4P57A

Mhc tcr peptide complex
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
178
structure length
178
Chain Sequence
KADHVSTYAAFVQTHRPTGEFMFEFDEDEMFYVDLDKKETVWHLEEFGQAFSFEAQGGLANIAILNNNLNTLIQRSNHTQATNDPPEVTVFPKEPVELGQPNTLICHIDKFFPPVLNVTWLCNGELVTEGVAESLFLPRTDYSFHKFHYLTFVPSAEDFYDCRVEHWGLDQPLLKHWE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of chronic beryllium disease: linking allergic hypersensitivity and autoimmunity.
pubmed doi rcsb
molecule keywords HLA class II histocompatibility antigen, DP alpha 1 chain
molecule tags Immune system
source organism Homo sapiens
total genus 31
structure length 178
sequence length 178
chains with identical sequence C
ec nomenclature
pdb deposition date 2014-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00993 MHC_II_alpha Class II histocompatibility antigen, alpha domain
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4p57A02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 4p57A01
3ZYOA 3JWOH 1MCFA 1HHJA 1OAKH 3DLQR 4BSWA 4YAQB 3UCRA 5C0FA 4X5WA 1D6VL 4AENA 2DQIH 3J8F7 4XZUA 5EOCJ 4P46B 5IJKA 2CUMA 3O6KL 4GT7A 4RRPA 4QHMA 2AGJH 3VXPA 3BKJH 5DLMH 1UWXH 1X9QA 2FSEB 3FRPG 5F6IC 5GRZA 2AJZB 1LMKA 4ZMAT 4G3YL 1MRDH 3DVNB 4EKXA 4UUJB 4WUKH 2Q6WA 1AQDA 1JHTB 1UH4A 4S10A 3CSGA 1MJ8L 5C71A 1UB5B 3HZYB 4MXQD 3IETB 3V2AR 2MKLC 4C4KT 43CAA 1CFQA 1A9EA 3TA3D 4A6YL 2WANA 3GJEB 1IKFH 4MDIB 5J1AA 2FX9H 5LAXA 3GMOA 5F6IB 1II4E 3U0PB 2PYFA 2QBWA 5I17A 4OZIF 1A6WL 3JBG7 2DTML 4W4OA 5IQ7H 2IALA 5IG7B 3QEUA 2PO6C 1Q94B 1ZT1A 4G43B 2HTLC 4ORGB 4NOFA 2HJKA 1F02I 4X4ZA 3X3FH 3OXSB 2Z91A 4KTEH 4R7DA 3VG9C 2P44B 3GMMA 3NFNB 4JQXA 1Z0NA 1NANH 2AQ1A 4KKAD 4LDEB 4F7EB 4AEEA 3EYQC 3LQAH 5FB8B 3L7FA 5IT2H 3JWDH 1BEYH 3GIVA 2GJJA 5CUSH 2FJGA 1AE6L 3QIBD 3RBGA 1LD9B 3X13B 3C5JB 4JRXD 2Q3ZA 2VRAA 4F9LA 2EKSA 2DLIA 4M7LT 3FRUB 1R3HB 3HA0A 1D5BA 5B4MD 2F54A 5GJSH 5H94B 4AL8L 4ETQB 5JW3L 4IRSC 1INDL 3NA9H 1NGYB 4O2CB 1ZLVH 4EJ1C 5JZ7C 1R5WB 4M5YL 1MIML 1ZSDB 3LHPL 1RUQL 3QO1A 2XZQH 1QYGH 4NQEB 3ZZ1A 3BP7A 1D5ZB 4F7PB 1SY6H 3CVHL 1FC2D 3FN0H 4KH2A 4ZUVA 4YXHH 3ULVL 1T21A 3D0VA 4NNXB 5JXEA 1FZOB 2AV7B 4LSTH 1ZT7A 3I84A 4L8DA 4F33A 3WFHA 3UMTA 3B3IB 4N8VA 3WNLA 1X6LA 3JSSA 2EKJA 1HSAA 3NCYS 4IRSB 4HW6A 1DUYA 1YYLL 4KI5D 4L3CA 3C6LC 1UCTA 5FYKU 1L9MA 1S9YA 4KRNA 4YHOH 1AGFA 4FABL 5B39B 1BJMA 2P48B 5DC0A 5F1OB 3VFWB 3MLTA 2H3NA 2Y5EA 4YWGH 3SCMD 3A6BH 3QDMB 1AP2B 1TZGH 4KK6D 4M1GH 4X0KB 4XWGL 3TO4D 4OCXL 2P5EB 3SO3C 1ZOXA 4MJIE 4OSUL 5B38G 1FFNB 1FAKT 2VLKA 2BVPB 3DETC 4FHBD 4YHNA 3C6LB 1KT2B 3EFFB 2UZIL 5D6CB 4Y5YC 3PQYE 2Z0BA 1KACB 3ZE0E 1MLCA 2XRAL 3VE0B 3LN5B 5GGUB 3X11A 4EI5B 3EBAA 1U8PB 4JVPA 2WSKA 3SO3B 4A6YA 1KTLB 1DBBH 1U92A 1IJ9A 2ZSVA 3BJ91 1NCAL 1R0AL 1VACA 2J88H 4S0SD 2JB6A 2D03H 4ZQKA 2DQJH 3KWWA 4JREC 1F8TL 1YY8B 2DQUL 5FYKE 1NEUA 2B4CC 5E2TH 4Y5YB 3UTTA 3ZSTA 1XT5A 4G6FD 4KGLA 1BBDL 4JB9H 3U6RA 4J3XA 2HH0H 4F2MB 5EUKB 3C2AH 1EHNA 5E2UL 2HFEA 2GAZB 1BZ7A 2APXA 4HIXH 4LNVA 4XC3L 2R4SL 5CJOH 1EJOH 3PHQB 4L3ED 3MFFA 5SWSB 3I50H 3ZDYF 5L2KA 5E2VL 5ANMB 4PRBA 4HGWB 2WBJD 4EDXA 5B8CA 3HI5L 3HRPA 1EAPA 5D2NE 4MXWL 3ZKMC 3PGCA 4DUXA 1HQ4A 1KB5B 4JN2B 5IVZB 5H8DA 4Z7VB 2WIIA 4DCQA 1FNLA 3WN5C 1MFCH 3RU8H 5FK9B 4KTDL 3MZTA 1YYML 4Z7UA 2XTLA 1QLRB 3MBED 2DL9A 1H8OA 3BEVB 1WWCA 4UIMB 1CGYA 5K9QG 3VGAC 4HS8H 1J10A 1WJ3A 2DYPA 1YEGH 4HWBH 4U1KA 5FYJH 5FV1L 1F6AA 1OT2A 3HE6A 2JK5B 4EOWL 4YBQD 5D7SH 5E0QA 3WN5B 4E41D 5JO5B 5KSBB 3ZDXF 2E7BA 5EDXA 4HF5L 2OZ4H 1V7MH 5INCB 4WI6A 3GKZA 1J0ZA 1LO3H 1FO0B 4M62H 4TPRH 5EB9A 2FBJL 5IBTH 2ARWA 2CGRH 1DANT 5B3JF 3V6ZA 4F3FA 4ONFH 1DSFH 4FZ8H 4BQBA 3DURB 1J1OL 5C7XH 1G9NL 4XGZA 1WVZA 3SDXE 1CQKA 2CRMA 4EQ3A 4J3OC 4P2OA 3EDKA 4LLUB 1KCSH 5KVGL 4I48A 3PJSA 1CWVA 2EIEA 1XR8A 5DMIL 2YD1A 1S5HA 4O5LL 2V7HB 4KRPC 3G6AB 4NRYB 3CD4A 5CJXC 1R3KA 3WLBA 2AERT 3VGFA 1P7KA 4NKDA 4PJ7A 1E28B 1G9MC 2VLJD 5T3XH 4PJGB 1WCBB 4LMQI 1BFVH 5ITFB 2XKNB 1FE8H 3FN3A 3N06B 4JFPB 3MRGA 5J57B 3O2VL 5FDWB 3GMNA 1T0NA 4ELMF 4O4YH 3RIAF 4NFDA 1EGJL 3UTPD 2XPGB 4KRPB 3DX9A 2WWMC 1WFTA 5I1JH 4MHHG 2VDPL 5DDHA 2E8ZA 1OSPH 4OM1H 4XWOC 3V6FA 3HMWL 3DV6A 3T3ME 3O2DL 1S7QA 2V7NB 5CJ8A 2X4TB 2YPLD 4WEBH 1RK0B 5SWZE 3EO0B 5EBLA 2NY2D 1V3KA 5IVXE 4HIIB 1A0QH 4EXKA 1H15A 3MNVA 5K59E 5MEOB 1PEZA 1EMTL 5F7NC 1EFXB 2EXWC 5IB1A 1NMBL 4N90D 3MV9B 3EYFA 5GZND 1EVUA 1DQQA 4HMEA 3L6FB 1H8NA 3TA3A 4JFXA 1QSFE 2PTTA 1CLZL 4QTIH 3HE7D 5HVFB 3MO1B 1CE6A 4M3KB 9CGTA 1TQCC 4JQIH 3S5LA 3G6JB 4X4ME 1K4CB 4PJHF 3LMJH 3T0WA 2HJFB 3F65A 3IKCA 3O11B 5DQJA 3HZKB 2O61B 1JZ7A 1N2RA 4L8CB 2VTFA 5CGMA 1SHMA 1MF2L 1OGAB 4NT6B 2AKRB 2YSSA 4GG6E 5JIKA 4H5SA 2B39A 4KQ4H 3NCMA 5FHAH 3AY4A 3KPRD 1MNUH 1EHLH 2CRYA 5DD5H 3O3AA 2FR4B 4O2EB 2LU3A 2GY7B 4P2RD 4PJDF 2BFVL 1YJDL 1JE6A 2EDEA 3DSFL 3ZTNL 1HHGB 1WUNT 4P2QB 3QIBA 5MHSE 4QXWA 3LQMA 4CDHA 4JRXA 2CR3A 3SDAC 4MNGA 1RV6X 1P53A 4APQC 3A6OA 4RRPG 1T5WA 3C60D 1UH3A 5KVDL 2XKUA 4LSQH 4X9GA 5D2LA 5IESL 1I8KA 3CCHA 5TFSH 5C9JB 5HJ3A 2XXMB 3K80A 2MQCA 1E4KA 1TNMA 4CADB 2BNUA 3QWRD 3O9WC 2VXUH 1Y6KR 4X8JA 5IV2B 4FP8H 1F4XL 5I1HL 4APQB 3GSNH 1DP0A 3RDTD 4ELKB 4TVSa 5EIIB 1EGJA 1KXQE 1DEEB 3CFKA 1DBAH 1KJVB 3GDBA 2GJ6B 5GRYA 4HFUH 4TVPH 4NZTL 4IOFD 5SX5H 1H8SA 4OGAD 2P5WB 3O9WB 4HGMA 4P0DA 5CP3A 1XCTB 4MCZA 3CMOL 3O2DA 5IHBA 1NFIA 3SCMA 3UJJL 3FQNB 3TO4A 1QFWH 3GUTA 2AJUH 3S37L 5IB4A 1OP5H 4KHXH 3CXDH 4K23H 4MJ6A 5LGHL 1F13A 2Z4QB 4BQCA 1J05A 3VA6A 3LZFH 5HYQB 3VI4E 4OJFL 3W11C 1KCUL 4OQTH 1R3IH 2NZ9D 1OPGH 5SV3A 1AGBB 3U9PL 1DBMH 2NY4C 4E0RB 3ORJA 4PGEB 5F9AC 3V52H 3VXOB 4BZ1L 3QG6A 3TVMC 1INQA 4HPOH 2J6EL 2Q3AA 5DXWA 3MRQB 5CSZA 5JORB 2BY0A 5DC4B 1OT1A 1GRWA 1YN6A 2FJHB 3IJYB 2BVOA 3GJFH 1A6ZA 4YEFA 1HILA 4Y2DC 2KBGA 3EZ8A 4NKOB 5T1DH 2HMIC 2W9EL 5EZOH 2V17L 1LEIB 1YECL 5HHOB 2NY4B 2F54E 3IU4H 4XNQB 5I8EA 3GRWL 4OZIA 4OI9A 3VXRB 1AHWA 3G04A 4FQQB 1UKTA 3WHXB 3OGCB 4XNZB 5E5MA 3SY0A 1KELH 4LHUD 1NUGA 4EDWL 4P4KC 2KDGA 5J1TC 1OAQL 2IJ0C 4ENEC 5K9OB 4KAQL 2E8YA 4H88L 4Y2DB 4I77H 2UWEB 3UX9B 1BWMA 4R3SB 2DD8H 2VZSA 4M6ML 2WBJA 3WFZA 1FG9C 3RNKB 3UPCA 3WFCL 4R26L 4MVBD 2IAND 1U8KB 5FAAA 1ACYL 4P4KB 1XH3B 1CGVA 1IEAA 4GBXB 2QL1A 4O9HL 5L7XH 1MJJA 5JW5A 4FQLL 5HDBE 3LDBC 3N1QC 2GFBB 3MBEA 15C8H 5SWQA 3BIAX 4QHNA 3VDAA 1T5XB 2MMXA 4LVOC 5F7YC 2XYCA 1D9KD 3TCXA 2W07A 5JPNA 3V0VA 3V4VL 4GSDH 2UUDH 1OAZH 1XIWC 1OSZB 5DURB 5A2FA 4TULL 4Q9RL 3H7BB 4K94C 4XCCH 3FTGB 5E9DD 3SDCD 4U6TA 4E41A 5CBAA 1I8LC 3KAAA 5JUEH 3OKLB 1IEBB 4OGXL 3V4PL 4L29A 5TQ2H 2DDQH 2VE6A 5AWNH 1KENL 3DTXB 2W59A 3DJ9A 3ARGD 1KBGL 5F1SA 4LVOB 2K9UA 3FFCD 4PJFB 3DX7B 5DJCA 3JWOL 4F7MB 1Z5LA 2VH5H 1OAKL 1XIWB 3KXFB 4MB3A 2BCKA 3OKDA 1XR9B 3O0RH 3OB8A 1AH1A 4I3GA 4TSAH 2DQIL 3U2SA 3UTTE 2PW2A 1XEDA 4U6YB 2P46B 1IC4H 3HFMH 4XCFH 2XQYG 3SKJH 3O3DB 1GIGH 5IM7B 4PRNA 2AGJL 3I3BA 3UYOD 1G7LB 1J1PH 5DLML 4PBVC 4A2MA 4R8WH 4PGBB 1MRDL 1RAMA 1KC5H 4F37K 4RWYH 4YK4C 2VLJA 4WUKL 5EBWA 4D9QE 4LU5H 2J6EA 4BQ9A 4UT6L 1X44A 1KIPB 4M7KH 1ES0B 5FGCB 1WIUA 5CIPA 2ICEB 5L2KE 4JFYB 1FYHB 3WFEH 4Q6YA 4LP4A 3OAYH 2H2PC 3P40A 3PDOA 2W60B 1RULH 3PDDA 4U1LA 1RJZA 1OB1B 3KHQA 1IKFL 1WBYA 2FX9L 4LLWB 5J89A 1I3GH 5I71C 2XV6B 3GRWA 2MHAB 3MV7B 1QKZH 4GXUM 5IQ7L 5GSVA 5KOVC 1JPST 1XCQB 2VWEE 4FZEH 4E42B 5FYJD 3D5OF 1CICD 2HWZH 4PV9A 5IMOB 2VXTH 4Z7UE 1EJ6A 5C07D 2C1PA 1QSEB 3GB7B 2YPLA 3PL6B 3S4SA 3X3FL 3ULVE 4QY8A 1MPAH 2AAVA 4KTEL 1KJ2H 4LKXA 2YBRB 1U8QB 3WV0A 2JB5H 3D6GA 3BE1H 4FQXC 2A6DB 3LQAL 5DFTA 3TN0A 5I71B 2HT4D 3JWDL 5IT2L 5GISH 2NMSA 4F7CB 5IMKA 2ATPA 3PHOB 4ZUWA 5CUSL 1U8IB 2X42A 4OCMC 3HR5A 3IDNB 3OAUH 1U8MA 5SX4H 3U7AA 3HE7A 5JMOC 1FORH 2GTZA 5FA4A 1OTTD 3T77A 5GJSL 2EE2A 1FN4A 3KPOB 3NA9L 3L5WB 3U79A 2C4FU 1AC0A 4FQXB 4NC2B 3KYOB 5EOTA 5E70A 4YPGA 5DJZB 3DRQB 2XZQL 4RNRA 2V2XB 1QYGL 3IFOB 5T3XD 5A3ID 3OKNA 4NHCH 5CGYD 1SY6L 1FL6A 3KPRA 3FN0L 4YXHL 3SHSA 2I60H 4XI5D 3AXLB 3PXJA 4GQPH 3BMWA 4LSTL 4MLIA 3EOAA 4PJ7E 2QADD 1NC2D 4CN1A 1U58A 2BVUA 1ZA3B 4P2RA 3KG5A 3TV3H 5JOFB 1Y0LB 4U7SA 4JY6B 1TPXC 4QRRB 4DAGH 4YHOL 3CH1B 4PG9A 4PJ5B 4ESKA 4OFYD 3L3OB 2HG5A 4YWGL 2DLFH 3A6BL 1TZGL 4M1GL 1KFAL 2IAMB 4ZFOA 5FA3B 3WS3B 3E3QE 3A0OA 1UA6H 5J0BA 4E5XB 1UJTA 1TLKA 3PP3H 1YC7A 1M6OA 4X7SH 2XZZA 2ADGB 1TPXB 1Z9SA 2XOTA 3QWRA 4MNQE 4PGJA 1G0DA 3HC0A 3EHBD 5HTSA 2RQ8A 5E4EC 4U1IB 3QUYC 2OM5A 1BHGA 3S88H 1SMOA 5EA0H 3DX8B 3RDTA 4XH2B 5F1KC 1MCWM 1E4XI 2PXYD 3P4MA 1JCKA 3GMQB 1DBBL 4BZYA 1GGYA 4OD3H 4LPVA 1Q72H 1R3JA 2J88L 3L9RB 2W38A 1FZJA 2D03L 2DQJL 3FO1A 1DBKH 4Q58C 4ELMA 5E2TL 3V7MA 2PKDA 2DI9A 1U8OB 1S7TA 5E4EB 3QUYB 2HH0L 5H37H 5FFLA 3C2AL 3ARQA 3I02B 2DS4A 4JZNB 1IBGH 4HIXL 4F9PC 5HYEA 1KG0A 5CJOL 1EJOL 4NKMB 5KTEH 3H2WA 3I50L 3ARBC 3RWCA 5ERWA 4ZTOH 3THMH 3IXAA 3CVIH 1CGTA 1F4YH 4J1UB 2HA1A 1N6VA 4EUPH 1T66D 3RY6A 3BPLC 3P4OB 2ZSWB 4YX2H 4QCIA 1NDMB 3FT4B 4OZGE 2BSSA 4NYLA 5HYSB 3JVGA 4KXZH 1A9BA 2F19H 4JRXE 4MA3B 1MFCL 4MNGE 3NOIA 3RU8L 3WE6B 2A6IB 3IU3B 3MV8B 1XGTB 2WAHA 3H9YA 3ARBB 3FO2A 1JNHB 1CQYA 3QEHA 5E94A 3BPOC 5C3TA 4NGHH 4ISVB 4PJHA 1SYVB 1RUAH 1SY6A 4PBWD 4NUJA 4HS8L 3GSXA 1YEGL 4I1NB 4NZUH 5IQ9B 2P8MB 5FYJL 3BPLB 4XMKH 4LHUA 1BREA 3KNBB 5HHQB 4M93C 1R3LA 2ZUYA 4YHIA 5D7SL 3WJLA 1KEGH 2BVQB 3O41A 1OM3L 3ZHLA 1JVKA 4YDJA 3IB4A 5ISZB 1T89A 2OZ4L 1V7ML 4BFEA 4JDZB 3ZE1F 4J3TA 4TVPD 4U1SA 3BPOB 4PJDA 3QJFB 1WFOA 4BK5A 4M62L 4TPRL 4KRLB 4KI5E 4KKLC 3VRIA 5IBTL 1A8JH 2I9LB 1G6RB 3HZMA 5ESAB 2CGRL 2Y4SA 5EPMB 5HI4C 2ZWLT 2OCFD 2IANA 5AD0B 4ONFL 3P11H 5HHXH 1DSFL 2RR3A 4FZ8L 1JGDB 43C9B 4M93B 5C7XL 3O3EA 1BQHA 1BBJB 5EFIA 3FAXA 3T4AA 5GGRB 4CW1B 1KCSL 1BVLB 4P5KA 1C5CH 1YEJH 2R23B 1D9KA 4L8BB 3MTRA 4I0CC 4OFIA 4BQ6A 1QEWA 4HAGA 3UXFA 2C9AA 5DJXB 3WCYA 5T3XL 3RA7H 4UU9B 4XC1H 5FM5M 5E9DA 3SDCA 1BFVL 1ZHKA 2PTUA 4ZXBD 4ODHH 2CLVA 1A7BA 1MWAH 2CMRL 5EZJB 4PJIB 4MS8D 1U3ZA 1W0YT 4NO0D 4D94A 4JE4B 2R2CA 3STLB 3ZE2F 3ARGA 4WFFD 4Z0XA 3VFMB 4O4YL 1P4LA 1EZVY 3B6SA 3FFCA 3P9LA 3IS0X 2F5AH 1I1YA 4W6YB 5I1JL 4TUJB 4XT1C 2VXQH 2X6MA 2XT1B 1OSPL 5L8LB 4OM1L 5C0RH 1UKQA 2R1YB 4R90L 5K33A 2HVKB 3K81A 3RX5A 2YXMA 4L4VB 4YQXH 5DO2C 4BSVA 3QDJB 3OJ2C 4WEBL 5I1EH 2NZIA 3S35H 1I1FB 3FB7A 4LOUC 3WFDH 2YRZA 1A0QL 4Y4KC 3IRZA 2A6KB 3LSOA 4H25A 1RZJH 4AH2B 5C3LD 3RY4A 3U46B 1AGEA 2L4OA 3ARTA 4LCWE 1ZVSA 3BGMA 5I1IH 1CFNA 4I0PC 1S9WA 1FDLH 2DIJA 1JV5B 3MUHL 4JGMA 1T0MB 2AXFB 1BOGA 4QTIL 5IB3A 5MEPB 1JHKL 1YDPB 4JQIL 1D5XA 4HDIB 2BDNH 4YZFF 5E1AA 5DT1H 3LMJL 3UPAA 3LV3A 4Y4KB 3OR6B 5DUMH 4HWBA 1JN6B 1CICA 5IMMB 3WKMH 5F44A 1ROWA 2IBBA 3H6JA 1OW0A 2X4PA 2ZNWA 5C07A 4KQ4L 4I0PB 5FHAL 4D0DA 5T5NF 5AG8A 1GYAA 3PV6B 1MNUL 4G8EA 5DSCA 3RPIB 1EHLL 5DD5L 2OZ4A 2IH3B 4LRIC 2CDEB 1NEZA 3VFRA 5JXAH 1MCPH 2ZUUA 2J8OA 2QR0B 3QDHA 3MA7B 5IF0A 1F11B 4E41E 3P73A 4OB5H 4XNMA 3RX7A 1FFOB 4NJ9L 2QKIB 3BPCB 4GKZA 3UAJD 3GSVB 2R8SH 1MCRA 2H2SC 4Y1AB 1W0VA 5IFHH 3VW3L 3B5TA 1T2QH 3KPMA 1A6TA 3QIWC 1U3JA 4HV8B 3SE3C 1WV7T 4LSRL 4LSQL 5TFSL 4ZPVA 4N0FA 1EBAA 2P24B 1AD9B 2VXUL 1NJ9B 5MENB 5KANG 4FP8L 2CKNA 1ZHLB 4KVNH 3GSNL 5CZXD 1OOAA 4IOIB 1D5IH 1NC2A 2VLJE 3N85L 3QIWB 4U33A 2M26A 4LASH 2B0SH 4PGZA 2BRQA 5HHNA 1EUUA 3IAGC 1GSMA 4RAHA 1K2DB 2EE6A 1DL7H 1VGKB 4HFUL 4R6UA 4RDQF 4TVPL 5DEGA 5T3ZH 3TWCH 1VFBB 3VGBA 2R1XA 3UTZB 2DKMA 3MJ9H 4OFYA 12E8L 4NN6B 3UTPE 3NPZB 4X98B 1QFWL 2AJUL 3QPQD 3DIFB 1JWUA 4KHXL 2EH8H 3CXDL 4EVNA 4FQPA 4K23L 1BD2B 1PAMA 4WI8A 1Y6MR 1VERA 3QXAA 5C0JA 3CJJA 4ODWA 5AAMA 3LZFL 1F3JB 5I1LB 4X6DE 1GGTA 1R3IL 4K7PY 1LEGB 1OPGL 2YPLE 2CKBH 3S96B 4UOW0 3V52L 1PGRB 2FHBA 1CDIA 2OJZH 3BDBA 5DK0A 3KDMA 4HPOL 5I73C 4L9LC 5GSRA 1YQVH 1JGEA 2PXYA 4ODVL 5CBEB 3TCLB 5D72H 3ZDYE 1WAAF 2NY1D 3QIUD 4GKSA 4PP1C 3EUUA 1HHHB 3CZJA 5T1DL 5EZOL 3OKKA 1KIRA 4ERSL 2P7TA 2YD5A 3GM0A 1JPGA 3IU4L 4RGNB 4MJ4A 3OB0K 2VNCA 1AGDA 5B21A 3ARXA 4XAWH 5I73B 3NN8A 2WM0A 2NQCA 1O7SA 4KMQA 4DZBA 4AM0B 1KELL 5HGBB 3ARDD 1UENA 1SBBA 3ISWA 4R4FH 4PREB 1NBVL 1HH6B 1P6FA 3T0VA 1KPUA 1JPFA 4WNQB 3IVKA 3FQWA 4Y4FC 4YBLC 3KPRE 3LY6A 3IDIB 4I77L 2BY3A 5T33H 2ZCHH 2DD8L 3ARFC 3QHZH 4XVUC 4OBRA 4RFOL 4PY7A 4QRPD 5E00B 3V6OA 2JIXB 2KL6A 3ZDXE 3VGGA 3L3KA 2GUOB 2Z8WC 3OJDA 5INDA 1I85A 3QUML 4PTUA 1UWXK 5L7XL 4WU5A 4Y4FB 4ONHB 1RUMH 5IBLC 15C8L 5B3JE 1JUFB 4YNYB 3ARFB 5T1MB 5C6WH 1WITA 3GSNA 3VRLF 1LILA 1S5IL 4RQQB 4GSDL 1OAZL 2HP4A 1T1XA 4X6EA 4XCCL 35C8L 3GFUA 5J12C 4RAUB 4FXGA 1WTGT 5JUEL 3W81A 2A74A 1ZANH 3TZVD 2FGZA 2VLLB 5TQ2L 2DDQL 3JV6A 1T22A 5AWNL 2NY0C 1NKRA 1MUJA 1XZ0A 4DQOH 4PRAB 5F21B 3TYFA 4DOHB 4XCYB 3WLWC 1JYNA 3GSUB 3GSQA 3PWUB 3CNKA 3RIAK 2YKLH 3WDIA 3VXMB 5TDOB 3BD4A 4IDJH 1HHKA 2VH5L 4PGCB 5AZ2H 3TPUB 3RVXC 5C86A 4DGYH 1TVHB 3GSWB 5D7IF 2E6PA 3O0RL 4JM4H 3T1FA 5EC2A 4TSAL 4K55A 1AKJD 4ELME 5J12B 5E7FA 2IFFH 3WIHH 4ACPA 2WUBH 4S1SL 1IC4L 1LEKB 3HFML 1MY5A 4NKIH 4XCFL 3SKJL 5BQ7A 1PLGH 1GIGL 3QZWA 3BP6B 3DVGA 1J1PL 1HOCA 4R8WL 3L3HA 1KC5L 4G6AC 4LU5L 3ES6A 3WUWG 4TSBH 5MI0C 2FEEL 1RURH 2B5IC 2PCPA 5BCAA 4M7KL 4Z76A 5A2KH 4OQ1A 4ZXBA 4G7VH 1T20B 4GW1A 5E4IA 3VDBA 4DUVA 3WFEL 3SGEH 5K9QI 3ZDZF 3GJFA 4NO0A 4JZJC 2G5RA 3F6LA 3UBXA 5E1HB 1RULL 4HKZB 4DK3A 1BZ9B 1A1MB 1OWWA 5DHYB 3RX8A 1PZ5A 5AYQA 2XA8H 4OV5B 2H1PH 1I3GL 3H3PH 3P4NB 1B9ZA 5EZIH 4JG1H 2Z31B 1QKZL 3CUPB 4HIHB 5MI0B 4GRLD 3CFBA 4R4ND 2B5IB 1XF3A 4HUWB 3DNKA 2VXTL 3FT2B 3NVQA 5KJRL 4S0TD 3D3VD 1HXMA 4U2YA 5C0AB 3RKDD 3VXQA 5FUCC 5HGAA 1C5DB 2IBZX 4JZJB 3LKRB 3SKUD 1A3RL 1MPAL 1OAYH 1UH2A 3BW9B 3K4ZA 1A3LH 5DHXB 1KJ2L 1KCVH 3PWVB 2Z93B 4R9HA 1NGZB 2JB5L 2X4UA 3QXDB 3BE1L 1NCUA 5DMJB 5ADOH 1HXYB 3FQXB 1EEYA 5GISL 3TBSA 4JQVC 2EDOA 3E6FB 2A38A 4KJPD 3HB3C 4RMRA 4X9IA 2CIKB 5EO0B 3MXVH 1YA5A 4IBLT 3T1WA 1SYSA 4LCCA 3OAUL 4PJDE 2XZCH 4MD5B 1FORL 3MRBB 1CLYH 2W0PA 5DMGC 3V6BR 2IANE 4J4PD 4PLKC 2AS5M 3RWFB 3C09C 3SKMB 2ADIA 1JWSB 2Y7QB 3HI6H 3MCKB 5KSVA 1D6EB 1RQ5A 1PDKA 2FHFA 4RAVB 3LCYA 1HEZB 5F9WC 4NHCL 5C0GB 2I60L 4MHHI 3NGBC 1CFTB 3BRFA 4HH9A 3WIIH 4CL7A 1GZQB 1IGCH 3C5SA 2BOBA 5LCVH 3TV3L 2DWDA 3O6FC 1FJ1B 4LVEA 4YBHA 5E9DE 4ZO8A 5HDLA 3TBWB 1YMHA 1GC1C 4ZODA 1QFOA 3C09B 1S9VB 1T2JA 4DAGL 1PVHA 2YC1B 4IM8A 5C6TH 2VOTA 5GGSA 5JMRA 3GSRA 1TVBA 1KB5H 5F9WB 1M71B 4KKBD 3FFCE 3MRJA 2DLFL 1WGOA 3NGBB 4AIZA 4DGIH 3G6DH 5FYJU 2EYTB 2Y5TA 3B83A 3RWDB 5EH1A 4IIQC 1UA6L 3BIKB 2JELH 4YDVB 5CEYA 3O6FB 1P84J 4X7SL 2FL5A 2OL3B 3JUZA 2VR9A 1NBYB 3IXTA 2A83A 3STZA 3P0VH 4JVWA 4Q6IA 3KPSD 5F7WC 3S88L 1YEDB 5EA0L 3KPNA 4JPWH 2VABB 3DSNA 3DGGB 5D6DA 5DK2A 1T1ZA 1FQ9C 3CSYA 1NCDH 3QULB 2CRIA 4IIQB 1BQSA 1QVOA 4X4XB 4OD3L 1Q72L 5DFWH 3BJLA 1ONQA 3VRJB 1ZHNB 3QQ3B 4IJ3C 1FVEB 4PJAB 3TNNA 3MREB 1NFKA 1DBKL 5I8CA 3LQZB 2JJUA 4QYOA 2YWYA 5GS0C 4JANA 4LIQH 2CXKA 5C09E 5GGVH 4OLXH 3UZVB 2OTPA 3UEZA 1F3DJ 1N6UA 4CJ1A 5DYOA 1QQDA 1X4YA 3WBDA 1KJ2A 4MJ2A 5FYJE 1IBGL 1M7DB 2A77H 2Q76B 1GGCH 5TDNA 1LE5A 3EFDH 2V2WA 4KK9D 5DJDA 5KTEL 5C07E 4U6XA 1QO3B 1RZKH 1JL8A 4IJ3B 3GIZH 2XG4A 2YEZA 3THML 3CVIL 1B90A 4ZTOL 5E8DH 1INEH 1X4XA 5IUSA 1F4YL 4PGDB 3MGTB 2VDQH 4J3SA 4PJCA 2D9QB 1U8NB 1SEBB 5TDPA 4YX2L 3TBVA 1ZWIA 3KS0J 2X4RB 3LIZL 3NACL 3SBWA 1W2KT 1X5GA 3QIUA 2C7UB 3EJYD 4PJXB 4PRPB 2F19L 2PW1A 3FO0L 4HIJA 2WINA 3FT3A 4P3DB 5MP6H 5ICYB 2EYSB 5EO1A 3R0NA 1FFPB 4NGHL 1EEZA 5HHPB 1G9MH 1H3VA 3T0BA 3TT1H 4TQEH 4NZUL 2JE8A 4GOSA 1CGUA 4XMKL 3ARDA 5E8NA 5ETUB 1OTSC 5T3XE 4X99B 4XPFH 3NCJH 1UG9A 1KEGL 3W0WD 3RP1A 1RHHA 5DJ8B 5BOPA 1RZIB 1U9KA 2BVEA 2QSCL 3MLZH 5T3ZD 3RHWF 5FYLH 4WENB 2DMKA 2F53B 3QO0A 4QRPA 1HE7A 1SJHB 5J4MA 3ZKND 1B88A 8CGTA 1A4JB 4YFEA 3KJ4C 4NQTA 3EKCA 3P3YA 1I8IA 3P11L 3BP5A 3PWNB 1HKFA 5I1GH 4JFDD 1SVZA 3G5XB 1I9EA 1L7IL 5CEZH 1K4DA 4GG8B 1IEHA 2I27N 1C5CL 2NXZB 2MWCA 2ZOKB 3SDDD 2IFGA 1TETH 3MRIA 3KJ6H 2XN9E 4ZFZB 3PWPD 4P99A 1LK3H 3D25A 4S1DC 3RA7L 3KJ4B 4XC1L 1IQWH 4JHZA 1BJ1H 3CFEA 3ZL4L 5F7HA 2J5LC 1QD0A 1XGQB 4ODHL 3TZVA 4LDOB 4K07A 1N7MH 5J56B 3SKOB 3MRKB 1FGVH 1A1OA 4WWKC 3MRMB 3QDGD 1XGUB 3EO1B 2P42B 4BUGA 2WWKO 4C57C 3OKMB 3NZHH 2ID5A 3CGTA 3QHFH 4HKJA 3VFNA 5C0RL 1AXTH 1N5AB 3TPKA 1AKJA 3ET9F 3ARYA 3RWIA 3VD9A 2J5LB 4P46D 4HX1A 4YQXL 4PLJD 3U4EA 2CLRB 2LAGB 4QXTB 2EDDA 2HFFB 2HTKD 5I1EL 3S35L 4DZ8A 5EN2A 1PSKH 3WFDL 3F7VA 4EUPA 3BZFB 5DJYB 4XPBH 3VWKC 1RZJL 3K7UA 1TZHB 5DD1H 5DQ9A 1LE9A 4RWHA 1GGIH 5F1NB 4DVRH 4GS7C 2EC9U 5I1IL 3GKWH 1FDLL 1CD8A 5I1AB 2MCPH 4P59H 1UZ8A 1C12B 3BFOA 2JJSA 3V6OE 1GZPA 1IGYB 3RUGB 3B9AA 1Q9WB 1WAAA 4OLWH 4J23A 2GK0A 4BFIB 2R0WH 5DUML 5BRZE 2YZ1A 1ZA6A 4GRLA 1CLCA 1YQ2A 1VEOA 4LSPH 3AB0C 1EX0A 3O3UN 2D9CA 4OKVB 2WZPD 3WKML 4PLNC 1U36A 3L95A 3W2DL 2B1HL 5F3HA 3D3VA 4FXKA 2G2RB 4HXAH 3HAEH 5HHMD 4ODUA 3VH8G 1ND0A 3U0TB 3BIBX 2C4FT 3LKOA 3LPGA 3IJHA 4WHCA 3TO2B 5JXAL 1MCPL 3Q1SH 1I7ZA 4O58H 5K9KB 5SX5K 1P5VA 2OI9C 4LCIL 2OJEB 4Z7VF 4TNWF 4J3WA 4OB5L 2ORBH 3VXSD 4DN4H 5E8OB 4I4WB 3AB0B 4TVPE 2NNAB 2BZDA 2HTLD 4AK1A 1OP5K 2R8SL 1S7XA 1X5HA 1W8OA 5IFHL 2HLFC 4P9HL 3QZWG 3UTQA 1JF1A 1T2QL 3KPLB 1CDUA 1K6QH 5IW1A 3BHBA 3FO9A 1N6QH 2CIIB 2FGWH 4J4PA 1KIQA 4LCYB 3QJHB 4GXVH 4YLQT 2OI9B 4MWFB 3DYPA 3RNQB 1H9VA 3FFDA 3ROLB 5KSBF 1S7RB 3OXRA 2YZ8A 3BKMH 3X12B 3NPSC 1MWAA 1P7QB 4I18C 5FOBB 5FO8B 4KVNL 1D5IL 4NOBA 2BC4B 2H32B 1KCKA 3GJFK 3LB6C 4WI7A 3ZT5A 3AS0A 4IRSD 2E6QA 4CVZB 2B20A 4LASL 2OR9H 2B0SL 4OUUB 3MNWB 4N0YH 5JZ7D 1FVCA 2DM4A 4JVUA 3CXHJ 3BD3A 4U1NA 4FG6C 2R9HD 3DUUB 1DL7L 5D1XB 5D1ZC 5T3ZL 3TWCL 4OZFG 4WFFE 3MJ9L 2Q87A 1QR1A 4V1DD 5E6ZA 4KPHH 2AQ2A 3NPSB 1U91B 1RY7B 2P5ED 4HUKB 4I18B 4WFED 2EH8L 3BDXA 3ILQC 1LO5B 2V9RA 1QTYT 4Y4HC 1CTNA 1S7VB 1Q1JH 5D7IA 4AQ1B 4PRHB 4WV1A 3OZ9L 5DMYA 4PJGF 5ICZA 1BFSA 3RAJH 3RFZC 4LCUB 1KIUA 5ESVB 4MD0B 3QUXC 5D1ZB 1S3KH 2CKBL 3ALWA 3HRZB 4PV8B 2EH7H 1CG9A 2ILLA 2W0FB 3TIDB 3KPSA 3QUKA 1IGMH 4EI5D 3I6LE 1FZMB 1J8HD 3V5HB 4I8DA 1YQVL 2J4WH 2VJXA 1KXVC 4LPYA 4KK5D 1X4ZA 5D72L 4Y4HB 1L9NA 5CEXB 4M61B 5EO9B 1IAOA 2DQTH 3CFDA 4WU7B 1H0DA 1XF5A 3WJJC 3LN9A 4KDTA 4R0LB 4UZGA 5H2BB 1MLBB 2ADFH 1TTFA 3ULUH 1AR1C 3I9GH 1A7QH 5LJYH 4HK0B 2UUDK 4M8QB 3KYKH 1BVKA 2VUYA 5JHDB 3LH2H 1R24A 1FL5A 4XAWL 3RWEB 1RZGB 4K94H 4QOKB 1UXSA 2NY6C 4AEFA 3MLXH 3RGVC 1X5FA 3C8DA 4JG0L 3EDFA 2R2HB 2VQUA 4MAYB 5EU3B 3CX5J 4R4FL 5KSAC 3BZDA 1WF5A 3HZVB 1MHEA 5DD6A 5T33L 2ZCHL 4X83A 3CAFA 2P4AB 3RVWD 3QHZL 1FL3B 5EU4A 4KJQC 4IRJC 3HPJA 3G6JF 3CPLB 4HLZG 3CDYA 2NY6B 3C5ZC 3RGVB 3ZE1E 1WZ1H 3MQIA 1PX3A 5C0ND 3W9EA 1YUHB 3BSZH 1ZGLA 4M9OA 1RUML 3FQUB 1I3RA 5D1QD 3MGOA 3MROA 3DRTA 4NIKB 4U4BA 1NSNH 1EFQA 1MHPH 1NAMB 3SGKC 3IGAA 3V79C 2ICWB 2GITA 2WW8A 1KJMB 2W65B 3OAYK 4KK8C 1NMCB 4LVNC 5J9PA 2ZNXA 3C5ZB 3D69B 3C2SA 3W0WA 4GLRI 1A7PL 2RFXA 4TTDC 2YN3A 2M8XA 1PKQB 1ZANL 2R2BB 5DVKA 3LKPA 4K2UH 5HDQL 3B2VH 3MJ9A 4M00A 2HRLA 2YUWA 5I75B 5JPMA 1I1AC 2YKLL 4WFGD 1I7UA 4V2BA 5SWZB 4IDJL 3A6CL 4N1HB 3D2UD 5AZ2L 4UOW1 3NA4A 4DGYL 3U7WH 4JFDA 3ZE2E 4Y5XC 4DVBB 4JM4L 2G75A 3EDJA 5F3BA 5TE6H 2BXZA 2IFFL 4YGVA 3WIHL 4O00A 2FRGP 5CFHA 1PLGL 2LVCA 3FOLB 3DI2B 3ZMRA 3D0LA 2CKBA 4JKLA 2JKXA 1C16B 3K46A 3SDDA 3FQTA 5E8PB 2X4OB 4LK4A 4C58B 1I1AB 1QR4A 2AW2A 4OD2A 3PWPA 4TSBL 1RURL 3OX8B 5E6IB 2CDGB 4YIQA 4C56D 3UJIH 4G7VL 3VFSB 1OGTA 1S7WA 4Y5XB 1ZHBB 2DOCA 4U6HB 1XAUA 3MRFB 1I4FB 1ETZB 1UZ6F 3R8QA 1LVEA 5F7DB 1J0KA 1KN4H 4PJCE 3MUJA 1IT9H 1DQTA 4KRPD 5FV2A 5LKNA 1H3UA 3EYOA 3WD5H 3QDGA 2XA8L 1U8HB 2H1PL 1NBZA 3H3PL 4YAQA 4XP9H 4U1JA 4UNUA 4JG1L 3BOVA 5D7LD 5SV4A 3VGHA 2LTQB 5KSUA 1NGXB 1MCOH 4P46A 2BNQD 2P8PA 1J8KA 4YZFE 5IJKC 1T83A 4C83B 2FSEA 1KCLA 1UGNA 1A7OL 1OAYL 2AJZA 4NM8H 1A3LL 2UYLB 3DVNA 3P9MB 1KCVL 4UUJA 3K8MA 3RZWA 2WWMD 1QRKA 1S7SB 1V3MA 1JHTA 5FYLD 1EFXD 5J06A 2R2EB 1B0GB 5ADOL 4JRWA 2V5RA 2CDFB 1HHJB 3QEGH 2ZCLL 1UB5A 3HI1B 3IETA 4X5WB 5GRJH 3QQ9C 4QT5B 3MXVL 4AENB 4P9MH 3QWOA 4XZUB 1I8MA 4Z7WB 4F57H 1AIFB 2XZCL 2X09A 3PP3K 4NRXB 3VXPB 4D0BB 3U0PA 1CLYL 1HI6B 3UPRB 5CEZD 1X7QB 4X7EC 4L4JA 1WFNA 5IG7A 1JZ5A 1Q94A 4O51A 1RJYB 4W4OC 1HZHH 4G43A 1MFBH 2Q6WB 5KZCB 2LE9A 4IRZH 1OGAD 1A7RH 2VLRD 4LSVH 3OXSA 3RVVC 1OTUD 4HCRH 2UWEF 5DJ6B 4HG4J 2AXHA 3NFNA 4K9EC 4F7EA 1U95A 2AJSH 2HVJB 3WIIL 2CUIA 5LCVL 2YPVH 1BX2A 4OIIH 4RDQG 5HDOA 2PYFB 2BOCB 5I17B 1T4KA 4WO4B 4PB9H 4P2QD 5AZEH 1LD9A 3X13A 1RIUH 3C5JA 3F8UB 4AJ0A 1ZT1B 1LNUB 5C6TL 4KV5E 5IEKB 4F9LC 3FRUA 1KB5L 1R3HA 3WDJA 4ZFFA 1BM3H 2NW3B 3FB8B 3WIHA 1DQJA 5D7JC 3ZE0F 1TFHA 4DGIL 4R7DB 1NGYA 3G6DL 4O2CA 3Q0HA 1NLDH 2CH8A 1ZSDA 2JELL 5IMLB 4FQCH 5EU7E 4LNRB 3L7FB 4XAKE 4JDVB 2VDLH 1D5ZA 4F7PA 3CXHK 4NBZB 3U30C 2X4NB 3U1SH 4NNXA 2AV7A 5AUMB 2EKSB 2OQJB 3P0VL 4GRWB 3B3IA 1HCVA 1T7YA 4QHKI 4JPWL 2X9XA 4IRSA 5D7JB 1JNLH 3ULUF 5C92A 3BWAB 1DFBH 2CXGA 2O26U 5IJVA 5B39A 2OYPA 3MZGB 3LEXA 5CHNA 2VZVA 3U30B 4PJ9B 3KYNB 4LIQL 2P5EA 1WAAE 5GGVL 4OLXL 2CK0H 3AS1A 4G42B 3K3QA 1FNSH 2VAJA 4F33B 3L3DB 2BVPA 1SEQH 2EXYD 1DBJH 1HSAB 3EFFA 1IGTB 1DUYB 2A77L 1GGCL 3D3VE 3EFDL 5D6CA 5GJTH 3NCEB 2DLGA 1RZKL 2NXYC 4G8IB 3MC0A 1NCWL 3PWJA 3LN5A 1INEL 3CX2A 3GMPA 3PNWB 4EI5A 1U8PA 2VDQL 1J8HA 3B9KD 5M94B 2H3NB 2Q7NA 1CIDA 4CVXB 4NDMB 5C2UB 5IKCA 1KTLA 4KJWC 3CC5A 2ZG3A 1Z9MA 5FO7B 3VGEA 2OTWB 1WBXB 5KANI 2VLKB 2Y07H 4YHNB 5MP6L 3MJ8B 5HHOD 4JN1H 4F2MA 2DQEH 3MUGB 1G9ML 3VXRD 1VEPA 4JFHD 2GAZA 2C1OB 3TT1L 4TQEL 3X11B 1CGWA 3FMGL 4HWEH 3C6SB 4NNYA 3H9HA 5BV7H 4OF0A 2NW2B 4M1CD 2Y9RT 3I75A 4P23D 3NCJL 2I9TB 2Q86A 2HJLB 1QBML 1LHZA 1QSZA 5F97E 1G7QB 5DEFA 4ZQKB 4UT7H 3DGCR 4HGWA 1EDQA 4HS3B 3VRLE 3MLZL 1DE4B 5B8CC 1KB5A 2XY1A 4JN2A 2YD7A 4QXUH 2XTJD 1WK0A 2VDRH 4Z7VA 3HPLB 2HFEB 1BZ7B 5ACLA 4GBXD 5I1GL 4MA7H 5FK9A 2VWEC 3MFFB 3EW3B 1QLRA 4BJLA 3RZCD 3BEVA 5D1QA 3T0AA 2FHCA 3PQYD 4UIMA 5CEZL 3BESR 4LFHG 4BZ2H 2EDXA 3O4OC 4PRBB 1UEMA 3WNKA 5I8KH 3ULVC 3UJTH 5M7QA 4OCYH 3WL9A 5D7IE 1EAPB 3RL1A 4S1RH 2F5BH 5DURD 1TETL 3HE6C 3KJ6L 2OK0H 1LK3L 3WN5A 4BSJA 5DJAB 1IQWL 5JO5A 5KSBA 4DCQB 1RZ8B 3HKFA 4D9LH 5JR1H 4QRSB 4PJEF 4MAUH 1Q0YH 5FYKD 3PIQA 1OQOA 2VITB 3RJQB 3Q2CA 3D39D 3T3MF 1N7ML 1X5AA 1V3JA 2J2ZA 4UBDD 1FGVL 4LLVA 3ULUD 2DYPB 1BP3B 1T1YA 1XIWD 3DURA 3NZHL 3QHFL 3HE6B 1DQLH 3LPFA 4LLUA 4K7FA 1GPOL 3T3PF 4P2OC 1NH6A 5F9OL 2BSRB 1VADB 2FDBP 2V7HA 2HT2C 3G6AA 4NRYA 1XGPA 4YFDB 1PYWB 1L0XA 4PJGA 4XBGA 5FOJA 1WCBA 1RIVH 1H3TA 5ITFA 4XPBL 5DD1L 3E6HB 1FIGH 4C56A 1GGIL 1AE6H 4I9WD 4DVRL 4UILH 4N0CD 1CFSB 3GKWL 4P2OB 4JKPH 3L3IA 2RJMA 4I48B 4P59L 3PJSB 2MCPL 2XPGA 2NY3D 2X2YA 4GG6F 1TQBC 1E27B 3AMLA 4OLWL 3RL2B 4ZUTB 1T04B 4M5YH 4MGXA 5JA8B 3MV7D 3PHSA 1P7KB 2R0WL 5D7LA 5TH2B 3LHPH 1RUQH 3OJMB 4ORZC 3OPZH 3E2HC 4LSPL 5KVEL 2COQA 2V7NA 5FUOH 3CVHH 3V8OA 1NGPL 3PL6D 4HXAL 1RK0A 3P2TA 1QPPA 1FLTX 5DZLA 3MRGB 3GMNB 4HIIA 4PG2A 1B0RA 4G6MH 1WC7A 4QEGA 1TQBB 1MFEH 1KYOK 4QRQA 2R39A 1J12A 1EFXA 1TITA 3Q1SL 4O58L 4UI2A 3SOBH 3W0WE 5DDHB 1U8LA 4FABH 2ORBL 3MV9A 4DN4L 3L6FA 4I2XA 4M1DH 2EDTA 4MXQC 1JI2A 2VERN 3VXTB 5T3ZE 3BX7C 2FWOB 4YUEL 3TA3C 1Q9OB 4HG4K 3G6JA 5D96C 5C0CB 1K6QL 2DI7A 1CS6A 1IQDB 2HJFA 4MD4B 1UYWH 1N6QL 2FGWL 2O61A 3HZKA 1LP9F 1CD0A 4FQXD 4OFPA 3B8YA 4IMLB 4OLYH 1YNKH 4L8CA 3MNVB 1G7HB 4GXVL 4NQCB 4JFDE 3PF2A 1OGAA 1Q9KB 4YO0A 4NT6A 2R29H 2VLRA 5HYJB 3Q6FB 2FR4A 4CBPA 3BKML 3EYFB 4O2EA 1CTOA 3GBLA 1DQQB 2Z9TA 5CGTA 1YEEH 4B0MM 5A2IH 5D96B 4KKAC 3PWPE 1FZKA 2OR9L 3S5LB 3H8NA 1Z0MA 4U3HA 4N0YL 4QRRD 3JXAA 1FSKC 2EDNA 3D85B 5JDSA 1P4BH 4P2QA 1F8TH 4G5ZH 1BZQK 1JK8A 1N2RB 4GKNB 2HN7A 4CU7A 5TQ0H 5ALBH 4PJ5D 5J6HB 2ZG1A 1BPVA 3QDGE 4KPHL 2IAMD 2AK4B 3SQOH 3O3AB 4P2YA 1GXEA 5C9JA 3PV7A 4C54A 4XC3H 1U2HA 1JGLH 1MCEA 1Q1JL 4CADA 1ZKAA 1P2CB 3WNMA 2VISA 3RAJL 5IV2A 3HHRB 4Q97A 4PJIF 4APQA 1S3KL 4JRXB 4HZAA 2EH7L 3PXHA 1IGML 1QSFD 4AEHL 4ELKA 2IBZY 1CR9L 2YA0A 4JFQA 3S3PA 3AC0A 2J4WL 1G0XA 1DEEA 3CLFH 4QRTB 5CJ5A 3DMMC 5C8JB 1KJVA 5D2LB 2R56H 1I8KB 3CCHB 4Y16B 2YRLA 2NYYD 4GFTB 5GGQH 3VXNA 1IL1B 2DQTL 5HJ3B 3WEXA 1XCTA 2ADFL 2JJTA 3JZ7A 2Q20A 3ULUL 2O5XL 2GTWB 3I9GL 1A7QL 3ARWA 4ONGH 3SCMC 4KK6C 3TO4C 3T2OA 3KYKL 5HGHA 3I2CH 3HAEA 3MACH 4K94L 2Z4QA 5ELIA 1KOAA 5ADPH 3MLXL 3SEPA 3DMMB 4HEPG 3ZYZA 1AGBA 5JW4R 5HHME 4JPVH 4E0RA 4PGEA 3INUH 3VXOA 3B9KA 4MCZB 1NFIB 2JLLA 3MRQA 3SCMB 1C7TA 3TO4B 2XWBB 4WEMB 3RHWK 1RPQA 5IB4B 3FB5A 4MJ6B 5JHLH 4OF7A 1G9NH 3MRDB 3BEWB 4HWZA 2A6JB 4JFOB 4GUPB 5EBGA 3ARBD 1J0HA 5DTFB 3BSZL 5HHOA 4PBXA 2JJWA 4B7LA 5F9JA 3UDWA 2DAVA 1NSNL 3VXRA 2XQBH 1MHPL 3LKSB 1VEMA 4RMQA 3WHXA 1AHWC 3JV0A 1TNNA 1E4XH 4JJ5A 1A22B 1HQRB 5CSZB 3SGDI 1VESA 5K9OA 4Z7QF 4P23A 1J18A 4HSQA 5JTWA 4FN0A 4X6FA 3P30H 2UWEA 3BYTA 1DUZB 2D7PA 1A6ZB 5ISZD 4R3SA 1WFUA 4NWTH 3VU2A 2PUQT 5I2IB 3PABA 3G08B 2AEIT 4K2UL 1QFHA 3RNKA 4G6FB 4PD4K 3B2VL 4MDJB 3HTLX 2H9GB 3VWJB 3EYUH 3O3BB 3OG6B 4OZIB 1U8KA 1CF8H 1XH3A 3KLHD 4GBXA 3HMWH 3SY0B 3U7WL 4L3EB 2GFBA 4LPTA 3RZCA 5TE6L 1KTDA 4OLZH 1T5XA 3PQYA 2P5EE 3MBEC 4U3XA 3K0WA 1S7UB 2EE3A 4DEPB 4ZAKC 2ZJSH 1OSZA 1WEJH 1J87A 4M7LL 3H7BA 4B5EA 3FTGA 4YBQC 4IMKA 4P57A 3SQBA 2FZ3B 2E9BA 1NMBH 3OKLA 1U6AH 3UJIL 1IEBA 4PRDA 2M2DA 1CYGA 1D7FA 1MJJB 1J8HE 3D39A 1RMFH 5JW5B 3MBEB 1KN4L 1R5IB 3CSBA 4HMCA 3DX7A 1IT9L 3WD5L 5BVJB 2C3VA 4F7MA 4ZAKB 1EAJA 3B9DA 1KB9J 1XIWA 4XPTH 4XP9L 2EC9T 1XR9A 2XFXB 1XF1A 3PUCA 1I8LA 4Y19D 3QSKB 1MCOL 1VSCA 4PR5B 4L4VD 3O3DA 3K4AA 5CBAB 5IM7A 1G7LA 2GCYB 3BDYL 1BJ8A 4M5ZH 4H1LG 2P8LB 4M9PA 3UTSB 4NM8L 4PGBA 1Y18A 4FQHB 4G8FA 3BQUD 5D2NA 1YJDH 5IB2A 1JNJA 5SWSE 1GC1H 3ZTNH 3IJSB 5L6YH 3IF1B 5I6XC 1ES0A 1REIA 1MIEH 1VENA 2ICEA 1KTKE 4Z78B 1Z5LB 3EOBB 3QEGL 4JFYA 1GAFH 4TNWK 4UQ3A 2BCKB 2EE9A 3BD5A 2BHYA 3QPXH 1PFCA 2W60A 3VDCA 1T0PB 3KGRA 1OLLA 4WCYH 4F57L 1L7TH 2VSDA 4LLWA 3QA3B 4GW5A 4Z7VE 4WHYH 2MHAA 4KZDH 4P5MB 2GK2A 3MV7A 4Y4KD 3V8CA 2MPAH 3QH3A 5C9KA 1UCBH 4E42A 2VLJB 2PF6A 5IMOA 4CNIB 1HZHL 1MFBL 2XKSA 4IRZL 1J9CT 2AEPH 4PUBL 3RVUD 3JUYA 3V4UH 4UTBH 5CIPB 1NL0H 3BH9B 3GB7A 3PL6A 4I0PD 4HCRL 1BIIA 4KQ3H 3REWB 3AREC 2YBRA 2ZUTA 3BO8B 1WT5A 2A6DA 2AJSL 2DL2A 1WSST 2YPVL 2CO6B 4F7CA 4OIIL 5KSBE 1RIHH 1AD0B 1MQ8A 3PHOA 4NZTH 1QOKA 1U8IA 5AZEL 5GSVB 5GS0H 1T7WA 2ZCKH 5GZNC 4HKXB 4KKNA 3UJJH 1A6VH 4HK3N 4YFLI 3UC0H 2MNUA 4LIQE 3S4SB 3AREB 2NTSP 4QY8B 4WFGE 1I9RH 3KPOA 3L5WA 4LKXB 4FQXA 1K8DA 3KYOA 3QRGL 2CLZA 1NCCH 4KUCF 1MCIA 5DJZA 3DRQA 4FQCL 2LU7A 3IFOA 3T0ED 3L7EB 3PGFH 2VDLL 3D9AH 5MEND 2ATPB 4ZUWB 5C0IB 1EZVX 4UQ2B 2H2SD 1BQLH 1RU9H 3U1SL 3AXLA 1EEUA 2F74A 4M6OL 4PJGE 3QIWD 2EIZA 5JOFA 1Y0LA 5DUBA 2RB8A 4ZUUA 4JY6A 1JNLL 2Y25A 3WDHA 2UVEA 4QRRA 4C56E 1DQDH 4N5ED 2Z35A 4PJEA 1EH9A 4JO3H 5EOTB 3G5ZA 1DFBL 3VG0H 3CH1A 1CLOH 4PJ5A 3T0DA 3L3OA 3B5HA 2R0LL 3OKNB 2AJ3A 2XNAA 3C60C 2IAMA 2BJMH 3KPRB 5FA3A 2W9LA 2CK0L 1BD2D 3EIFA 3EOAB 1FNSL 2HRPH 1U58B 4P2RB 1SEQL 5CS7A 3TGXA 2ADGA 1DBJL 5L8JB 3MJGX 1DN0B 32C2B 5GJTL 3WIFA 4OZGF 4U1IA 3MR9B 4PG9B 3DX8A 1QSFA 4XH2A 4ZS7H 3TBTA 3C60B 2EEDA 4OFKA 3RDTC 3GMQA 4ZFOB 1MHCB 3SE9H 1OARH 4Z18A 3MV9E 3L9RA 4I2XE 4O9HH 1M6OB 3QI9D 2Y07L 3NMEA 2J8UF 1G7PB 2FBOJ 4OGAC 5IHLB 1S78D 4GG6A 3HC0B 3QXWA 1U8OA 3G6JE 4RGND 4JN1L 4Q2ZA 5HYIA 5CEZE 2DQEL 3KPPB 3LRGA 3RKPA 4HCRA 1N3NB 4PRID 3ESVF 3O8XB 2AJYH 3I02A 4O2FA 4DN3H 3RDTB 1OAUH 2MCG1 3QFDB 3IFNH 4HWEL 5BV7L 1OGAE 4NKMA 2YXFA 3LQAC 1QLEH 2ICCA 1YMMB 4XMLH 3V4PH 1R3JB 2NZ9C 4FMFA 4LLMB 3S6CA 1FZJB 4UT7L 1EHAA 2QQKL 3FO1B 1CE1H 4N0RA 4X6BB 4WTZA 1ZXQA 3AAZB 5KN5B 1NGQH 3P4OA 3P0YH 1P6AB 2ZSWA 1IAII 4JPKH 2EDFA 4HZLA 3RY6C 1S7TB 3VJ6A 4QXUL 2BY1A 2VDRL 5HYSA 1F58H 4PY8J 4P2QE 3MRNA 2N7AA 3JVGC 3AS2A 4JY5H 2A6IA 3IU3A 4OTXL 1KG0B 2MTPA 2VDNH 3ARBA 4MA7L 1JNHA 4Y4FD 5HPOA 4MNQD 5IR1B 1WICA 4MJ5B 2ITDA 1SYVA 3GMLB 1YY9C 1A6UH 1A2YB 4MXVF 1PZUB 4BZ2L 1LP9A 5IQ9A 1ADQL 2P8MA 5I8KL 5LVEA 4CKVX 3UJTL 4KUCD 4N0UB 4OCYL 4UT6H 3PP4H 4S1RL 2F5BL 1QACA 3ZYJA 2IQ9H 1GGUA 5F8RC 4UTAL 2OK0L 4RFEA 3WUWB 4D9LL 5D8JH 5ISZA 5JR1L 5HBBA 1XFPA 4MAUL 1Q0YL 1T89C 5IBLD 3OJVC 1QBAA 5K9JH 5F7UA 3FO2B 1WBZA 3OHXB 3QEHB 2I9LA 4PJHB 1IAIM 3VXMD 4FFZL 1UQSB 4MVBC 3GSXB 5AD0A 43C9A 4K7PX 1UZ6E 1BBJA 1DQLL 4CW1A 5GGRA 1R3LB 1BVLA 4M7ZC 4YHIB 3ECBB 4P3CH 3FONB 4NZDA 4NQXB 4GJTB 4L8BA 4NO3A 1BFTA 1D9KC 3W5NA 2DM3A 1MFAH 5DJXA 1PQZB 4ZOBA 4UU9A 1RIVL 3OG4B 1KB9K 1YPZF 2PO6B 1FIGL 3RVXD 3SDCC 2IANB 5EZJA 3CIQA 1J7VR 4PJIA 4PJAF 3O3EB 4M7ZB 1BQHB 4UILL 5EFIB 5C70A 3T4AB 2MQ0A 3IDMB 3STLA 4JKPL 3VFMA 4J6RH 1DLHB 3VG9B 2A9NH 3ARGC 3LKNA 4IHOA 5BOZG 2ESVB 4JY4B 1EPFA 1RUKH 2Z31D 2NTFB 1QEWB 4AIOA 2R1YA 4J2XA 4DKDC 1JWMA 3OPZL 4Y19A 1EEQA 5FUOL 4OF8A 5HHOE 3SDCB 4L4VA 4RMTA 4U6VH 1NFDF 25C8H 4JM2F 3VXRE 2DTSA 4JFHE 1OD7A 2IBGA 2J1KA 3BQUA 4G6ML 4TTGA 4Z0XB 2A6KA 4UNVA 1P4LB 4XMPH 1MFEL 1UVQB 4J3UA 3GMRA 1T3FB 4MA1C 1ZLUH 1QRNB 1L0QA 3RWJA 1I1YB 3SOBL 4MCYB 5IOPB 3U46A 3FCTB 2UWEE 4N5UA 3F7RA 5T5FH 1RZFH 4GAFB 1P9MA 2I07B 2X70B 3U36B 4PJXF 5JNYB 1C8PA 4M1DL 1JV5A 4KUZH 2AXFA 4UNTA 1KFAH 5MEPA 1MOEA 1MCLA 2XTJE 4Z9KB 3T04D 4FQ2L 3IDYC 3VFOB 2WBWB 5EC1B 1UYWL 4Y4KA 1OCWH 3FB7B 3OR6A 4OLYL 1YNKL 4XP5L 5HVWA 1JN6A 4PFEA 4JR9H 1N5YH 2EO1A 4MA1B 2APBA 4H25B 1CICC 4U49A 2R29L 5IGXH 4NWUH 4I0PA 1N64H 3N9GH 3PV6A 1OW0C 3RPIA 1U8JA 1YEIH 1ZVSB 3MGAA 4LHQB 3IYLW 1UADC 2CDEA 1AI1H 2FX7H 4NSKA 1BOGB 1YEEL 2J3SA 2E3VA 3MRLA 3PG2A 3MA7A 4R2GD 5E1AB 3UO1L 2DF3A 2HT4C 2XIDA 1P4BL 2QKIA 3BPCA 4WUUD 4G5ZL 4H8WH 3GSVA 1CICB 4Y1AA 3D39E 5TQ0L 5ALBL 1CN4A 1I1RA 3Q3GB 4Z95H 2X89D 5DF0A 3ULUE 4X6DF 5C07B 3OAZH 4RX4D 4HV8A 5EORH 5DSCB 1OTTC 3SQOL 4X7FC 4GMSH 3QCUH 4RGMC 1KEMH 1FP5A 1HSBB 1NEZB 3O6FD 5DI8B 3X3GH 1JGLL 1F90L 1M05B 1URLA 3T0EA 5IF0B 1AD9A 3P73B 3DROA 1NAMH 4JREB 3TJHD 5A3IC 5MENA 2W9DH 4LCWD 4RISH 2H26B 1ZHLA 2Z8VC 3MBXL 4AEIH 4GKZB 5F1IB 5I19H 2AV1B 3WNPA 3QIWA 2QADC 3SE3A 4TOYH 1A6TB 2YD9A 5C0DB 5FGCE 1VB9A 3CLFL 1IGJB 4RGMB 1A1NB 2R56L 4I9WE 5F8QC 1F42A 1IRAY 1VGKA 4ZPVB 5DMKB 3LVEA 5GGQL 1VFBA 3UTZA 4PY8I 2H8PB 2GQHA 2CJUH 2YOCA 4X98A 2DI8A 3CVHA 1TCMA 4ONGL 1N8ZB 1BD2A 4ZDHA 3I2CL 3MV7E 4WDIB 5F9DC 1NC2B 1JRHI 3MACL 3REVB 1F3JA 5ADPL 4LLDB 5I1LA 4JHWH 3DI3B 2IF7A 1OM3H 4JM2D 4JPVL 3INUL 3QQ4B 1K3IA 3EHBC 1H3XA 5ID1B 1QBBA 4OZ4B 4WEUD 3VGAB 4H26A 4C55A 3TCLA 3FN9A 2PXYC 3RUGF 2BSED 1JWUB 5IVNA 3BXNB 3PDGA 4JHBA 5JHLL 4PRPD 2GSIA 1HHHA 2E7LA 3QI9A 2YHGA 4G9DB 2P1YA 5I9QC 5IW6A 1T1WB 2BXYA 4IS6B 1DR9A 2ZUSA 4J12A 4XXDB 4RIRB 4PRIA 2XQBL 5DK0B 4RZCB 4AM0A 5GSRB 5A16B 2HT3D 1E4XL 1JGEB 4PREA 3SGJA 1HH6A 3IDXH 3RVTD 3TF7C 4WNQA 3CFIC 2CMRH 3P30L 3GO1H 2APWA 1M1SA 4JZOA 4OAWA 3IRPX 4OCWL 4AY0A 5I9QB 5JQHC 4NWTL 5T1KD 2P43B 2P7TB 5CJQH 1T66C 5E00A 4XRCA 4QRRE 2NX5B 1RVFL 1AGDB 3EYUL 3V6OC 4PJEE 5FCUH 2GUOA 1CF8L 2PN5A 2IQAB 1QBLH 2Z8SA 4PJ5E 3N1PC 2MSPA 4R90H 4Y4FA 5E8EA 5HGGS 4ONHA 4L9DA 4MNQA 3FQWB 1A02N 3MLWH 4OLZL 3ULSB 3BMVA 1JUFA 2K7PA 2NXZD 1IZJA 3ARFA 3MJ6A 2F15A 5T1MA 4NJAH 3VXUB 2ZJSL 4RQQA 4PJBB 1MI5B 4XPAH 2EDRA 1WEJL 4NN5C 5HGDB 3T3PE 1HIMH 3GK8H 3TN0D 2NR6D 1NBQA 5D70H 1YNTB 1FNAA 1YC8A 4RAUA 1X3DA 2DQFB 1U6AL 3IDJB 2VLLA 5IFAH 2Z92B 4PRAA 4WU5B 1RMFL 1CL7I 4JO4H 4XCYA 3GSUA 3PWUA 1JHKH 4XHJD 1JF6A 3VXMA 3WYRA 4XX1E 3DPBA 1ZEAH 1AQKH 2ZPKH 3CK0H 4UAOC 3TPUA 4XPTL 4ZPTA 1MFDH 4NN5B 1TVHA 2DIAA 3GSWA 4FOMA 5I76B 5KAQG 1BF2A 1A14H 1T1XB 3DO7B 4LMQE 1LEKA 4L5FH 4ZD3H 3MRRA 4K9EH 4S2SB 5HHVH 3BP6A 1FG2B 4PPTA 3RWHA 2VQTA 4M5ZL 1T22B 1AC6A 3QNZA 3VH8B 2OL3L 1Q8MA 1TQCB 4KDVA 5JOEA 2ARJB 1GC1L 5ACMA 5L6YL 2FH8A 3U48A 3VA2C 1MIEL 4OZGA 2O93L 1HHKB 4NJ9H 3B9EA 3QQNA 3CSPA 3OKOA 4ZXBC 1YN7B 1GAFL 4GRWH 2UZYB 3VW3H 4MS8C 3QPXL 4WI9A 1CDYA 2D7NA 4HKZA 1BZ9A 1A1MA 3S34H 4Z7NF 4WCYL 3S9DB 5DHYA 1L7TL 1I1CA 4OV5A 3QZWB 4LSRH 3DVGB 3P4NA 2DQDH 1HOCB 4KZDL 1DN2A 2Z31A 3L3HB 4Q9CA 4HIHA 2MPAL 1UCBL 2HYMA 1A21A 4M4PA 2J8UA 3BISA 4HUWA 3ES6B 4NPYB 4YHPB 5L88H 3TJEH 2QV2A 4Z76B 2AEPL 1FNGB 4ZXBB 3V4UL 4UTBL 1NL0L 3SDAB 1C5DA 3LKRA 1ORQA 3BW9A 4KQ3L 1LP9E 1CDJA 2YS4A 2VMFA 1G6VK 3N85H 1NGZA 3QXDA 3VD5A 5EG6C 1KXTB 4UINH 1HXYA 1EXUA 3U0WH 3E6FA 1RIHL 3AS3A 5ISZE 1AGCA 1TDQA 1MHHA 2CIKA 3BVNB 4LEOB 2VZTA 5GS0L 1UXWB 3CFBB 2ZCKL 12E8H 4R4BB 4LCCC 1A6VL 4MD5A 3MRBA 4QRUA 2BNRD 4XXCA 4OZFB 4CMMA 5DGQA 3UC0L 1VPOL 5HGAB 1EERB 4XCEB 1I9RL 1JHLH 5B22A 1A3QA 1JNNH 1NCCL 1JWSA 4FFWC 2Y7QA 4JQVA 4XCNB 1UFUA 3H42H 1EEYB 2AXJA 3PGFL 1HEZA 3U4BH 5C0GA 3D9AL 2AJXH 2E6JA 3O4LD 3TH3T 1BQLL 1RU9L 4DKEH 2HLFD 1SYSB 4LCCB 3MRHB 3G9AB 4ODVH 2KQMA 1FJ1A 3TBWA 2YUVA 3ARZA 1DQDL 4PJIE 5ABDE 4WUUA 4AMKL 2YC1A 1TJHH 4JO3L 4HQQL 5D1XD 3VG0L 2X10A 2OXHA 1CLOL 4HPYH 4IOSD 4ERSH 1M71A 4MMZC 2X89A 4RX4A 4NN7C 1SM3H 3L3JA 2BJML 3TVMB 4N8VG 1SBSH 5EIQA 3RWDA 4OLUH 3BIKA 3LEVH 3LB6D 1AJ7L 4YDVA 2HRPL 3O6FA 4HH9B 4JRYB 3C5SB 3AVEA 2OL3A 4U1MB 1NBVH 4Y19E 4KMTH 1JZ3A 4L4VE 1NBYA 4HHAB 2D7QA 3QDJE 4LCWA 5D1ZD 4QHUB 5GGSB 1UM6H 3N50A 1ZS8B 1YEDA 1FYTB 1P1ZA 5CZXC 4RFOH 4ZS7L 2VABA 3DGGA 2FX8H 2D4DA 2WLZA 3HC3H 3QULA 4U0QB 1YPZA 2FECI 3SE9L 4N9GB 1OARL 5GHWL 3JTTA 4D9RD 3VRJA 1ZHNA 3QQ3A 3QUMH 2UVFA 4PJAA 1ZAGA 3KHOA 1F3DH 3MREA 3LQZA 2FL5B 1R5VB 1RZ7L 4YHKH 2AK1H 5ACZB 5L2JB 3IXTB 2A83B 4K7PH 5CILH 5FECA 3UTOA 5JHDD 4FXLA 3MOQA 4U05A 3STZB 3QPQC 2OSLA 1FNHA 4QOKD 2AJYL 1S5IH 3X14A 2IMMA 4DN3L 5FGBC 4PIRF 3KPNB 1IM3B 1OAUL 3TESA 3GI9L 5D5MF 1VKXA 3IFNL 2Q76A 4MAYD 5DK2B 5BJTB 35C8H 2DLTA 3CSYB 1QO3A 1NFDA 1QLEL 3QUZD 4JM2A 4XMLL 1ONQB 3KS0H 1F00I 4QHLB 4GH7B 2X9WA 3MGTA 4KRMB 3LDBB 4NUGH 4PGDA 1CE1L 2N1KA 1MRFH 3TT3H 4Z7WF 4QYOB 5KBNC 5C0BB 1NGQL 1U8NA 3P0YL 5F96L 4Z7QE 4JPKL 4JFEB 4HH8A 2L7UA 5BZDA 2NY6D 3ILPB 1F58L 2NY1C 3AU1B 2C7UA 1CD9B 4HUUA 4PJXA 3BP4B 4PRPA 1F45A 3SBWC 4LP5A 1DJSA 4JY5L 1UM5H 4Y1AE 1HHIB 4OM0H 5ESQB 4S1SH 2E7HA 2VDNL 5DJDB 5CKGA 2EYSA 1FFPA 5HHPA 1WTLA 1A6UL 2DBJA 3H7LA 4JAMB 2VC2H 3ETBF 4BKLA 4JFFD 4LF3B 2D7MA 4X8XA 1NAKH 4KZEH 3PP4L 5ETUA 3T0EE 4HFWB 2IQ9L 5F88B 3TBVB 1IAKB 2VAAB 2NY1B 5MENE 2ICES 2VSCA 5D8JL 4U2ZA 3TIEB 1HDMB 2IPUK 3FT3B 5T1KA 5K9JL 5GZOD 4NM4H 2F53A 3L3GB 1SJHA 5EO1B 5C09D 3T2QA 1EEZB 3SE4C 4F58H 4JHAH 1LDPH 3UYRH 4YK4B 4FTVD 3S36X 4I3RH 5BS0D 2YWZA 1I9JH 5ID0A 3G5XA 4HJJL 2C3GA 5KJRH 4X6DA 4LSDA 4BK4A 4GG8A 5ICXB 1GL4B 1A3RH 4P3CL 5DD0L 1QLFB 4YJZL 1BD2E 4JEGB 2ZOKA 3FRPA 4GRWF 4R7NA 1MFAL 4D8PB 3QO0B 4QRPB 4ZFZA 4WW2C 4XTRD 3IAPA 3N1FC 5E6ID 2C3HA 1WWBX 1ODAA 3QNYB 2VQ1B 1XGQA 4YC2C 4QNPF 4HMDA 1W72H 4POUB 3BP5B 1WZKA 3DX6B 3MRKA 4J6RL 4OLVH 1J11A 1AO7B 1MVFA 3MRMA 1K4DB 3EO1A 2A9NL 1MCQA 3UZQA 4Y0GA 4KDWA 3P4LA 3OKMA 1RUKL 4W6WB 1IM9D 2GEEA 3QCTH 1OY3B 3PE9A 1NGWA 3ARSA 4WW2B 3ZT7A 2EDYA 5EU7C 3V0AC 4RGNE 4GLRH 4YC2B 4FA8A 4U6VL 3RGHA 5FUZL 4QXTA 25C8L 4PRIE 4LSSH 1YEFH 3M1BB 2QSTA 3BKYH 4XB8A 5A2LH 4Y89A 4XPHL 2DBLH 2JCCB 5DJYA 4XMPL 1KN2H 5EOQH 1ZVYA 4FFVD 4PTTB 1MCBA 5F1NA 4U0RC 5T5FL 4KMLB 1RZFL 3HMXL 2BSTA 4RGOL 3HUJF 1AKJB 4KUZL 3S3SA 1C12A 3H9SB 5KG9A 3DWTA 4HX1B 1IGYA 3CDCA 3RUGA 4NQDB 1MCNA 1VDGA 3WUZA 4BFIA 4OD1L 2RGSA 1OCWL 3F7VB 1IC5H 4EUPB 4OKVA 4JR9L 2XN9D 4NFCA 1N5YL 2FATH 2P47B 3HCVB 4R4NC 1RJLA 4U0RB 5IGXL 2Q8AH 4NWUL 4LGSB 3QQ9D 1N64L 3N9GL 4X5XB 1BVZA 1YEIL 5LGJB 3U0TA 2X4SB 2R0ZH 1AI1L 2FX7L 3S5LG 2G5BB 3TO2A 1G7MB 1G7JB 5K9KA 3NIGF 2YMXH 1MVUA 2OJEA 2EDKA 4YPJA 3QB7C 4WO4D 5E8OA 4I4WA 3CFJB 3HNVH 1T6VN 2NNAA 2VXVL 4KJPC 4H8WL 3SKNB 4XVTH 5D93C 4DOHE 3L95B 3ZHDA 3D3VB 3KPLA 4Z95L 2BNRA 2LAAA 3DBXB 2Y6SD 2A1WH 3CDGA 3VXME 5EORL 2CIIA 4KI1A 4GMSL 3QCUL 5FKPA 3ZKSD 3QJHA 1JGUH 1KEML 1KLUB 5B38A 3VFUA 3X3GL 4MWFA 4HAFA 2VB5A 1FHGA 1I7ZB 3RNQA 4AT6A 4M02A 1XF4B 3OF6D 3EOTL 5D9SB 3ROLA 1FNFA 1N4XH 2EEAA 1S7RA 1CI5A 1NAML 3O4LA 2E5EA 2W9DL 4J8RB 4RISL 2I5YH 5D93B 4AEIL 3WNNA 2DLEA 4LRNH 5I19L 4JO1H 4PJ8D 1JF1B 5D7JD 4CVZA 2PTVA 4OUUA 3MNWA 4TOYL 3GGWA 3LIZH 3NACH 2VIRB 4MQXD 2A0LD 1KIQB 2BY2A 3C8KB 4NC1C 3FO0H 5BRZD 5D1XA 1HYSD 2YA1A 4CVWA 4DGVL 4RCAA 4PJ9D 5I66B 2CJUL 3FFDB 4OZHB 1U91A 3RWGB 3O6LL 3NIFF 4I18A 4KKBC 3OXRB 5C0EB 5HI3C 1MWAB 1V05A 1LO5A 1SJEB 4I5BB 1S7VA 2J8UE 4DFIA 3BZ4A 4X80L 2BVTA 4WV1C 1U93A 4JHWL 5C0AE 2VDKH 1FVCB 1KUMA 2BHZA 3KLAB 3NFPB 5ESVA 4MD0A 1RZJC 5D1ZA 4PV8A 2EDQA 2QSCH 3X17A 5CINH 1MCWW 2D7OA 3V5HA 1QR1B 4I13B 4CVUA 3KR3H 4JDTH 4Z0BH 1G9EA 2EDHA 4M61A 3KLSA 5EO9A 2UZXB 4WU7A 5I30H 3NTCH 1B4RA 1TTUA 3U82B 4AG4H 4R0LA 1MLBA 3BKCH 4BH7B 3V5KB 5FUCE 5E2WH 4KDTC 4BM7A 5IEHB 1L7IH 4HK0A 5DVLA 2BP3A 3ZTJG 1CVSC 4M8QA 5JHDA 2D3VA 4WW1A 3RWEA 1CG9B 1RZGA 4QOKA 3KPSB 3QUKB 1JZ2A 4WFHD 4OCSH 5D7KD 1NC4D 1ORSB 1VHPA 4MAYA 4QLRA 5EU3A 1AR2A 1Z3GH 3LRSA 5IWLA 3HZVA 3IDXL 3ZL4H 2DWEB 5GXBB 3WXWH 4LSUH 1A47A 2OTUB 3QUZA 4KK9C 3WJJA 4KC3B 4AYFA 4MXVE 3GO1L 3MMEB 1XF5B 3F7PC 4EXPX 3BN9D 3QP3A 1QUNA 1FL3A 4GRMB 1JPTH 2CUHA 3W82A 2ZUQC 5CJQL 3SPVB 3T4YB 3KYMB 3CPLA 1KPRA 1FL5B 5FCUL 4WUUE 1UXSB 3HG1B 1MCSA 5A2JH 1QBLL 3EJYC 1YUHA 1HH9B 3MA9H 1X5ZA 1K8IB 4WY7H 1MHEB 3FQUA 1SJVA 3MLWL 3WKNA 3QNXB 1NAMA 3A67H 5MERB 3S8WA 3QWQB 4NJAL 3I6LD 4JFFA 2ZUQB 3H3BC 1KV3A 5EU4B 4J7RA 2YPKB 1KJMA 4PJCF 4XPAL 1HIML 4N9OB 3GK8L 3HPJB 3D69A 5E7BA 5D70L 1FRGH 1GOFA 4GAYB 4U1GC 4ZOCA 1PKQA 6FABL 2R2BA 2IADA 3RTQC 5IFAL 3W9EB 3WS6A 2BK8A 3NBNA 3CZFA 4JO4L 4RFNC 5FXCH 5DR5L 5C09A 1YPZE 3D18A 2NY5C 3ZKNC 4KWUA 1ZEAL 1AQKL 2ZPKL 3CK0L 4FTVA 5ILTH 4PJAE 5I1DA 5BS0A 1MFDL 2HFGH 4DVBA 2PYED 4EQ2A 1K5NA 3W2DH 2B1HH 1A14L 3HLAB 3WNOA 4MQ7B 5DRWB 4U1GB 4HWNA 2FB4H 3W0WB 4L5FL 4ZD3L 4K9EL 1YEKH 5HHVL 2RFXB 3RTQB 4DWHA 5JIHA 2X4QB 3DVFA 3L1OL 4ODSH 3K4DA 2FJFB 2FIKB 1LK2A 5E8PA 3LKPB 4RFNB 1T7ZA 2X4OA 2VL5A 3O6MH 5KOMC 3C9NB 4Y2OA 4LCIH 3OX8A 5E6IA 4MZ2A 2CDGA 1NFDE 3VMPA 3VFSA 3LKQB 3WO3B 1ZHBA 4U6HA 1CBVH 3MRFA 1I4FA 1ETZA 3VFGH 5F7DA 4JFDB 5F3BB 1C08A 4P9HH 2G75B 1FNEA 4Y8DC 2EZ0D 2HT2D 3S34L 3T2NH 3AM8A 5DRNB 1N0XH 5HPMB 2DQDL 2LFGA 1IM9A 4PRPE 4PJXE 3LPWA 1EUTA 1I7TB 4OD2B 1NGXA 1BIHA 1V7NH 5L88L 3TJEL 3BH8A 2V6HA 3OSKA 3QDAA 4C83A 1IAMA 1S7WB 3V7AE 1T83C 2UYLA 3P9MA 2ZKHH 4PLJC 1RK1A 5LBSH 4NRZB 2HTKC 4KV5F 2X40A 5D5MA 2R2EA 3MLUH 1B0GA 4UINL 1SVCP 7FABH 2CDFA 3U0WL 2ICWJ 3W9DA 1NBZB 1A4KB 3HI1A 4P5TD 2WP3T 4U1JB 3LN4A 4QT5A 1IMHC 3DUHA 3EGSB 4Z7WA 1FV1A 1M7IB 5EBMA 3S4SG 4X4YA 5KSUB 1AIFA 2F53E 5EU6B 2J8HA 3NZ8B 2P8PB 4JKMA 4NRXA 4D0BA 2OP4H 4W70A 1HI6A 5C0CD 1MREL 3UPRA 1X7QA 1J1XH 1JHLL 4RMVA 3TBYA 1RJYA 3ZT6A 1JNNL 3OZ9H 4NQCD 4LKCA 2XN9A 4KVCH 3V95A 2YR3A 1IZKA 5KS9B 1MJ7H 2X1WL 3H42L 4RMUA 5CJBA 3U4BL 5HYJD 5E56A 4Z5RA 5J6GB 5DJ6A 2AJXL 1T03H 1WCQA 1B6DA 1WWWX 4ZFGH 4ODXB 3R4DA 4ODBD 2ZUVA 3V0WH 4DKEL 3QWOB 1ZT4B 3UZEA 1I8MB 4OIAA 2HVJA 3T8XB 2Q1EA 4NQSA 1FPTH 3H0TB 2BOCA 2CSPA 1U3HD 2FNBA 3D85D 4WO4A 4NHUA 1TJHL 4HULB 4O51B 1LNUA 1A64A 5IEKA 2ATKB 1C5BH 4HPYL 5CLTA 2NW3A 3FB8A 4POYA 2AK4D 1SM3L 5HHMB 4L9LB 1SBSL 1MJUH 1S9XB 4OLUL 3LEVL 5IMLA 1U95B 1F6LL 3I6GB 3ZKXC 5F7FA 4JG0H 2FIRT 4LNRA 4TUOA 2Y06H 4JDVA 4FNLL 5JQ6H 1BX2B 3OF6A 3GNMH 4KMTL 4B53A 1T4KB 2X4NA 3VXSB 4YHYC 2EDJA 4GQ9H 5AUMA 2OQJA 5KW9H 4LGPB 1UM6L 5CD5D 5I1CH 3TNMB 1VFOA 4WIQA 4ZFFB 4PJ8A 3TFKC 5D7JA 2FX8L 4M43H 2W91A 1DQJB 4Z77B 3HC3L 5DVOA 3I6KA 2XZAH 4UOJA 3BWAA 3SJVB 1VFAB 4Y16D 3ZKXB 1FFQA 3Q48A 5BRZA 5FF6B 4XVSH 2R9HC 4YBLB 4PJ9A 4F80A 2V9TA 3KYNA 2YD2A 4I0KA 2EYRB 4YHKL 1KSRA 3RUGE 4YHYB 2AK1L 4MYWB 3S36H 4K7PL 4IEFB 4M3JA 5CILL 4G42A 5CCKH 4BH8A 2VKWA 3L3DA 1EBPA 1B0WA 3MUZ1 3IDGB 2YUZA 3LS5L 1IGTA 3DMMD 2IC2A 5DRXB 5IFJB 4LBEB 4LPXA 1A7PH 4G8IA 1Y6NR 3PNWA 5IJVB 5BVPH 4NUGL 3LEXB 5CHNB 1MRFL 5HDQH 4EI5C 1FLRH 3TT3L 4CVXA 4NDMA 4V1DB 3NABH 3MNZB 3V5DB 3QFJB 3MYJB 5FO7A 3A6CH 4KK5C 5DS8B 2OTWA 3L5XH 4HUXA 1WBXA 2L7JA 1KNOB 3HUJA 3M17A 1FGNH 2DLHA 3IFLH 1UM5L 1PKOA 4OM0L 4XAKD 3MJ8A 2QSQA 5D71L 2DJ4A 2BNRE 2D7TH 4EBQH 3MUGA 3DVIA 2NY0B 3PWJB 5GRWA 2C1OA 3GMPB 1A6AB 2VC2L 4LLQB 1J8HB 1NC4A 3C6SA 1XGRA 2IEPA 5IKCB 1NAKL 4KZEL 2OS7A 2NW2A 2I9TA 2ZUWA 2HJLA 3CC5B 3O4LE 1G7QA 1PEWA 2IWGA 5DJ2B 4K8RC 4NKQB 1HK6A 4HS3A 5L8KB 3ROOA 4PLOB 4KROC 4QTHA 1DE4A 4WI5A 3RVWC 4NM4L 5FEBA 3CDFA 3HPLA 3VWJD 3JTSA 4Y88A 4F58L 4LHUG 5E6YA 4JHAL 4JO2H 1LDPL 4N8PA 2XG5A 3UYRL 4I3RL 3G5VA 4NNYB 1HN1A 1I9JL 3H9HB 5C0NC 1TZIB 3I75B 2Q86B 4QKXB 4HGKC 5J11C 5D1QC 5DEFB 1A7OH 4ZO7A 4X7TB 1J0IA 2FYYB 4KROB 5I0DA 1ZLUK 3F7YB 2WWKT 5T1LD 4H1LB 4YHZH 4PRHE 1Q9LB 4M03A 1QNZH 4X9HA 5DJAA 2ZCLH 4M6NH 4UV7H 1RZ8A 5F89B 4QRSA 1BQHG 4YE4H 3M8OL 5CWSB 1W72L 2VITA 3QUMA 2ICWI 4LPUA 4P49A 5J11B 5D1QB 5JW4N 4OLVL 2YA2A 1OP9A 4QXGH 4ZAKD 5F7KC 1ED3B 4Q7DA 4D9RE 5DJ0B 3M07A 3NCBB 3QCTL 3VFVB 3WL9B 1UJ3C 3RL1B 3SGDH 2PYEA 3U7YH 1H5BA 1OWRM 4FMKA 2WP3O 4PS4H 4Z7NE 1C7SA 2HLAB 1A5FH 1KCRH 2BSRA 4ZOAA 3MJ7A 5JHDE 1PJ9A 1VADA 3HNTH 5DQDH 5JW4M 3UTSD 4LSSL 4NO5A 4QOKE 1PYWA 1RZKC 3PIQB 4LARH 4TN9A 1YEFL 2FO4B 3BKYL 5C08D 2KQNA 2DBLL 4LLVB 3IFPA 1QA9B 1CXLA 4UDUB 1KN2L 2FH6A 1F4AA 3E6HA 3K1KC 5EOQL 1QFUL 4KY1H 2B4CH 1VFMA 1N59A 1T1YB 4G9FD 4L8SC 1UJ3B 3D2UB 2Y23A 3FOMA 2A73B 3OAZK 1CFSA 5BW7C 4K7FB 2LABA 4C4KO 1G1CA 3LD8C 4X6CF 4HJGB 4GW4A 1E27A 5BMFH 1MCJA 1BAFH 3RL2A 2GSGA 2ZG2A 5CD3B 4ZUTA 1T04A 1XGPB 3MLYH 1TCRB 5TH2A 1IC5L 3I3DA 4XBGB 5FKAB 2MOVA 2FATL 4L8SB 5I1KL 4XP4H 1RUPH 1F3RB 4C56B 2Q8AL 1ZK9A 5F70A 1UC6A 1UB6A 3MRPA 3LD8B 4JFFE 2R0ZL 3L3IB 5A43C 1OF2B 4OCRH 4PG2C 5JLZB 1XF2A 1CDHA 1PY9A 1X5JA 2YMXL 1K85A 5HI5D 3VMOA 4M48H 4P5TA 1PKQE 3B2UD 5D7LB 1LO4L 3HNVL 1JZ6A 3VXTA 1FO0H 4QF1B 3J7HA 4XVTL 2FWOA 5LG1A 5TE7H 1Q9OA 2BNQB 1DDHA 1U42A 1A7NH 3ARED 1CD1B 1P5UA 5C0CA 3FQRB 3UP1A 2A1WL 1IQDA 4MD4A 3IS1X 1NEZG 1T80A 5TPWH