF 4PJIB 1BJ8A 4HGWA 4N9OB 2CQVA 3EYOB 1WICA 3C6LD 4K23L 3T0EB 4PJDB 4EUPG 5F7WC 1JGUL 1OCWL 4O00A 4XPTH 1BX2A 4IRJA 4X98B 4RGOH 3BD4A 4H8WH 3NIFE 5E9DB 5I18L 3IXAA 4NQCB 1AO7B 3V4UL 1P84K 1YNTB 4Y19D 43C9B 1KPUB 2JCCA 2OR9H 1HH9A 1CR9H 3G5VA 2R0KL 3N85L 1M05A 3P11L 1KIQA 2MQCA 3T0EC 4P5TB 1VACB 5GZOD 1UYWH 2VAJA 4P4KD 1XCTA 2BCKB 3G6JB 3PV6A 3ARDD 1UKSA 1SJHB 3PWNA 3RWCB 1KCUH 2XG4A 5T1LA 4WNQB 4HIEB 3SBWC 4OTXH 2A73A 4DW2L 4BELD 3MODH 3BUYA 2R2BB 3CVHA 4ZSOE 1MFEH 1RUPL 3NCJH 3EJJX 4L4TE 3WNOA 5ID1B 3GBNH 1MVUB 3SE3A 2WINA 1QA9B 4LLMA 1ZSDA 3BN9D 4PJ7E 4P5TC 3T0WA 4MXQD 1IGYA 2FR4B 2UWEA 4EVNB 3H7BA 2FGWH 1JP5A 3F5WB 3FHAA 1TZIB 4XP1L 1CZ8L 4LSTH 3F58L 1JMXA 1A3RL 4KDTA 1QR1A 2R4RH 1G7QB 3TZVD 1KN4L 1MWAH 5FDWA 3LEXB 1OWRM 1ZVYA 2FJFA 4FQXD 3VXTB 2XZQL 1OAQH 4WCYH 3FB8B 1BBJB 3RPKA 2IH3B 3ZE0E 4C56A 1AGBA 3I2CH 3IRPX 4P5MB 2EYTB 5JORB 2IFFH 3R8QA 6CGTA 4ODUB 2ED9A 2Y5TA 1I8LA 4EDWH 3D2UD 3QCVH 3T1FA 1T22B 3EOYG 4OZFB 4K94C 4F2MA 3P3YA 3L6FB 4X4XA 3MBXL 4MJID 4W6YB 5E2TL 2OM5A 3LIZH 2VL5A 4BQBA 3EYSL 1H8OA 1S9XA 4HC1L 4M4RA 5GRJL 1BJ1J 3ALXA 5IT2H 1IEHA 5E99H 1ADQA 3HI1A 4JLRA 1A1NA 2AEIT 5CD3B 5EBMB 1BVKA 4X5XB 2J5LB 3FCTB 4J23A 3RNKA 5FYKL 4YAQB 3Q3GB 4MNGA 3V6ZB 2OK0L 4CVZB 5JOEA 4I5BA 3EO9H 3FQTA 3W82A 4RX4A 2W9EL 4Z7WA 2VZ1A 3MXWL 4U1HB 2V7HB 3NZHL 3ECBB 3V2AR 2GJZA 1B9ZA 1CXEA 1NUDA 5HI5D 3DSFL 1UKTA 4N8CH 3BJLA 3X14B 2JCCE 1CE6B 2J5LC 5D7IF 1C5BH 4OD1H 2J3SA 2W91A 1DEDA 2AJXL 4AG4L 1L0XA 2MHAA 1RZIA 2ZKHH 1EDQA 3UDWC 2JJSC 2FH8A 1UENA 5CSZB 3CZFA 5HGHA 3F7RA 1NKOA 2DQDL 2ZUUA 5E0QA 3QH3A 3HUJA 3IJHA 5JOPD 3QPQC 5FHAH 4K2UH 1B0GB 1PG7X 4XH2B 4BM7A 1DLFH 4HKXB 2Q6WA 1N0XH 1VPOH 4Z8FH 3Q48A 1BQHA 3HMWL 2V6HA 3IGAB 5IM7B 4B41A 3PP4L 3S36L 3AREB 3C08L 1JYNA 5DJZB 4TRPL 3ZE2F 5DK0A 1XR8A 4GLRI 2DJ4A 2UWEE 5E4IA 2W60B 2ZCHH 3RA7H 4OCMC 3W81A 1HI6B 1JHKH 4GH7B 3E2HB 3T4YA 2NW3A 3TH4T 4F33B 1Q0XL 4FZ8H 3MLUL 4JREB 1ONQB 4N8VB 1NFKA 3S88L 3JXAA 2EYRA 5C0ND 1FNHA 3AREC 3GB7B 1VFOA 3KJ6H 4GRMA 3KPLA 4JDZA 5FKAA 2ZCLL 2DLHA 1KIQB 2P7TB 1A6TA 4C56E 5IMLB 3DECA 3FL7A 4JAMB 4EQ3A 1XCTB 4NQXA 3PV6B 5EUOF 5DJCA 4LLAA 2OZ4A 1CDHA 2J7LA 2LU7A 4NUGL 5FGBA 3E2HC 1JUFA 3GZKA 1OY3B 4MB5A 2RB8A 3VFVA 1FFRA 4PUBH 3TT1L 4M48L 3MFGB 4JREC 1GGYA 4B7LA 3MROB 2R4SH 5J1TC 5EU4A 4R7DA 3TIDA 3UYPA 2AJYH 1TZGH 4OFYD 4XNMB 3MRIA 1KJ3L 1KGCE 2IMNA 4HXAH 1CF8L 2WINB 1PX3A 4HKJA 1BLNA 5HDQH 3UROR 5I2IA 1N7MH 3CJJA 1N64H 1EEYA 2IQ9H 3MA7B 3JV6A 2MCPL 2EDNA 5LQBH 4PJXA 3ELAT 4PGCB 1RJCA 3DRQA 4XBGA 4HMDA 4FQJH 4JFFD 1RU9H 3PDDA 3T8XA 2H41A 4DAGH 3SJVB 2FJHA 4FABH 1XGPA 2VQ1A 1NCCL 1FAKT 3OJ2C 3TVMA 1A9BA 2A83A 2VDNH 3HR5B 4MS8D 1QR1B 2AXHA 1Q1JH 4MNGE 2DIBA 2YD9A 5D4QA 3SE3C 1DE4B 1DN0B 5FDWB 4RA3A 2FJFB 4WW1A 4YFDB 3ZDZF 1J1PH 4Z7WE 5HI3C 3ZKXB 1QPPA 4UT9H 3H9SD 3G5ZA 2NYYD 1IZJA 4NBXB 2RAMA 2IBZY 1EERB 5E7BA 2VQUA 3SKOA 3W2DH 3E6FA 1ZE3C 1Q9KB 3CVHH 4XHQA 4XPHH 5MHSE 2HTKD 3UMTA 3IDIA 2G60L 5CHNB 3ULSA 1P7KA 1ZS8B 1ZEAH 4KRPB 1UKQA 4KDTC 4ZDHA 5F7UA 2VDMH 3L5HA 3VFSA 5CGTA 1A6PA 1NCNA 2OQJA 5JMRA 3ESUF 5BW7A 3ZKXC 2VL5B 4M1DL 1FVDA 1RUAH 4M93B 2RIKA 3OR7B 1Z3GH 1MCPH 1S9XB 2CLVA 4L29B 3HUJE 4FFZH 3AXLA 4G7VH 4XI5D 4BQ6A 3WXWH 1UZ6E 2AQ2A 4K9EC 3NCCB 4HLZH 3AVEA 1MRFH 2NPLX 5CJBA 4KRPC 2DD8H 1ZLSH 3ZMRA 4YDIL 3Q0HA 5F1OB 2Y07H 1KIRA 1MIML 2UZIL 3CSGA 4AK1A 3RNKB 2Y6SC 3VFWA 2JJTA 1R6VA 4HBCL 5IBLD 3ARWA 4OUOA 4JDTH 4M93C 4KUZL 4Z7WB 4Z0BL 3BIKB 1Z5LA 4OKDA 4JG1H 4QY8B 5SWSD 1DBAH 1ZA3A 5GGQL 1NJ9A 3MACH 1BBDL 1WT5A 5GZND 4OCWL 4Y1AD 1CICD 5KTEL 5ISZD 4IIQA 1GH7A 4AEIL 4CL7A 3MBEB 2O5ZH 3VXPA 4NZUL 2UV3A 2MHAB 1RZIB 1AGEA 1D5MA 5DZNA 3HE6B 4U4BA 1MIEH 4I0PD 4QTHB 5FYKD 1MF2H 4CDHA 3KYMA 4WI6A 1OP5H 4LKXB 4NQVB 2UZXB 3IJHB 2VLMD 2CLZA 2VO5A 2AK4D 4ZPTB 3L9RA 3FQXA 1ES0A 3HR6A 1SBSL 5CEYA 3UEZA 3T3PE 2Q6WB 3MBEC 4JFHE 3MUGA 4H25A 4JB9L 1S9YA 1EPFA 3LQZA 2PCPB 5MEPB 3PP3H 3HE6C 3SQOH 1XR8B 4GAJL 1MCJA 4PJXE 5DHYB 1ITCA 1NGYA 4X4MA 4W4NA 3Q5OA 1G0XA 2HKHH 7CGTA 4D9LH 4LFHD 1DANU 4YWGL 2P1YA 3T4YB 3MCKA 2NW3B 3LEVH 5JW4M 3FN0L 1N4XL 2N7AA 2WUBH 2GJJA 3FZUC 4KK8C 1KNOA 3GNMH 2H6PA 5L8JB 2VDLL 2DQHL 2EDRA 4GRMB 5L2KD 4JDZB 3KPLB 5DJYB 1ZLWK 1C12A 2X10A 4R4ND 4NT6A 4PJ9A 1YEEL 5ENWA 1XF5A 5F97E 5J8OA 2OYPA 1BIHA 3DX9A 5C07D 3SE9H 3MRMA 4OCRL 4UZGA 1MCBA 3L5IA 5DJCB 4BZ1H 3O2DA 4O9HH 3K2UL 2E6QA 3MRLA 2PTUA 2QQQA 5EU4B 4S1RH 4R7DB 4YHLH 5I8KH 1IMHC 4MQTB 2B20A 3BXNA 5DA4A 1X5GA 4OIBA 2EDHA 4ORGB 1TITA 4FQPA 4JFED 3DURA 4PJHF 5E2UL 2AJZB 4XNQA 2EDFA 5ILTH 3JV6B 2DAVA 4UAOB 5MENA 4NRXA 4M43H 3ZSTA 4E5XA 2MPAL 3I75B 1HHJA 3T2NH 2YD3A 4PP2A 3DUUA 2A0LC 4KQ4H 5FGBC 4FQ1H 1WZ1L 2W9LA 4YK4B 4K7PX 1VFAA 3BP4B 5BJTB 3ULVL 1U8QB 5D2NB 4JCLA 1XGPB 2DBJA 2BVOA 2D0GA 4NJ9L 1A9BB 3S5LA 1NBVH 4MDIA 3RVXD 3VXNB 5IFHH 1KF9B 1YECH 1WITA 1RMFH 4WW1B 3BKYH 4ELMA 4HHAA 3KR3L 4UAOC 3A67H 2OZ4H 3TYGL 3HC3H 4IRSB 3G5ZB 5DWUH 4YK4C 1C08A 3GJFA 4OUUB 3EYVA 2COQA 3E6FB 5D2NC 3MV7A 1JPTH 3ARFA 3IDIB 2Q86A 2EEBA 3ULSB 3T0VA 3MLPA 1CT8B 1BZ9A 5HPMA 5ESAB 3N0PB 4ZDHB 1C16A 4KZEL 5F7DA 4DTGH 4RZCA 1DR9A 4HUXB 2ILLA 1DFBH 3CMOH 4K8RH 2KH2B 5TE6L 4R96B 3BWAA 5F6IB 5I76B 1FVDB 2A1WH 4IRSC 4QRUB 4YHNA 2NY5C 5I19H 4Z6AT 4FXLA 3PQYA 4YX2H 4KAQL 2F19L 3ULVF 1QKZL 3IJSA 3ARBB 4JVWA 4I77L 2ICES 1EJOH 2WV3A 1R3KA 5D9SA 3TM6A 5LWYH 2KBGA 5C0BB 1YEDB 1OTTC 4NHCL 2CDEB 2XZCH 2N4IA 4D0BB 3LS5H 4XXDB 1H8NA 3MV9B 5F6IC 5CZVL 5T1KB 4HFUL 1OF2B 4X4ME 4GBXD 4YR6A 4F9PA 4JZNB 4X99A 3GRWL 1XGYH 1QLEL 4OLWH 2XY1A 3ARBC 4NC1C 1AP2A 4MMXC 1FRGH 4N5EC 2VERN 4UINL 3EAKA 3S9DB 3V6FA 1IGFL 3TWCH 4CU7A 3TNNA 3VXPB 4E42A 2BY3A 4GQ9H 3O2WH 3RTQA 1D5MB 1KUMA 3AUVA 4RMUA 1T4KA 2Y25A 3REVA 4PJ5D 2LU3A 1RV6X 3N1GC 2Y4SA 2BNRA 2CLZB 1CGUA 5EFIB 4UQ3A 3QB7C 5IB1A 2VNCA 3DV4A 4L8DA 2EE3A 3L9RB 4M3JA 1QSVA 3Q6FB 5CEYB 1HYSD 3SDYL 2FO4B 3ARPA 3B9AA 3V7MA 4F15B 2WIIA 3MUGB 4H25B 4U2YA 1BFTA 3JWDH 3VWKD 3LQZB 5IFJA 1MREH 3UJJH 3DMMA 3P4LA 2P46B 5D5MB 5MENE 1P5UA 4KHTH 3KLAA 43CAA 4CKVX 8CGTA 3FQRA 1A1MA 5JDSA 4YE4H 2Q3AA 1FGVH 5EZIH 4DUXA 3BRFA 4KI5F 3FOLB 4X8JB 5INDA 5EORL 2NNAA 4F15C 4I13B 1A6UH 3MRPB 1ZHLA 1XGQB 1C12B 4X80L 3MJ7B 4NT6B 4PJ9B 4ELME 3LKSB 3L3JA 5ENWB 1XF5B 3RX7A 4HK0B 3G6AB 3MRMB 4K3HA 4OCYL 3NCFB 1KT2B 3EO0A 4F7MB 3UTOA 5DFWH 1OWWA 2L7UA 4R4BB 3MV7E 4BFIA 5SWZA 2FHCA 4Z7OF 5FFLA 2PN5A 3O3DB 2X4PA 4JPKH 3B9KD 4TTGA 1G6RB 3CVIL 4YHKL 1E27A 1A3QA 1F11A 3RIFK 4PJ9C 4Q6YA 3DURB 4ODBD 2EC9T 4XNQB 4XX1G 4BZ2H 5GRUL 4DVRH 3U7AA 4QHLA 3H3PL 3MMEA 4BUGA 4E5XB 3PQYE 1HHJB 4M8QB 4PP2B 3DUUB 5A2LH 3VDAA 2VXUL 4L4VB 4OM0L 4PJDF 2DLFH 4S1QH 2HFEB 4JFDB 2XY2A 1OM3L 2VLJB 1YYLL 1OVZA 3ETBF 2BVOB 1Q72L 3S5LB 3VJ6B 5IP4A 2Y23A 2YRZA 1FG9C 3P73A 3VA2C 1U8OA 3K4ZA 1F3DJ 1JNHB 4ENED 1S78D 5F7KC 3SE8H 1T7YA 4YO0A 3CDGA 4HHAB 1ED3B 3CXHJ 3IU3A 2XA8H 4P2QA 3MRBB 4K94L 1N8ZB 1P7HL 2PYEA 5D7SH 3H9YA 3S7GA 3QRGH 3IETA 5EC1B 1CQYA 4ESKA 5I1IH 1BD2A 3GIVB 4R97B 3T2PA 3G6JF 1DBMH 1LO0H 3MV7B 5EU7E 1NANH 3ARFB 1UH2A 2FB4H 1BFVL 4M4PA 1I8KB 2B7DT 4LCUA 1BZ9B 3ULVD 4QWWD 4XZUA 1C16B 3FO9A 4RZCB 4LGPB 5DRXA 4KKAD 4Y7MA 3QNXB 3MX0A 4DN3L 1KOAA 4CADA 4YIQB 5B8CA 1WK0A 1CDCA 2BK8A 1V7NL 2OBGA 4PB9H 4P9HC 1IQDA 3M8OH 1CLCA 2BNRE 3PWLA 3W11D 3LMJH 4R97C 3IJSB 5ICYB 1J05A 1KLGA 3ARFC 2E27L 5D1ZD 1JYXA 1YEGL 3D39D 1LE9A 5ANMA 3BISA 1R3KB 4JO1L 4BH7B 5KVEL 3I02A 4NQUA 1MHEB 3JUYA 1JNNH 3NIFF 1ZGLP 3MTRA 4IM8A 3QUKA 4IDLA 3V8OA 1AGCA 5TE4L 4H5SA 2EH7H 2XPGB 3JWNC 2E3VA 4M00A 1S9KC 2HRLA 4X99B 5EH1A 1QBLH 4XVSL 6FABH 5J56B 2NR6C 4LVEA 1R3IH 1YEHL 3OGCB 1ZA6A 4JPVH 4ONOA 4Y4KA 5BRZA 5DK2B 3ALWA 2HKFH 1AP2B 2RR3A 3QDMA 3QWOA 4PRDA 3DO7B 3V5HB 3DROB 3T77A 1RSFA 3ZSSA 3SKJH 1T21A 4LGSB 5TDPA 3TNNB 2OLDA 5MEQB 3MJ9L 3J7HA 4MMZC 1IE5A 5D2LA 5C3LD 1RIHL 1YNLH 4UIKH 5I16A 3GMRA 3ARTA 3EOBA 1SEQH 3F62A 1UADC 1KLFA 3REVB 5SWZE 2CGRL 2YPKA 2BNRB 2DQGH 3S37H 5IB1B 1NLBH 4FQQB 5EU7C 4L8DB 4PGDA 1SQ2N 4KFZC 2XYCA 5E8PA 4DGIL 1RZKC 4EKXA 1S7XA 3WDIA 4PRBB 2B5IB 5T5FL 3PHSA 1A7PL 2WWKO 5DJXA 2OTUA 4KQ3H 4KI5D 5IFJB 3HE7A 1JZ4A 4TN9A 1UWEH 4U05A 4KK5D 4HJGA 3CGTA 5KSUA 2VR5A 5JDSB 4GKZA 1B6DA 5H2BB 2IQAA 5FKPA 3E3QE 3FT3A 5ALCH 3SO5A 5CEZE 4K3DL 3DRTB 2R9HC 1U3JA 1SJXA 3RX8A 2LTQB 4N0FA 4U1MA 1NBZA 2GSGA 1CGXA 5INDB 2EICA 1V3LA 2NNAB 5DEGB 1H5BA 2B5IC 3EFFB 5DJ0A 5F3HA 1ZHLB 5KJRL 3QA3A 3L3JB 4WUUA 4P2QE 3CFCH 5D70L 1K8DB 3V7AE 2PYEE 4Y5YA 1BD2E 4U6VL 2UVFA 4QYOB 4G6KL 1SM3L 3FQUA 1IQWH 2LTQC 3LH2L 4V2CB 2LVEA 1LEGA 5JR1L 1PAMA 1NMBL 4YNYA 5T3ZE 4P2YA 5C6PB 4J3WA 1NCAL 3C8HA 4YFLF 4L3CB 3AGVA 4JY5L 1X5ZA 1YY9C 5E9DD 3T0DA 2ZUSA 4TTDD 1U6AL 3TN0B 2VLKA 4YXLH 1J0KA 4Z7VA 3GJFK 4EEEA 3CH8A 3I6KA 4XPFH 4PR5A 2JLLA 4WIQA 5E6ZA 3NA9H 1F6AA 4HH9B 5ANME 3QEUA 5F9JA 4U33A 4Z0XB 4P5TD 4I9WE 2X09A 4LIQL 4TVPL 5CGYD 3F65A 2BRRH 5CUSH 1U8OB 2CD0A 4L8SB 1NAMH 4L3EA 3OJVC 1MAMH 5HYQA 3FAXA 4YO0B 1X4XA 3TN0C 2C9AA 2KUTA 2LE9A 4PBVC 4MCZA 5JUEL 3V6BR 3WNKA 1M7IB 4RBPK 3KPMB 3OWEA 1HEZA 3QWRD 4QRSA 5HYFA 2GI7A 5BRZE 5DD6B 4EI6A 3E3QC 3GGWA 4U6YB 3QDME 4AT6B 1LNUA 2NZ9C 3Q2CA 1U8LB 5M7QA 4UUJB 3WMSA 1R24B 3P30H 4K9EL 2ZUYA 4JZOB 4Y4FB 1RJZA 1JPFB 4L8SC 5DRXB 3JVGA 4Z78B 5C0RH 5MI0B 4LKCB 1U93A 3GUTB 3E0GA 5D2LE 3ZDYF 4CADB 3OAUH 4HIJA 5B8CB 2VABB 3PDOA 2R0ZL 3GKWH 4G80A 4TUKH 4XT1C 1L0QA 1IQDB 5KBNC 5FCUH 5JIKA 2UWEF 2G5BB 1KLGB 4RAUA 2LV4A 1D5IL 5CP7A 2GY5A 4UT7L 1GCFA 4BH8A 5IIEB 2R8SH 5HHXL 1RZ8B 1R0AH 1H3TA 5DVOA 1DQDL 4Y4FC 3V4PL 1FNEA 1OT2A 3QUKB 5MI0C 1Q9OA 1MHCA 3D48R 1AGCB 4KY1H 4EXKA 4JO2L 5B8CC 4GG8A 5EPMB 2R69L 4LCCA 3HPLB 1QOKA 5F1KC 1PKQB 1DSFH 2JB5L 5DYOA 2BRQA 1KLUB 1T0PB 4L4TD 1KENH 4ZS7L 5BRZB 1RFDH 4DWHA 4X6EA 4YFEA 3QWOB 3T77B 5GGUB 1T21B 4ZFGH 4TSCL 4PYGA 4ONFH 4WUUE 1FORL 1NAKL 3PHQA 5EU3A 5D2LB 1U2HA 1UA6H 5I16B 3GMRB 1L4IA 5CLTA 4RDQF 1KG0A 3ULUE 1TMCB 2CIKA 4XP5L 5FO7A 1IL1B 4RQQA 1QEWA 1HDMB 2OMNA 1ZK9A 5GHWH 3ZL4H 2K1MA 2PF6A 1SEBB 2YWZA 5J12B 4TVSa 1AD0A 1MCHA 1Z9LA 3QXDA 2ID5A 3QPQD 4KPHL 2VLKE 4ZFOA 1WBZB 4Z7VE 4GAGH 4RNRA 3EO1A 5KSUB 5CILH 4I48A 5CLWA 4GKZB 1V8HA 4W68A 4DGVL 5FKPB 4Z7WF 5I1LA 3QFDB 5FUZL 3RKPA 1KPRB 4XTRC 4AEHH 4DOHE 5L88L 2KKQA 2WBJA 4RFNB 3S96A 3KS0J 1V3MA 1IBGL 3QXAA 5J12C 1CFVH 3HZKA 3L1OL 1H3PL 1UB6B 2WQRA 4L3EE 3BT2H 4JR9L 2X4NA 3D85A 3QA3B 1J9CT 4ZUSA 2QTEA 2KZWA 2VLRA 5F21B 4BJLA 2VR9A 3ARED 3TESA 2GEEA 1MCOL 1IKFL 1NGPL 4LSPH 1NCDL 5AZEH 4RFNC 4LEOB 2X4RB 1IAKB 3C5ZA 4GT7A 4EN3A 1A7RH 3F7YA 4FQ2L 5IF0B 1QBML 3WKMH 3HPJB 4QHNB 2ESVA 3FRUA 1JCKA 5L9DL 4Y5YC 5I1JL 3ULUC 1BZQK 3I6KB 4HSQA 1MWAB 4ONGH 2GHWB 4HUNB 4LOUC 5IBTH 1HQ4A 3STZA 5F9JB 2DQFB 3WFCH 3MCLH 2X7LA 5EG6C 3BKJH 2EKJA 1DUYA 2FX8L 3JWOH 2H8PB 4KKBC 4BK4A 5F8RC 5E56A 1IAII 1EHLH 2ICEA 5HYQB 4XPAL 3L3GA 2CUIA 5T1LD 1HQRA 4A6YH 3BDBA 3GMOB 3KPOA 1KB5H 1UM4H 2W0KA 4OCLC 2VXQH 5HSFA 4Z7NE 3WUWA 5I8OL 5HGBA 4QRSB 3HI5H 1NC2A 2OXHA 2ZZUT 4PJGB 3HMXL 3GGWB 3PGDB 4FXKB 1JI1A 4HX1A 4CMMA 1I1AB 4UI2A 1FBIH 2NY5L 3ILPA 1TZHB 1WGOA 3P40A 4MB3A 5HI3D 4WFHD 3P77A 4UV7H 5JO5A 1J1OL 1K2DA 2XWJA 3FFCA 2DN7A 2ARJB 4M6ML 3OQ3B 2F15A 4ERSL 2BY2A 3SJVD 4H0GA 3ZKSD 1IFHL 3H42L 5AG9A 2FX7L 3HZYA 1DDHB 1JV5B 3BMWA 1QPXA 3TBTA 3RVTD 3FHQA 4OT1L 4P0DA 1I1AC 1JWMB 2WQ8A 4RAUB 3DVFA 5CP7B 1RJLB 4UNTA 4BH8B 3QDHA 4C56D 1ZHKA 5GGSB 2EZ0D 3BDXA 3IS0X 1FNEB 1G9MH 3JVGC 4MZ2A 2A77H 5K9OA 3UZVB 1MHCB 1KB9J 4XCYB 3BW9B 4CW1B 5HHOB 3RIFF 3U9PH 4KRPD 4RMQA 1E4WH 2IC2A 5DYOB 2ICWA 5JDJA 1MLBA 1PG7W 4W6XB 4L5FH 2R0LH 1HILB 2Y6SD 3QUZA 4QRPB 3KYAA 4B53A 2KZ1B 4X6EB 3EYFA 2E7MA 3FB5A 4NKIL 4JY4A 1WISA 5FA3A 1BM3H 1QNZL 2VDQH 3MUZ1 1S7TB 1A6WL 5MP6H 2DKMA 5TQ2H 3TYFA 3PHQB 2VSDA 1SY6A 4CNIA 4OGXL 2VLRE 3QEGL 5EO0A 1QBBA 2IWGA 5GS0H 5I71B 2VXTL 4LDOB 4KZDH 1F58H 5JXEA 1CU4H 3S98A 5FO7B 4RQQB 1R3LB 1BOGA 3ES6B 1E0OB 4GRWE 4XNXL 4RX4D 4XCCL 5F1NB 4ZPVA 5LCVL 2CDFB 3OKKA 4FXGA 4Y8AA 5EIIB 4PGEB 3PJSA 2I27N 4UOJA 12E8L 5C0FA 2ESVE 1ZVSA 3QDJA 4RNRB 4P46A 5MHSD 1DEEA 1XF4A 1II4E 2BX5A 5I71C 1S3KL 1W0WA 2BHZA 1K5NA 1B0RB 1CFNA 4S2SA 3WLWC 1JYVA 4QT5A 3MRHB 3VH8A 1XIWA 3HE6D 4KVCH 4JO3L 2WBJB 4P3CL 5A2IH 32C2A 5TPWH 4WI8A 2P24B 2AGJL 3QXAB 3HZKB 4J3OC 5HYEA 5CFHA 1JFQH 4DK6A 2G75B 4LLYB 5E70A 4Q58C 5GS3A 4IDJH 4KRLB 4MJ6A 2ZPKL 2AERT 4OF0A 3FZUD 3L5WB 5TGBB 2VLRB 3UTTA 2ATPA 4PRAB 4DZ8B 5DRNA 3RWJA 5TJWK 4KROB 3RFZC 3MRNA 5FECA 4KJPC 2I07A 2GITA 4LLWB 2UYLA 3OR6A 4R90L 5EB9A 5C2BH 5KVGH 2WBJC 1RD6A 3MOAH 3VFNB 2FATL 4XC1H 1TNNA 3O2DL 2Q8AH 4YJZL 3FFCE 2J4WL 1MRCH 4U0RB 2D9QB 4WW2A 1G6RL 2VITA 3TBVA 2OR8A 4QOKA 2DM2A 2ESVB 3FRUB 3GSNA 1Q9WB 4FG6D 5D5MF 2YOCA 4KROC 3HS0A 2MKLC 4JN1L 5FYKU 2IF7A 5I1DB 1DVFA 3RPIB 3QPXL 5I1AA 1HQ4B 4I1NB 2GK0B 2X7LB 3T4AA 1SHMA 5EBWA 4OLVH 1MJUL 5F6HJ 2CR6A 3C5ZC 4X7EC 2AEWA 2QQNL 4JO4L 3MRKA 4U0RC 2ICEB 4KTEL 1NCWH 5FA4B 3DHMA 3VGDA 1J5OL 3U1SL 4LPWA 3WO4B 4MDJB 4OIAA 1JHLH 5HGBB 4XVTL 2X44D 3O6FA 1WVZA 3QIUA 5CGMA 4CMMB 4ALAL 2D4FA 4J6RH 4LNVA 4YGVB 4P9HL 3OKYA 4JPIA 5F9OL 3TLRA 1EV2E 5JO5B 1QFWM 3FFCB 1L7IH 4WWKB 2DJUA 4Q9BA 4RFEA 5EUKB 1PZ5B 2ITDB 4PTUB 5FUOH 1RZJH 3VW3L 4LEXL 3X13B 3SKNB 3WO4C 5ITBL 2ERJB 3RZWA 3TBTB 3NFPB 3T1WA 3D9AH 5GGTA 1J0JA 5IMOB 3E8UL 3ZKND 4PJFB 4OI8A 2CXGA 4UQ2A 4KKLC 4YQXH 5EOCJ 4IRSD 3REWA 3VFUA 2VH5H 1DQLH 2EDLA 4MXWH 2F5BH 4WWKC 1KC5H 1TJHL 1JGEA 1MNUL 1NPUA 3QDJE 3RL1B 5ICZB 2QLVB 2I60L 2L7JA 2WM0A 2ERJC 1FYHB 5DJAA 1ZLUH 3MFFA 3UBXA 2ICWB 3UTPD 1IVLA 3PABA 1OTTD 4X0KA 3O0RL 3QUZB 2WUCL 2ORBL 3EYFB 4NZTH 1KXTB 4JY4B 3DVGB 1YEIL 4UV4L 4ZAKA 3QHZH 4TYUA 3WS3B 3PWPB 4WY7L 5ADOL 4HF5L 4R3SB 2AJSL 2XWBA 3OB0K 3WIHA 3TYFB 2VXVH 2I9LB 1HKLH 5I1CH 4HPYL 1QTYT 1EXUB 1RZKL 3UTTE 3NIDE 3IT8D 3MGTA 4N5ED 4G8IB 3QUXA 1JPST 4NZRH 1E6JH 3KS0H 5C0BD 2HWZH 3DJ9A 3KAAA 4ZO7A 5L0QB 3QUZC 4LRNL 3MV9D 4P2OA 5INCB 4W81A 5T1KD 4MD4B 3CK0H 3U0TA 3DYMA 2EDJA 4X9FA 1INEH 4ZPVB 4FXGB 4OLXL 4ZD3H 2YMXH 3PJSB 4XWGH 4QOKE 1NDMA 5JW3H 4I18A 3C5JA 1BQLH 1ZVSB 3QDJB 4KDWA 2O5XH 4P46B 3HCVB 4M3KB 1A14L 1NMAH 2BSTA 2DBLL 3BKCL 1F2QA 3L7EA 2E6PA 2KDGA 3VGAB 2EIDA 4PS4L 2C3GA 4WDIA 2CXKA 4ODTH 1F3RB 3VH8B 2HRPL 1FO0H 1OAUL 3CFJB 4N1CA 4RFOH 3VCLA 1SY6H 5FOBA 1GGIL 1JHTA 1U91A 2AI0H 5GGVL 3L95A 4E0RA 4HG4J 4MJ6B 3VD4A 4P46C 5FF6B 3S35H 3VXSB 1VB9A 2P5WB 3UPRA 3C8KB 5DVNA 3VGAC 2BP3A 1AY1L 4Q6IA 3A6CH 5FECB 4OSUL 3BQUA 5TDOA 1TVBA 2UYLB 3OR6B 3WFDH 3FRPG 5IW3A 5BCAA 3CZJA 2X4OA 2ZWLT 1G7IB 2JJVA 2VDRL 5DLML 1CDBA 2X4QB 4G6JH 4BA8A 5C6WH 3VD5A 2W0FA 5DMKB 2R0WL 4WI9A 4G7YL 4WW2B 1K9TA 2EH8H 2HYMA 2OR7A 1HCFX 1HZHH 1I1YA 2V17H 3BDYH 3GSNB 3VGHA 2DWDA 4MLIA 4GXVL 3HS0B 4EI5B 2DTMH 1BEYH 3STLB 3OB8A 1QYGL 4PJ9D 4S1SH 4LDEB 1QFUL 4N0CD 5B3JE 2ZOLB 3O45B 3T4AB 5EBWB 1T3FA 1O7VA 1A21A 2Z8VC 3MNZA 3O3BA 2UUDH 5CEZL 4IOSD 3RWHA 4WW2C 5DMYA 3B5HA 4WGWB 1Z9OA 2XZAL 4HWZA 1Q9LB 3D25A 3G6DL 1WIUA 3HC4H 3PL6B 3WJJA 2X4UB 4EI5C 2XQBL 5HY9A 2W65A 5IHUH 4NUJA 4XBPA 4U31A 3ARZA 1GGBH 1MCDA 1PEWA 1F02I 3VE0B 3HG1A 4JPIB 1L7TL 5B38G 5MEND 4WFFE 3VXRA 3I3BA 4WHTA 4EJ1C 3DIFA 1IGIL 2AJVH 1KN2H 1W72H 2P8LB 3DX7A 4L4VD 4O58H 2AAVA 1JPGB 2NY4D 4JFDD 3LS4H 4P9MH 4RFEB 2VLJD 5T3ZL 4O2EB 3VA6A 4LHJB 3PL6C 2A6DA 3MPCA 1MFDL 5KW9H 4Z9KB 3G5XA 4UDUB 3UCRA 3GMNA 1UACH 2AXFA 4DKEH 3HHRB 4XVJH 2GKIA 5IJKC 2VXSH 2EE6A 1EUUA 1S7SB 3RQ3A 4XP4H 1CN4A 3WDHA 2OX5A 3MV7D 5AYQA 3ARFD 4R26H 4F58L 1S5IL 2MWCA 3GHEL 5F7EL 3KPPB 1MHPH 3BSZL 3MFFB 3UBXB 1ACYH 3PG2A 4UOW1 3LHPL 3GEWB 4U3CA 2VAAB 1DBKH 5D71L 3CLFH 1M7DA 3Q6GH 3HNTH 5E8DH 4IMKC 3L7FB 3PHOA 4ZAKB 5FK9A 4JGMA 3D5OF 3PQYD 3F7VA 1FYTB 3P9MB 3T2OA 3WNLA 2NR6D 1BVLB 2XWBB 1EHXA 5HJ3A 2VDOL 2F58L 2AEPL 3VXMA 4QRQA 2PXYA 3O4LA 5GGTH 5FO8A 4IHOB 3QUXB 2DYPA 3CXDL 5ICXA 1YEJL 5DMIL 2DL9A 3P4NA 4P2OB 4MNHA 4ZAKC 3C6LA 4XC3L 3OPZL 1IEAA 4X6DA 5K9KA 4G8EB 4MCYA 3QJFB 4X83A 5F89A 3C5JB 4HLZG 5L7XH 1Q0YL 4RGOL 3QUXC 2YSSB 2VDPH 3L7EB 4LAQL 1CTNA 3JWDC 4WEBL 3NAAH 4JQVC 3K81A 4K7FA 4Y19A 1FL5A 5E2JA 2E7BA 1JK8A 4ZTPH 2XICA 1AXSB 3B5TA 5DS8A 4OFIA 4P2OC 3RTQD 3ROOB 2OR9L 1CR9L 3TT3L 25C8H 4RISH 4LSRL 4LVOB 3VCLB 4P4KA 3GMLA 2Z8WC 5GRVK 1U91B 2BNRD 4HUUA 2R9HD 1HKFA 2PTTA 3UPRB 2X89A 3RGVB 2IPKA 5D2LF 2YUWA 5HVFB 5C0DA 4GFTB 3L3DB 5DTFA 1OGAA 5TQ0L 4M02A 5TDOB 1MFCL 3VI4E 2QKIA 1AGDA 1TVBB 4DGYH 3DMMD 3B3IB 1U8IA 3HG1E 5JOFA 1GHFH 5HVHB 2FBJL 3ULUL 3VXRE 5I8OH 1R5VA 2GTZB 5JQ6H 3NCBB 4JFXA 3JUZA 2W0FB 1T83A 3B9EA 4XCNB 5BMFH 3UJTH 5GQBA 2FX9H 3MRQA 3CPLA 3P4OA 5DUMH 3RGVC 4MQSB 2XWTA 1I1YB 1MJJB 1J88A 1T0MA 4HQQH 4DN4H 3HC0B 3U4AA 1TDQA 1J0HA 3MGAA 3WFHA 1FN4A 1HSAA 4OD3L 4UT6H 2YPVH 4V1DA 1D7FA 3TZVA 1NSNH 3FOMB 5HVHC 3IDXL 4ODXA 2IH1A 4RMSA 5ACMA 1T3FB 2Z31B 1MWAL 3MNZB 1DUZA 4OB5L 3H0TA 4WCYL 3WIFA 3RWHB 4QXUH 5GJTL 4J4PA 1DQMH 4HWZB 4RIRA 2YD4A 2OJZL 1YEKH 2A6JA 3L3HA 1WTGT 2I25N 2HJLA 4QXWA 4HS3B 4G3YH 3EZJB 5EOCH 3QNZA 3WD5H 3LEYH 3BHBA 2GY7B 2PW2A 4AH2A 3MRCA 4NUJB 4HIIA 4UILL 4XBPB 5E1HB 4FZEH 3ULUF 3CNKA 4MJIA 3HG1B 2Z31C 4LQFH 5EO9A 4F7EB 3A6BH 2BVPB 1MVFA 2DQIL 4WHTB 1XEDA 3GSQA 1AFVL 2EECA 5I0DA 1NC4A 3D3VB 4HULB 2EDKA 3NCMA 3VXME 4MB4A 4MJ4A 2HLAB 5CEZD 1TENA 3O4LE 5C71A 1F8TH 1P53A 3WFBL 1CFSB 2NZ9D 5B4MC 5IT2L 1BQHG 4NC2B 4KK6D 8FABA 4Z7VF 4D0DA 4WRLA 3LSOA 1P4IH 5E00B 2QQKH 2X1OA 1AXIB 5L6YH 4U6HA 1XGRB 4P2QD 2B0SL 4X6DE 4PGJA 4OIIH 5MERB 3VFOA 3EO9L 1S7UA 1BD2D 3ZDXE 1S7RB 3RDTB 4KC3B 3CX5J 3LOWA 3QEHA 4G9FB 4Y16A 3HAEA 5JIIA 1KIUA 2XI9A 4PV8A 1I85A 4HW6A 1KXVC 4Y19E 5T3ZD 1S8DA 4Y4FD 2O61A 2H1PL 4N8CL 4PJGF 3TBSB 3D69B 4R8WL 3LN9A 1UJ3B 4U1SA 4LSQL 5DD5L 5IVOA 1T0NA 1I9RL 4PLJC 3CIQA 3O3EB 1A2YA 3RDTC 5DRZA 5EIQA 3FT4A 1AI1H 4JKPH 2DQCH 3WN5A 3X12B 2NTFA 4IOFC 2F74B 4L1HA 1H3XA 2PXYB 3JBG7 5FO8B 1IC5H 1CGVA 2PUQT 1RVFL 2M26A 2DYPB 2BVYA 4NKOB 1OGAE 5IQ7L 1J0YA 1PQZA 4TOYH 3B6SA 3LKOB 2M2DA 5DK3A 1UWXK 3WNMA 1T2QL 2ADFH 3P4NB 3OJMB 1UJ3C 2NY2B 5EOTB 3B2VL 1EO8H 3QG7H 4QCIB 3QXVA 1YYML 2OSLB 1LEKA 4JFOB 3IFLL 5BRZD 4UTBL 5F89B 2NQCA 2PXYC 5EBLA 3QDMD 1IM3A 5HGGS 1HXYA 1IGCH 2OCFD 1A6AB 3KWWA 4GSDH 4WI7A 3RL2A 4V1DE 1FJ1A 5F3BA 1FAIL 1HK6A 3VRJA 4Z7NF 2NY2C 4LHUA 3IFNL 3DBXB 1HWHB 4HKZB 5JXAL 4TPRL 4YXKL 1GZQA 2QV2A 3DGGA 3EJYC 1R3JB 1CXFA 1IKNC 3GMLB 2ARWA 4HAFA 3CLEL 4HUUB 1N2RA 3BIAX 1FP5A 4POUB 1E6OH 4HDIA 1QR4A 4XTRD 4P57A 3DI3B 4JZJB 5C0DB 3L3KB 1K8IB 1LO2H 1UM6L 2GCYB 4GXUN 1GAFL 5A1AA 2NY0D 4OFYA 3MUJA 1OGAB 4OD2B 3QO1B 3QQ3A 2QKIB 4MJIE 1X6LA 1TZGL 2FJGA 5JOFB 1I8IB 2X1WL 5ACLA 4UIMB 3DO3A 2L4OA 3EHBC 4PLNC 5GISL 1WZMA 3KPSA 2SEBB 2FIKA 1NFDA 3R1GL 4KI1A 2V2TB 4CU6A 3MRQB 3CPLB 2AXGA 5FGCE 4JZJC 5CJOH 4W4OC 5B39A 1VEOA 1LDPL 3WFHB 1FN4B 4HCRH 2A74A 2W1NA 4FQHB 1BAFL 3I3EA 2IH1B 3QFJB 1GZPB 4OLUH 1DUZB 5TH2A 4MJ5A 2JK5A 3H9SA 3T09A 2AK1H 3ULUD 3PWVA 3TEUA 4UT9L 2R56L 1YEFL 3V6OA 5IMMB 1T1WB 4HWEL 2Y06L 3L3OA 4X6BA 2AQ3A 1O0VA 2YN3A 3W2DL 1KULA 1W0VA 3SGJA 4WWID 3W5MA 4KKBD 1ZEAL 4TNVK 4HIIB 1KTRL 4LRIA 1OARL 4BSVB 2VDML 5DFTA 1WLHA 2EXWC 4TULH 4PP1C 1FFNB 3GSQB 4JKMA 1N3NB 4UB0H 2BDNL 5C9JB 2DM3A 3GSXB 4GRWF 5JOPE 2XXMB 2XKSA 2F9BT 3MO1A 4J4PC 3UYRH 2CJUH 4ZOBA 2VWEC 5BZDA 4OM1H 5I1EH 5FGCB 3EJZC 5A2KH 1LHZA 3PWJB 1D5ZB 2WBKA 1CL7H 3LSOB 1QFHA 2DQEH 1KTLA 4U6HB 4HJJL 3O3AB 5A2JH 4DKFH 2BSED 4ODSH 4XAWH 3VFOB 5M95B 5D7IA 2DLIA 5ESQA 3LKPA 2EKSB 3S34L 2W59A 4HS6B 1I1AD 2D7QA 2FL5A 3CFKB 4H20L 4Y16B 3HAEB 4PV8B 1KCVL 1ZT4B 1DBAL 1IAIL 5F88A 2HTLC 4Y1AA 1CICA 4R0LA 5ISZA 5IGXH 1X5AA 2CMRH 1TETL 3K4AA 3N9GL 3OTTA 2J6EL 1FH5L 1T0NB 2QADB 4OAWA 3BX7C 1GGCH 1LO5A 4GW1A 2YK1H 3BE1L 4ZTOL 1MFNA 3BZFB 3MNVA 3FT4B 1MF2L 4R2GB 1SYSA 4P23B 3O6ML 2FRGP 3WCYA 4Y16C 1G7MA 2YPLB 4HMEA 3WN5B 4OCXH 2XRAL 3DVNA 5I17A 4ZFFA 2CIIA 5DQDH 3S97C 1YPZA 1CD1A 1YY8A 1PQZB 4UNUA 4PGBA 3TO4B 1W8NA 1AGFA 3W0WA 4H26A 3KNBB 3X3GH 3CUPA 1J11A 1OAKL 5BXFB 4Y5VB 1HHKA 5HHOD 4PJFF 2Y9RT 1RUML 3FB6B 3KPSE 3SQOL 1C1EL 1NFDE 1LEKB 4R2GC 1I3VA 4P23C 1Q94B 4JN2B 3WN5C 3AY4C 1EBPA 4QRPD 2FIRT 4G5ZH 5EBLB 2DIAA 1RK1B 3HN3A 1HXYB 5EUOA 3KWWB 2X4SB 3RL2B 2R23B 4X7SH 1FJ1B 4XMKL 3TC9A 3ISWA 5TFSH 3TO4C 1T1YA 3VRJB 5L2KA 3U0WH 4LHUB 1JRHL 1XCQA 2I5YH 1KPVA 3TO2A 3GSOA 1GPOH 3H9SE 5C07A 3DGGB 5DQJB 5LXGH 1YQVL 2JJUA 3FO0L 1TVDA 3GSUB 1IGJA 3V6OE 4C57C 1OGTA 4NNYA 1QSFB 4K3GA 1FFOB 3EGSA 3NZ8A 3WLWD 5F9DC 5A3IC 1KFAH 3LZFH 1I9IL 5I1GL 1JZ6A 2DM7A 5JLZB 4NN7B 4L8CB 4L8BA 5F9AC 1FVEA 4Q9QL 3CC5B 2ED8A 3SCMA 2VC2H 3NACH 2YN5A 3TF7C 4NN6B 4CVWA 2NLJA 4IRZH 2ZSWA 4LSUH 2FIKB 3RJQB 2B1AH 4BQCA 3IVKA 1B2WL 1I7UA 4KJPD 2OXGA 3T2NL 4ETYA 4TSAL 4MYWB 4NWUH 4PRHB 3EOTL 2WBJD 4U7MA 3WHE1 1MCFA 4NN7C 3V0VA 2A74B 4D0CA 4GKSA 1TCRA 3D85D 3GSNL 3V52H 1NBVL 3FO2A 4Y5XA 2ADGA 3WL9A 4A6YB 3U7WL 1OP9A 2Y7QB 5DJ6A 2QSCL 4WTWA 4YHIB 5KSBB 4LCWA 1CGYA 4NN6C 2VLRD 4K23H 5D7IE 4AYFA 4MJ5B 1P69B 1P4BL 2E7LA 2FEEI 2D7TL 3JSSA 2HLFC 4WU5B 1JGUH 2X9XA 2XACC 4KVNL 4X5WA 5CP3H 3R0NA 4EQ2A 3LY6A 4Y1AE 4M61B 4H1LA 5I18H 1W0VB 2PR4L 5B3NA 5HGDB 5C0EA 5ISZE 5A43C 3V4UH 5BV7H 2NY6B 3C5ZD 3NIDF 3FN3A 4Q2ZA 1CYGA 5CWSA 4NO2A 3MSPA 1OHQA 4AM0A 2R0KH 3N85H 5GRZA 3MLXL 5FYKE 2ESVD 3UZEA 2QR0B 4MVBC 1WC7B 3VGGA 3EDDA 3ZE2E 3V6OC 2WMPA 3LRGA 5H8DA 2Q1EA 1CVRA 3OKOA 3VRLF 4WW2F 1CFTB 4Y2DA 4DW2H 1YPZE 2N1KA 4F7CA 4WTZA 2NY6C 3I50L 1FZOB 1RUPH 5HI4D 3CD4A 3W0WE 1UJTA 2VB5A 3BZDA 3U0PA 3DXAA 3O11A 3LN5B 5T5NG 4IS6B 4LRIC 1PEZA 3DSNA 1P2CA 2D03L 3P0VL 2DLGA 3TJEH 3LS5L 1O7SA 5EN2B 4GUPA 4NNXB 2AXJA 1MEXL 2FL5B 2YHGA 4U6XB 4OLWL 2Z35A 4J8RA 5EUOE 5LAXB 4FFVC 1CFQA 4KKLD 2YEZB 3VFRA 3TBWB 4M7LT 4R0LB 4XP1H 1CZ8H 3BH9A 3F58H 1BPVA 5L2KE 1A3RH 5IVNA 3FFCD 1I7ZA 1KN4H 1NBYB 4ZFZB 3K0WA 1B4RA 4RA0C 4Q9RL 3EDEA 5C07E 4JQIH 1LO3L 2XZQH 4LLVA 4GW1B 1B90A 1AJ7L 3SHSA 3IDMA 4PJ5A 5DMGD 4RAHA 1RULL 3NOIA 1W8OA 1WSST 1K85A 2DI8A 3OKDA 2EDTA 5CAYB 5HHNA 5IK3B 1TJIL 1P84J 3WIHL 4R0LC 5I17B 4OFDA 2CIIB 1YPZB 1DJSA 2BERA 1YY8B 2PW1B 1AGFB 3QNYB 4TQEL 3UP1A 4LLQA 3JWDL 3BP7B 5E2TH 5GS0C 1HSBA 1U3HB 1F6LL 3EYSH 1TJGL 2OI9B 4NCC1 3MRFB 4NCC2 4HC1H 4DZBA 3LKRA 3MRDA 3QDAA 3T0AA 5GRJH 3ZDZE 3CXHK 3QUZD 5JNYA 1UWGL 4ZQKB 5I15H 2BSRA 1G6VK 4OZGB 1U58A 4KHXL 1NH6A 2H9GA 3VXQB 1A7NL 3DTXB 2DI9A 5IV2B 2X4TA 2I24N 1XCQB 5FYKH 1FL6A 4G43A 3TO2B 3GK8L 4LCWE 5A40E 5ALBL 3V7AG 2DRUA 3EDKA 5DJ8B 1U3HC 5I1HL 2OI9C 2W9EH 5JXED 3MXWH 2MKWA 4NNYB 4U1NA 3NZHH 1JNJA 3O6LL 2LAGB 3EGSB 1FCGA 3PIQB 3QEQB 2LVCA 3B9KA 5CIPB 3IAPA 1HH6A 1ZT1A 5BS0B 1U8NA 4JPKL 5BVPL 5IR1A 4EBQL 3CSYA 4FFYL 5ABDE 4Y89A 4QHKI 1VFBA 4NNPL 2AS5M 1NEZB 3BAEL 5EC2B 3SCMB 2CSPA 3QDJD 4P46D 2AJXH 3AM8A 4AG4H 15C8L 1EVUA 1J8KA 3KYOB 3HFML 4LLUA 4Z7UA 1A6ZA 4LVNB 2EEDA 3IVKB 2DQDH 3N1PC 1I7UB 3MYJB 5DHVA 2H45A 4GG6B 5IW1A 1RZ7L 1DLHB 4OLZL 4J3TA 1AHWA 2DLFL 4LPXA 4F7PB 4BYHA 5HDOA 4O2CA 3DXAE 1D6EA 3HMWH 4D0CB 3PP4H 3SCMC 4XP9L 3FO2B 4Y5XB 2ADGB 3C08H 3S36H 3HZMB 3VXSD 2QSTA 4TRPH 3I85A 4LCWB 3UTTD 4LVNC 5DUPH 4ZUWA 2BJML 1JGLL 3DX8A 4E9LA 2V5TA 4HKBA 4APQA 3P4MA 3BZEA 4X5WB 3RBGA 4JFZL 1MCWW 1H3GA 1GL4B 3BVNB 1Q0XH 3H9HA 3O8XB 4H1LB 5AWNL 5HGAB 3MLUH 2VISB 5CD5C 1A3LL 3AU1A 3S88H 4YPGB 4FQLL 3LKNA 4Q2ZB 4WJ5B 4Y5XC 4NO2B 2FWOA 1NGWA 2E9JA 3V5DB 3DYPA 4QOKD 2ZCLH 1G7PB 3BP6B 2P44B 3R0MA 1XGUB 4YHZH 5IOPB 3IDNB 7FABL 2E7LC 3N1MC 3M07A 4PJ5E 5E6IB 3L5XL 4EI5D 2H3NA 4U1KA 2RJMA 4NUGH 5I8EA 2IALA 2NY3D 3M8OL 4JKKA 1XFPA 5D1ZA 3D39A 2ZP0T 3O8XC 1A4KA 4M48H 4Y2DB 3TT1H 1URLA 1FPTL 5KAQF 3S4SA 5HYJA 4PJEA 2P45B 4DCQA 2YC1B 4F7TA 3QZWB 3DXAB 4Z7QE 1KJ3H 5ESVA 1VERA 1I75A 1CF8H 1XGTA 1XMWA 3JTSB 5CBEA 5TF1L 3GSRB 1XAUA 3MXVL 4PJCB 2MCPH 5E6IC 2EH7L 4I2XB 4GUPB 3IDYC 4TUOA 4YDJA 3O6FD 3IU4L 3QIUD 1LGVA 1PLGL 4EUPB 4Y2DC 1NCCH 1CFQB 1P6AB 3KYKH 1C5DA 4Z18A 5JHLL 5LKNA 3GJEA 4F8TA 2CLRA 2C1PB 4CN6A 5EZOL 1WZLA 1YMHA 5GS1B 4LLVB 3VI4F 3ZLQC 5ITFA 5F6HI 4FA8A 1OLLA 3NN8B 1IC1A 3BEWA 3IDGA 4FQCH 1EGJH 3GRWA 2HMIC 5KG9B 5HHNB 4JANA 2G60H 3FAWA 1OTSC 2W92A 3GSWB 3BD5A 1U8JB 4RGNB 4U1JA 4LLQB 4KJWC 1MCQA 4Z7UE 5GS1C 4HUWA 4M1DH 1UH3A 3HZVA 5D7JA 3SGKA 5ERWA 1QQDA 4DZBB 5EU6B 4GMTL 1G7LA 2AKRB 2D9CA 2CK2A 4P2CG 5BZWA 1G0DA 1FO0B 4XHJC 4Y88A 4PG2C 2ADIA 1U58B 4QNPF 4ZAKD 3S37X 1FFPB 4N90D 5DD3L 2CO6B 2H9GB 1FYTD 2X70A 1BOYA 4RGNC 1MIMH 4OZ4A 5LGJA 1F3JA 1FL6B 4G43B 5F1IA 5DD1H 1KJMB 1B6UA 4HBCH 1RUKH 3SPVB 4X7FC 3QUXD 1H3VA 1RI8A 4Z0BH 2Q7YA 5D1QB 3RUGB 3RVWC 3IJYB 1F5WA 1ETZB 1HOCB 1S9VB 2EO9A 1GSMA 4PJIA 4P2OD 2B2XL 5GGQH 3RHWK 2KL6A 1BBDH 3ULVE 1U8NB 2GJ6A 5IR1B 3T0EA 4OCWH 1SYVB 5KTEH 4AEIH 2BSSA 4NZUH 4X98A 2P8PB 1FLTX 3K8LA 4PPTA 2X2YA 3SBWA 1KXQE 2XTJB 4BSWB 4NQCA 3SKMA 1AO7A 1A5FL 2XTLA 4PBWD 4YXLL 5D1QC 1YNTA 2D3VA 4X6DF 3D39E 1NFIB 4NM8L 4S0TD 2DMCA 2EIEA 3ZDXF 1TTUA 4FS0A 1QP1A 2DB8A 5HYJE 1XR9A 4PJEE 4HUMB 4P5TA 1SBSH 1VACA 4JM2A 1JGVL 1D6EB 2BCKA 4WHDA 3U4BL 1P4LB 4D8PA 3RWCA 4WNQA 2X1XR 1ZMYA 2XTJC 3RGVD 4GAJH 3DGCR 1PY9A 1K6QL 1OQXA 4MQXC 2R2BA 3UTQB 1OSPL 1UVQB 2LQRA 1P5VA 4NKMA 3CDCA 5D93B 2V2WB 4MA1B 3P4MB 1EVTC 3BZEB 1QFOA 2H2SC 3DX6B 4YWGH 1T80A 4YDVA 4YEFA 1YZZA 1PYWB 3FN0H 1N4XH 4NWTL 1VSCA 4C55A 3TJHD 2FR4A 1W72B 1ORSA 2W9DL 3AU1B 4K07A 5HHQB 5JA8B 2VDLH 3LKNB 4V2BA 2DQHH 4KKCC 1NGWB 2I26N 1IC4L 3F5WA 1ZXQA 2GFBA 1YEEH 3UJIL 5DHVH 1S9WB 3OAUL 1EFQA 4X7TB 5D93C 4U1KB 4OCRH 3VDCA 4MA1C 1G7QA 1EHAA 1UZ8B 3IAQA 2EDEA 1YA5A 3D0LB 3VXTA 2VL4A 2Z31D 5HYJB 4PJ8B 1BBJA 2IH3A 4PJEB 3B4NA 3BGMB 3EDJA 4GOSA 3QJHA 4P5MA 2EYTA 3I3DA 4KI5E 4EZMA 5JORA 1PVHA 4ODUA 4JHAL 5EULV 5E2UH 4M6OL 5B4MD 4ODWB 4KY1L 3BRDA 4GKNB 4TUOB 2MPAH 4NRZB 1T22A 4OZFA 1BGXL 2BVQB 3OXSB 1WZ1H 4YEEA 3OKLB 3ULVH 1NCTA 1KENL 3QDGA 3HG1D 5FUCE 2ED7A 1Y6NR 4PJ8C 4NJ9H 4FMFA 3VXRD 1ND0B 2F53B 4CAGA 3GJEB 3RY5A 3C5SB 1WBYA 3U82B 5KZCD 4LNRA 1F90L 4BSJA 2JELL 5IBUG 2I9TA 4KU1A 1YMHB 3KR3H 1JF1A 3TYGH 5I8CA 3RJDA 5CD3A 5IVZB 3DETC 3BEWB 1A0QH 3FCTA 4X5XA 4PJIE 3CDYA 4HFWB 4YAQA 3Q3GA 3EOAB 3V6ZA 2J8UB 4CVZA 2V5MA 2GJ6E 2ZOKB 3T0EE 5CZKA 3UDWA 4AL8L 3QG6B 4PLJD 4U1HA 5IB4B 4KZEH 3ECBA 2DMKA 4U1JB 1JGDB 4G9FD 4HJ0C 4X9HA 4IOFD 3NABL 4NQCE 1AO7E 5C6TL 4NFBA 3HZVB 5F44A 5D7JB 1YC8A 1CE6A 4P49A 4KAQH 2F19H 4IEFB 3UAJC 2X9WA 3BD3A 5J11B 2ADIB 2D0HA 2OL3B 3GO1L 2H32B 5CSZA 3BIBX 4AEHL 4X8XA 4U1LB 4OZ4B 2FSEB 4NHCH 2NCMA 5A16A 1X3DA 1TQCB 1V7ML 2ZNXA 2PXYD 3O4LD 1JZ2A 5DZOA 5CZVH 3WUWG 1G7JB 2A9NL 4HFUH 5D7JC 4HKXA 5HPOA 2DYPD 4PY8J 1MCSA 5IM7A 3GRWH 1QLEH 4ZUVA 1D5BB 4DVBB 4ACPA 5J11C 2NY2D 5DJZA 2AV1B 5FUCC 2GJ6B 4UINH 1BREA 2W60A 3EJYD 1HI6A 1Y6KR 3IYLW 2BSSB 3AS0A 1IGFH 1KYOK 5F71A 1TQCC 4F33A 4MX7B 1IAOB 3G9VA 3QXUA 1KEGL 3AMKA 1ONQA 3SKMB 4N8VA 3GM8A 1CL7I 5JTWA 3WKML 1U3YA 3GB7A 5J1AB 1NUFA 5DO2C 2OP4L 4WEMB 3PWUB 3RWFB 4XGZA 1YJDC 1XR9B 2P7TA 5IMLA 4JM2B 1DQQB 4PY7B 4JAMA 2VZTA 3EHBD 3SDYH 2YA0A 4D8PB 1F4XL 2OTWB 1MCCA 3MRRA 2X89D 2XKNA 1BQSA 1J86A 3MA9L 1MI5A 3MROA 5LGKA 2DI7A 1FC2D 1FZKB 5I75B 4NKMB 4XNMA 1XT5A 2X9YA 1OGAD 1U9KA 4YDVB 3QDGE 4XWOC 1I3RB 4HUVB 4JM2C 1WWAX 3MA7A 1ORSB 4ODHH 3BH8B 3F7QA 4MLSA 4PGCA 3V4VL 3K8MA 1CCZA 4X80H 2GFBB 3SJVA 2HVJB 2IBZX 5I75C 4K71B 4FQIL 3HR5A 4OCYH 5D8JL 5IMKA 1RZGA 1KJ2A 1U8KB 4MHHI 4V1DD 2HJFA 1FC1A 1BWMA 4FTVB 3CU7A 1DE4A 1DN0A 5GGVY 1NFDF 3QFJD 5IESL 2EXWD 4PP1D 3CVIH 5IVXA 5DC0A 3QJHB 3O9WB 4JY6B 1MAJA 4J4PD 4JM4L 2NXZD 1Q9KA 5AAWA 2B8OT 1TTGA 3RVUC 4NBZB 3FT2A 1GGUA 5CHNA 5GRUH 1ZS8A 3H3PH 4K71C 3EJZD 5KSBF 3OF6D 2VXUH 2Q20A 2VRAA 5SV3A 1OM3H 3QDGB 1YYLH 4L5FL 2OMBA 2HFFB 1Q72H 4RWHA 3OR7A 4NFCA 1NC4D 4MD0B 3KPQB 4L29A 3L5JA 1WBYB 3O9WC 4POZC 4LNRB 3DARA 4B7IA 2I9TB 1EEUA 1FSKB 1JF1B 1KCLA 4OLYL 5I8CB 4K94H 2HTLD 3EIFA 3NTCL 4NCDA 1VFMA 1IJ9A 5CJ5A 5GS0L 4LPYA 4KZDL 4QRRB 5H37G 1HHIB 4WI5A 1BFVH 2Q87A 3TNMA 5HTSA 1TTFA 5T33L 4EOWL 3BIKA 3P2TA 4A2LA 1T03L 1GXEA 4JHWH 4QY8A 3ESVF 4OV6F 4Y16D 3MLYL 1PG7L 4DN3H 3KLHC 1FSKC 3BYYA 3QUYA 4AIZA 4OZFH 1J12A 3K46A 1RZFL 5C8JA 1V7NH 3VD3A 3V0WL 1JPSL 3MBEA 1QHPA 1R5WB 2E27H 1YEGH 4UMGA 1OAXH 3MLTA 4LDLB 3HE6A 4BUHA 4JO1H 5KVEH 4QTHA 3B5GA 4KVCL 2VN7A 4LKXA 4NQVA 4O51A 1MJ7L 5FYLE 2YPLD 5A16B 1JFQL 5TE4H 1MI5E 4E41B 1BF8A 4ZPTA 5E5MB 3BKML 5DSCB 3ZDYE 5ACZA 1ZOXA 4XVSH 4ZUVB 3QCTL 1YEHH 2PCPA 1L6XA 5MEPA 1M6OB 1FV1B 3BPCA 5DHYA 4WFHE 2VDKL 1G0YR 2LFGA 5FV2A 5KVGL 4LIQE 4QGTA 4TVPE 5FB8B 1YPZF 2CKBH 1AR2A 3SJVE 3QCUL 3MJ9H 3FQWB 3EFDL 3RWEA 1RIHH 4G6FD 3TBYB 4X9BA 1X5YA 5A3ID 4NDMB 3NPZB 1LMKA 5A2FA 4M1GL 4LHQB 3OAZK 2CGRH 4NJAL 1XH3B 5DJYA 4LHUD 4XGZB 1RURL 1J18A 5IVXE 4UBDD 2FDBP 4DGIH 3FFDA 2QJDA 3VXUB 5I1KL 5T5FH 1A7PH 1I3GL 1QSFD 4PV9B 3MRRB 4JRYA 3GSVB 2XKNB 3U6RA 5J6GA 4U2ZA 1MI5B 3ET9F 4LQ1A 5I66B 1R3HA 5TDNB 1IRAY 1MFAL 5GZOC 1UM5L 4ORGA 4ELKB 3KYNA 2AJZA 3UX9B 3IFOB 3NCYP 1A1OB 1KSRA 1MPAL 3I75A 3KPSD 2HLFD 1LO4L 1MQKL 5KJRH 3BP4A 5BJTA 1U8QA 3U9UB 5D2NA 2Y36L 3G5YB 4PRHD 1FG2A 2VUOA 4OFVA 5IMKB 1RZGB 4N0YL 4FQXB 1KTKE 1KJ2B 4U6VH 5KANG 2HJFB 2D7PA 1FDLL 3BPLB 3VXNA 4KWUA 2J8OA 3U4EB 4G6KH 1SM3H 2MMXA 2ZG1A 4GG6F 3HMXA 5JR1H 1NMBH 1JWUB 4MVBD 4IRSA 3OMZA 5IVXB 2GUOA 1I1FB 1NCAH 4OUUA 3RHWF 5BOZG 5HHPB 2E9IA 2Q8BL 1FE8L 1FZMB 3FT2B 4XB7A 5F8QC 5HD8C 5K9JH 2BVTA 2Q7NA 1CT8A 4FQXC 5ESAA 4JFQB 2NY6D 5GPRA 4XX1E 3MOQA 4FN0A 4HG4K 1E4XL 3BPLC 5DUBB 4Q0XL 1ZLWH 1CVSC 4HUXA 2DTSA 3ZHKA 1IILE 4R96A 5I76A 4OQTL 5HYIA 4QRUA 1FQ9C 4LIQH 3T2QA 2ARJQ 5F93C 4PRNB 5IB3B 5DD0L 3ARBA 4NO3B 2DLTA 4WI2A 3SY0A 1UT9A 4J3VA 1FHGA 5JUEH 3VGEA 2RGSA 3P9LA 4G8GA 4P2RB 4EXPX 5C0BA 1YEDA 2CDEA 1OAYL 4D0BA 4XXDA 5IQ9A 2HWZL 3WFZA 3ABZA 2NTSP 3MV9A 4NQDB 1MHHB 5T1KA 1OF2A 3TNMB 1SJEB 3CSPA 4NQSB 4DKDC 1AKJB 4JZNA 4XNYL 4K9EH 1JZ8A 3HTLX 1G9NC 4ZD3L 3QUYB 4AIZB 2JB6A 2W38A 2R0ZH 5J7CC 2YD1A 3LD8B 5T1MB 5C8JB 1FGNL 1BQLL 1FVCB 3GIZH 4HLJA 2DKUA 2H26B 2FHFA 4PJCF 3PUCA 3MRGA 1NMAL 1A4JB 2WWMD 1IGML 1T5WB 1U92B 4KXZH 1D5IH 4M03A 2XN9B 3MLTB 4PJAB 3C9NB 5DQ9B 1J1XL 4UT7H 3WIIL 2IPTL 5HHXH 1DQDH 4YUEH 3V4PH 1ADQH 4O51B 1FO0L 5L8LB 4Q9CA 4JRYE 5EFIA 4QO1A 4JO2H 3QUYC 4EDXB 3LD8C 2R69H 3Q6FA 5ACZB 1N6QL 2FO4A 4JHZA 2JB5H 3W0WD 4ZS7H 2EXYC 3MGOB 3VDBA 4KK9C 1U8HA 4N0RA 5GGSY 5D5MA 3BPCB 3TV3L 1U3HD 3N50A 2Q76B 2YUZA 3QI9A 4ZUTB 3RWGB 3WV0A 1X5LA 3RY6C 1RIUL 3D18A 1CGSL 5SX5K 5D2NE 1FORH 2DDQL 1NAKH 2DKSA 3ZTJG 3RWEB 1H0DB 4Z7QF 3FOLA 4FFWC 4X8JA 2EH8L 2C3XA 3GBML 4IBLT 2IBBA 3S35X 3MRPA 1XGQA 2VN4A 3MJ7A 3OX8A 4XP5H 1FNAA 4DQOL 3LKSA 2YD8A 3NH7L 5LBSL 2QQLL 3LQAC 4HK0A 4HT1L 5TE7L 4AIXA 3G6AA 1UC6A 1KT2A 3FFDB 4F7MA 4XVUC 3QQ4A 4K7PL 3G04B 5FYJL 2BZDA 4R4BA 2PETA 2JE8A 1HINL 3O3DA 4JRYB 3QEQD 4KPHH 3U6RB 3SDAB 3OGOE 5D96B 4YHYB 3WXVH 5J6GB 5BS0D 4P59L 5BV7B 1G6RA 1R3HB 3UTPE 4GQPH 1XZ0B 1MRDL 3MQIA 3MREB 5FUZH 2MQ3A 5SWQA 3SCMD 3KYNB 4QHMB 2VZSA 3MV01 1NL0L 1VKXB 3UC0L 5DT1L 5L88H 4JFFB 4M8QA 2QSQA 3PNWB 1OQOA 4NM4H 1IBGH 4L4VA 3VFMB 1H3PH 5FM8A 3ARGB 4JR9H 1PSKL 1K4DB 4NC1E 2HFEA 1KN2L 4JFDA 2VLJA 3SDAC 5D96C 1FG2B 4YHYC 1WBXA 5BV7C 2DLEA 1GGTA 1A6VL 3VJ6A 2GT9B 4G8GE 5C0BE 5CD5D 4Z7UF 4X4YB 1JNHA 3IF1B 4MAYA 4D9RE 3KPRA 5L8KB 3MV9E 1IKFH 1NGPH 5AUMB 1UACL 1ED3A 4LCWD 3OAYK 2ZCKH 3MRBA 1N8ZA 2GUOB 3KPTA 3VI3E 5JPMA 3X11A 5DJDA 3S3PA 1SVCP 5EC1A 1GIGL 3ARGC 1NGXB 3MZGB 3GIVA 3HNSH 1RJYB 4FQ2H 2Z91A 1EFXB 3OV6A 5IFAL 1QBMH 2AABL 3O8XD 2F54A 3UPCA 1I8KA 2VLLB 5L9DH 5I1JH 3U46B 5IEHA 3W9DA 1ZT7A 4OGYL 4GJTB 4YZFF 3GI9H 1M1SA 4QXGL 3QNXA 3TIEB 3GMPB 4YIQA 2WP3T 1KIPA 3H9ZA 4F9LA 2HTKC 2FX8H 4O02L 4HEME 5ICYA 1O5DT 2ZUTA 2FECI 4G6ML 4XPAH 3ZTNL 4XMPL 1OPGL 4Y2DD 3SY0B 3BFOA 1DQJB 1VGEL 5C09A 4BH7A 1MHEA 1F4AA 3P9LB 4FRWA 4G8GB 3DUHA 4I3GA 3DXAD 5J9PB 2Y72A 3MLVL 4R6UA 4YXHL 5C08A 1DQTA 5IQ9B 5D5ME 2C3HA 4ZO9A 2NY5H 2XPGA 3O4OB 2BY1A 4NO5B 2X5PA 4ZYKB 4DFIA 1J1OH 4PJEF 4NPYB 4WHYH 1HHHB 2FEDC 3OGCA 4M6MH 5DK2A 4ERSH 5J0BA 2HMID 2JB6B 3B9VA 1XF3A 3DO7A 5EOQL 3V5HA 1IFHH 2CRMA 3DROA 1OTSD 3H42H 3QHFH 3BWUC 3MRGB 3IB4A 3QSKB 4OT1H 3U48A 5MEQA 4OZHB 2EC9U 3O4OC 1CLOL 4WO4A 3QUMA 4HZAA 3BMVA 3QP3A 2AK4B 4KRNA 1JTOA 25C8L 4CGTA 1LWRA 2OL3L 5DEZA 2YBRA 4JVUA 4FQQA 2EDDA 4XHJD 1JYWA 4WTXA 4F3FA 4PRBA 1PKOA 1CLYL 3C60A 1CFBA 1F2XK 1NDGB 4RGND 4PRIB 1U8HB 1JN6B 5CINL 4DGYL 4DUVA 4NKIH 4NC0B 2ADJB 2J8UF 3QI9B 4L4VE 1JE6A 1QNZH 3FONB 3LV3B 5H2BA 5EU6D 5K93A 3T3ME 4LARL 4FNLL 3D18B 1A6WH 1YJDL 4JFDE 3RVWD 3TPUA 5JQ6L 2VLJE 3NA4A 4Z77B 5E08L 3DRTA 1CXHA 3R4DA 4OGXH 3UJTL 3QEGH 1YUHB 1RPQA 2PNDA 1CDYA 1MFBL 2HN7B 5DEGA 4ZUUB 3EFFA 2VXTH 3KPRE 3OX8B 4MHHG 2P42B 1CD9B 1K8DA 1ORQB 4XNXH 4XCCH 4Z95L 2C3WA 3VRIB 3QI9C 4OCNC 5DF0A 5K59F 3QQ4B 5D1QD 5LCVH 4HWBA 2OS7A 4QYOA 3IKCB 4QXUL 12E8H 2F54E 3NMEA 4XMLL 2G9HA 2AEQL 4KMTH 5HVWA 4JFEB 5GJSL 3OBAA 3WJLA 4O2FB 2C7UB 1I7TB 4L3CA 5SWQB 4QEGA 5EOCL 1MELA 3TN0A 2XTJD 4JO3H 4PJIF 4P3CH 4WFED 4MQXD 4AENA 1INDL 4CJ0A 2KQMA 2H2SD 4HH9A 5C09E 3LRHA 2ZPKH 3U2SA 1WBXB 5FYJD 4Z0XA 3DVIA 2EIZB 3T04D 4BZYA 1FNFA 5C08E 1UFUA 4MAYB 4L8SA 3KPRB 4KKCD 2PTVA 2GAZA 1D5XA 2X40A 4YDKH 4R90H 4NSKB 1A7BA 1M7IA 1G7HB 2FATH 3KPMA 4MA7L 5JPMB 3O2DH 3X11B 5DJDB 4JM2F 4APQD 2CUMA 1S7WB 2J4WH 4OIIL 5DD6A 1F4YL 1OW0C 4U6YA 2Z91B 1G6RH 4AT6A 3HKFA 2F54B 1U8LA 3FQNA 3OKMB 4UUJA 1R24A 5IEHB 3N1QC 4JZOA 4Y4FA 3W9DB 1ZT7B 1JPFA 4MAYC 4QHUB 3RZCB 4JN1H 4Z78A 4LKCA 3GUTA 2IPUK 5DVMA 2HVKB 3OZ9L 3IRZA 5GGRB 1KIPB 2VABA 1OD7A 1ZGLA 1MJUH 4RWYL 1RHFA 1QVOA 2QQNH 4JO4H 2CK0H 2G5BA 5CBAB 4KTEH 1J5OH 3U1SH 5C09B 5HYJD 5IIEA 3ZT6A 1RZ8A 3RZCC 4XVTH 3W9EB 1L9NA 1IC5L 5C08B 3QAZB 5I30H 3MLZL 4TOYL 4ALAH 4GW4A 5EPMA 4LCYA 4P9HH 4F9LC 4AQOA 3GJFH 2ADFL 1NUNB 2GTWB 3HPLA 5F9OH 1KCRL 1PKQA 4HD9A 5T1DL 4J2XA 1KLUA 3DETD 1JTTA 4D3CH 5F96L 3UTZB 4UOW0 3OKNB 5B39G 3VW3H 1FIGL 4XPBL 1A7OL 4LEXH 1XF3B 4DKAA 5EO1B 3M17B 2HFGL 5ITBH 1ACZA 2F53D 3S3SA 1MCEA 5GGUA 5JW4N 5IW6B 3UO1L 3QAZC 3E8UH 4XXCC 4HJ0D 4HEPG 4WO4B 3QUMB 4RBPH 4OF6A 1HIMH 1NCBL 2JJWA 1P6FA 3GMMA 2DOCA 5GS2D 3VFGL 2P5EB 1IL1A 1TJHH 1MNUH 1HDMA 2YBRB 3VFTB 3UAJD 1F13A 4ZG1A 2I60H 4I3RL 1SEBA 5D6CA 1E6OL 1WFTA 4F3FB 4O4YL 3C60B 3O0RH 4NGHL 4WO4C 1WBZA 2ORBH 2MJWA 2WUCH 4YHOL 1UQSA 1YEIH 5GIRA 1BFOA 4JRWA 5D7JD 1YN7A 5JW4R 1EAPA 4WY7H 2DQUH 2KPNA 2AJSH 2Z8RA 3TPUB 3SGEH 3QFDA 1DP0A 1KPRA 3GHBH 4HPYH 5CCKL 5IJVA 3LN4A 1ZVHA 1RZKH 3AB0B 5C0AB 2YRPA 5FGRA 5DR5H 2JTDA 3C60C 1UB6A 1SMAA 1BQUA 4PJHB 1MH5A 3G08A 4NKDB 1KTDB 3OHXA 1NGZB 3VFPB 1B3JA 1DBJH 1CK0L 1U41A 5F7NC 3FN9A 3STBA 4D2NA 3CX2A 1FNSL 5GSRB 4JFPB 5DO2D 3AB0C 2G9HB 4LEOA 2GJ6D 4M62L 3T0ED 4TUJB 2X4RA 5HHVL 1A14H 4P48A 2DBLH 3BKCH 5FYLL 3P0YH 4LPVA 5DEFB 1IAKA 4X6CB 2BOCB 1A7QL 2YKLL 3ALPA 4PS4H 4ZOEA 5CJXC 5IF0A 4HZLB 3HPJA 4QHNA 4NQCD 1AO7D 2HRPH 3ZHDA 2C26A 1V3KA 4AENB 4J7RA 1OAUH 4FMKA 4G9DB 4HS8L 1GGIH 1MWAA 4UB0L 5GGVH 1TVHA 4XWOD 3U2SB 1T7WA 2DQFA 2CPCA 4JM2D 4GW5A 3WJLC 2H8PA 1AY1H 5JMOC 4RCAA 2RCSL 2C4XA 2E9BA 4OSUH 5E8EB 1UH4A 1D5XB 2GAZB 4RMWA 2K7PA 5E2WL 1KJ2L 3GMOA 2V2XB 1PKQE 4PLOB 4XCFL 2BC4A 4LFHG 5DLMH 2BHUA 4PJGA 4MWFB 3PGDA 3V0AC 2R0WH 2G2RA 4FXKA 4G7YH 1I1AA 4M9OA 5IKCB 2B4CC 1S78C 3SDXA 1T2XA 1TZHA 3WLBB 3FQNB 3RU8H 4GXVH 3KLDA 1ZANL 3LQMA 1JNLL 1LD9A 2ARJA 4I3SL 2IJ0C 3RNQB 1JWSB 1QFUH 4MD5B 1B4JH 4YHML 1EH9A 3IS1X 4LU5L 1ZGLB 2W0PA 3MR9A 4O5LL 1DDHA 1JV5A 1QVOB 5CEZH 5LGHL 2EIBA 1EZVY 2R1YB 1CDJA 1I9JL 1JWMA 2NW2B 5HVGB 2AV7B 2XZAH 35C8L 3G6DH 1RJLA 5B21A 5GGSA 5AZ2L 4M7LL 3KHQA 3EYUL 1EUTA 2XQBH 1G9NL 4KTDL 4F80A 3O9WD 3O41B 4POZD 5GXBB 2C5DC 2D0FA 3W11C 4XCYA 4GW4B 3BW9A 4LCYB 4CW1A 5HHOA 1L7TH 4RMTA 3F6LA 5FAAA 1IGIH 4RRPA 5IVXF 1HILA 1KELL 2DQTH 4QRPA 3QDGD 4CDGC 1BWWA 5T3ZH 4NYLB 1LK2B 1FCCA 2W0LA 4C83B 4JQXC 1MFDH 1Z2KA 2X41A 4UTAL 3PXJA 4AEEA 4U1IA 3UYOD 3B9DA 3DNKA 1S7TA 2R2EB 4YFLI 4X7SL 1RK0B 1ZWIB 1U8MA 1ZHBB 2EDQA 1AQDB 5CKGA 2DICA 3GMMB 4K3EL 1QFPA 2N56A 5IEKB 1AXTL 5LXGL 4YBQC 2KQNA 1R3LA 2IG2L 2VZVA 2EDWA 3ES6A 1S5IH 3GHEH 5F7EH 5EZJB 5D6CB 2DMBA 5F1NA 5I73B 4OF5A 5GSVA 2CDFA 3LHPH 2V7NA 3ZKMC 5EIIA 4PGEA 5D71H 3ME0A 4UDTB 4HIXL 1UQSB 3ZYIA 5GIRB 1BFOB 1YN7B 1H15B 4HAGA 3O3UN 2VC2L 1EAPB 3MJ6A 2E7HA 4JRXA 3LQAL 3T0BA 5B38A 3ZZ1A 1B0RA 1T89C 5IJVB 2F58H 1ZLVH 2AEPH 3LN4B 3MRHA 4Z76B 5JHDB 1CDGA 1QFWH 4WTZG 4WUKL 4LSVL 4Q74A 5I73C 2P24A 3ARYA 3R06A 2D31A 3MYZA 2UY7A 1JI2A 4H8WC 4JKLA 4KK5C 2G75A 1YEJH 1MCWM 3RWDA 4LLYA 4MA8L 4D9QE 1MH5B 3G08B 4E41D 3DHJA 1P1ZB 3L5WA 5TGBA 3OHXB 4XC3H 3OPZH 4HWNA 4KV5E 4PRAA 4PJGE 4I4WB 4DZ8A 3D87B 3THML 5DA0B 5FO9B 5E2VH 2ICWJ 1UCTA 4LLWA 2YWYA 3SDXE 3OJDB 2O5YL 3DUSA 3VFNA 1Q0YH 4LAQH 4C4KT 4WEBH 1NCUA 5D72L 4PD4J 5BV7L 2VZUA 5HHMB 3AROA 3MLRL 1T04A 3ARQA 4HUKB 5CJQL 4P4RB 1Q9WA 3TT3H 4Y4HB 4LSRH 1BZ7B 5I1DA 1DBBL 4OI9A 3SEPA 3RPIA 3F12A 1TVHB 3C2AL 2GK0A 4N9GB 3VD9A 1UCBL 3MNWB 4GW5B 3O2VL 4TTDC 5HYSG 4PY8I 3BJ91 2QHRH 3BPOB 3VXUD 1TPXB 2CRIA 5FA4A 5TQ0H 5FYLD 1MFCH 2ZSVA 3ILQC 5HHOE 2FBJH 1AIFA 2IFGA 1MI5D 1FZJB 2MNUA 3CMGA 3ULUH 4OI7A 4MDJA 4XRCA 2VIRB 4Y4HC 3AAZB 4NRYB 3MUHL 1NMCB 2BC4B 4J12A 3TJEL 1I8MA 1CXIA 2QHLA 5CGYC 4QRPE 2G2RB 4KXZI 2M8XA 5I74B 4YGVA 3SDXB 1M71A 3LPGA 3DV6B 1MAKA 3BPOC 1TPXC 4OD3H 4TVPD 1LD9B 4WWKA 5EUKA 1S5HA 1ERNA 3FMGL 3IDXH 1PZ5A 1VADA 2APTA 2ITDA 4PTUA 4P3DB 3X13A 3SKNA 4Y2OA 5HD8D 1RHHB 5C7XH 1QO3B 3MR9B 1NMCC 4OB5H 4H88H 4JQIL 2QEJA 3BZ4B 3NFPA 4K55A 5IMOA 4ZS6C 5GJTH 5KVFL 3ARXA 2FYYB 5I74C 4PJFA 1BIIB 2A6IB 2WW8A 4HV8B 1ZLVK 4AEFA 2OJZH 4PG9A 3EKCA 1QUNA 4ZMAT 4P99A 3Q1SL 5E7FA 1AQKL 4XNUH 4NQEA 3HRPA 3RL1A 4ZSOB 1UXSB 2HT4C 1ZTXH 2VUYA 4UILH 5ICZA 5KSVA 2DQJL 4L4TB 4GAYA 1TLKA 2DQIH 4M7KL 4CN4A 1AFVH 5CMAB 4JRXE 2J6EA 4QHKJ 4LF3B 4PJ7B 3ORJA 1FL3B 2ZG3A 3WFBH 3DVGA 1WFUA 3BEVB 5I15L 4U1IB 3PWPA 3MOBL 3WS3A 4NP4L 4R3SA 2AJUH 3QIWA 3SOBL 3KGRA 2WLZA 3V9FA 2I9LA 1U8MB 2YRLA 1MQ8A 1EXUA 2R29L 4JG0H 3SDCB 2B0SH 4G8IA 3I6LD 4L9DA 4P2RD 3SN6N 3MLWL 3MRJB 4B5EA 5INCA 2B1HH 4NQDD 2V5SA 4MD4A 4LPTA 4L3AA 1AKJD 4WVRA 2BY0A 5IB2A 5GSVB 2CKBB 2V7NB 1WIPA 2H1PH 2AJ3B 3PGFL 4MA3B 3VGBA 1YC7A 3SDCC 2P43B 2DM4A 3QUYD 4R8WH 2BNUA 4LSQH 5DD5H 2FD6L 3HCVA 5EBGA 2HT3C 4YH6A 1I9RH 1EMTL 3WUZA 3VG0L 1K4CB 3MBED 4JRXB 5B38B 4JKWA 2EXYD 3VI3F 4LP4A 4KK9D 4LCIL 2XN9D 4Z5RB 3S4SG 1OSZA 1NLDL 2CH8A 3R06B 1PJ9A 3CFJA 2D31B 1ZHNB 4BKLA 4TSBL 1RVFH 4LSSL 5IQ7H 4F57L 2EO1A 4PJBA 3RWDB 4YLQT 2BFVL 1T2QH 5FF6A 1D9KA 3B2VH 3VXSA 4N1EA 2P5WA 4KK8D 3C8KA 4OZHF 3RIAK 4FFWD 2HH0L 1WEJL 1YYMH 4HGWB 1U0QA 1OTUC 2YR3A 1C5CH 1A22B 5DUPL 3IFLH 1I3UA 4UTBH 1BX2B 3DUSB 4IRJB 2NZIA 1NBQA 1G7IA 1ROWA 5IROC 2X4QA 3IXAB 3OB0H 4XVUD 5DMKA 1FAIH 2VE6A 1NEUA 5K33A 1J8HA 1QSEA 1T04B 2EC8A 3IFNH 2JCCB 1HH9B 4Y8DC 4OCSL 5BOPA 5JXAH 3G5VB 4TPRH 3S36X 4YXKH 1ZGLM 1M05B 4EI5A 5EA0L 4YHZL